123 Commits

Author SHA1 Message Date
af3e55e518 Fix some retarded bullshit 2025-08-22 00:10:46 +02:00
13b48229ac Fix some bullshit (the re) 2025-08-22 00:05:22 +02:00
670f6ed7a0 Add tests for EvalRegex 2025-08-21 23:56:05 +02:00
bbc7c50fae Decringe 2025-08-21 23:17:36 +02:00
779d1e0a0e Fix some more shit I guess 2025-08-21 23:16:23 +02:00
54581f0216 Clean up the cringe 2025-08-21 23:10:18 +02:00
3d01822e77 Fix failing test 2025-08-21 23:05:57 +02:00
4e0ca92c77 Add failing test 2025-08-21 23:05:57 +02:00
388e54b3e3 Add comprehensive help string for available Lua functions 2025-08-21 22:32:10 +02:00
6f2e76221a Add real regex support to lua 2025-08-21 22:27:37 +02:00
e0d3b938e3 Fix tests 2025-08-21 22:26:20 +02:00
491a030bf8 Hallucinate actual json fucking thing 2025-08-21 22:19:21 +02:00
bff7cc2a27 Hallucinate a json mode implementation 2025-08-21 20:39:35 +02:00
ff30b00e71 refactor(db.go, file.go): improve database error handling and file snapshot seeding 2025-08-09 16:12:26 +02:00
e1eb5eeaa6 Improve config readability by removing unnecessary fields and adding omitempty 2025-08-08 09:58:03 +02:00
2a2e11d8e0 Add more examples to the configuration file generator 2025-08-08 09:52:47 +02:00
6eb4f31127 Implement regexes, an entry option allow for same modification to apply to multiple regexes and variables that can be referenced in lua 2025-08-08 09:50:31 +02:00
4b58e00c26 Hallucinate some logs
Hallucinate more logs

fix(utils/db.go): handle auto migration errors gracefully

fix(utils/modifycommand.go): improve file matching accuracy

fix(processor/regex.go): improve capture group deduplication logic

fix(utils/db.go): add logging for database wrapper initialization

feat(processor/regex.go): preserve input order when deduplicating capture groups

fix(utils/modifycommand.go): add logging for file matching skips

feat(processor/regex.go): add logging for capture group processing

feat(main.go): add trace logging for arguments and parallel workers

fix(main.go): add trace logging for file content

fix(utils/db.go): add logging for database opening

fix(main.go): add trace logging for file processing

fix(utils/modifycommand.go): improve file matching by using absolute paths

feat(modifycommand.go): add trace logging for file matching in AssociateFilesWithCommands

feat(main.go): add per-file association summary for better visibility when debugging
2025-08-08 08:10:51 +02:00
8ffd8af13c Use atomic values instead of mutexes 2025-08-01 16:38:31 +02:00
67861d4455 Now only save CHANGED files to database (before changes of course) 2025-08-01 16:34:48 +02:00
299e6d8bfe Fix glob matching when backslashes are used as separators 2025-07-30 14:41:38 +02:00
388822e90a Create example yml even when no args are provided
ie. invalid usage
2025-07-30 14:38:29 +02:00
91993b4548 Improve error handling in ResetAllFiles function by logging warnings for failed file writes instead of returning errors 2025-07-27 12:47:21 +02:00
bb69558aaa Fix issue where invalid isolate commands would prevent other isolate commands from running 2025-07-21 21:28:12 +02:00
052c670627 Add a simple trim to lua 2025-07-21 21:00:11 +02:00
67fd215d0e Don't stroke out when backup doesn't exist in db 2025-07-20 11:48:55 +02:00
9ecbbff6fa Implement special flags for dump and reset db 2025-07-20 11:47:45 +02:00
774ac0f0ca Implement proper "reset" that reads snapshots from database 2025-07-20 11:43:25 +02:00
b785d24a08 Implement saving snapshots to a database 2025-07-20 11:38:08 +02:00
22f991e72e Clean up shop a bit 2025-07-20 11:20:19 +02:00
5518b27663 Remove deprecated flags and rename filter to f 2025-07-20 11:12:58 +02:00
0b899dea2c Add Disabled flag to ModifyCommand 2025-07-19 11:08:51 +02:00
3424fea8ad Dump a basic "config" to example usage on failed command 2025-07-19 01:15:48 +02:00
ddc1d83d58 Fix file associations
It was fucked because we were removing the static path and then cramming
that into assications
2025-04-22 10:53:25 +02:00
4b0a85411d From cook FILE - F I L E - FILEEEEE
This is the 4th time I make the SAME fix
2025-04-22 10:46:03 +02:00
46e871b626 Fix flag collision with logger 2025-04-22 10:45:11 +02:00
258dcc88e7 Fix reference to utils 2025-04-18 12:48:24 +02:00
75bf449bed Remove logger and replace it with a library 2025-04-18 12:47:47 +02:00
58586395fb Add file util for later 2025-04-13 21:31:19 +02:00
c5a68af5e6 PROPERLY implement doublestar 2025-04-13 21:29:18 +02:00
b4c0284734 Add rimworld cook file 2025-04-09 09:47:53 +02:00
c5d1dad8de Rename project to "cook" and ditch loading fgrom args, now files exclusively 2025-04-09 09:47:53 +02:00
4ff2ee80ee And fix the god damn backslashes fuck windows 2025-04-01 11:29:57 +02:00
633eebfd2a Support ~ in globs 2025-04-01 11:29:02 +02:00
5a31703840 Implement per command logger 2025-03-29 17:29:21 +01:00
162d0c758d Fix some tests 2025-03-29 17:29:21 +01:00
14d64495b6 Add deduplicate flag 2025-03-29 17:29:21 +01:00
fe6e97e832 Don't deduplicate (yet) 2025-03-29 17:23:21 +01:00
35b3d8b099 Reduce some of the reads and writes
It's really not necessary
2025-03-28 23:39:11 +01:00
2e3e958e15 Fix some tests and add some logs 2025-03-28 23:31:44 +01:00
955afc4295 Refactor running commands to separate functions 2025-03-28 16:59:22 +01:00
2c487bc443 Implement "Isolate" commands
Commands that run alone one by one on reading and writing the file
This should be used on commands that will modify a large part of the
file (or generally large parts)
Since that can fuck up the indices of other commands when ran together
2025-03-28 16:56:39 +01:00
b77224176b Add file lua value 2025-03-28 16:47:21 +01:00
a2201053c5 Remove some random ass fmt printf 2025-03-28 13:24:12 +01:00
04cedf5ece Fix the concurrent map writes 2025-03-28 11:35:38 +01:00
ebb07854cc Memoize the match table 2025-03-28 11:31:27 +01:00
8a86ae2f40 Add filter flag 2025-03-28 11:20:44 +01:00
e8f16dda2b Housekeeping 2025-03-28 02:14:27 +01:00
513773f641 Again 2025-03-28 01:26:26 +01:00
22914fe243 Add a lil log 2025-03-28 01:24:23 +01:00
2d523dfe64 Rename pattern to regex 2025-03-28 01:08:48 +01:00
2629722f67 Minor fixes and tweaks 2025-03-28 01:03:27 +01:00
1f6c4e4976 Fix up the tests and some minor bugs 2025-03-28 00:51:26 +01:00
bfd08e754e Replace old tests with asserts 2025-03-28 00:40:53 +01:00
750010b71a Add more tests to regex 2025-03-28 00:28:51 +01:00
9064a53820 Add more tests (and fix some things) for replacecommand 2025-03-28 00:23:42 +01:00
294c04a11a Add more tests for modifycommand 2025-03-28 00:03:23 +01:00
ba7ac07001 Fix up the logs a little 2025-03-27 23:36:56 +01:00
5d10178bf9 Update old and add new tests 2025-03-27 23:33:57 +01:00
f91c2b4795 More cleaning up 2025-03-27 23:07:22 +01:00
057db23d09 Implement panic recovery :?? 2025-03-27 23:06:46 +01:00
bf72734b90 Clean up regex.go a little 2025-03-27 23:04:39 +01:00
cc30c2bdcb Cleanup 2025-03-27 22:56:42 +01:00
f453079c72 Fix up regex.go 2025-03-27 22:50:15 +01:00
e634fe28bd Clean up processor 2025-03-27 22:24:59 +01:00
4e4b7bbd19 Implement parallel file processing 2025-03-27 22:22:43 +01:00
89eed3f847 Refactor git shit to its own module 2025-03-27 22:20:22 +01:00
f008efd5e1 Refactor modify and replace to their own files 2025-03-27 22:18:12 +01:00
f6def1e5a5 Refactor entirety of replace command to main for now 2025-03-27 22:11:03 +01:00
867b188718 Work out file reading and writing 2025-03-27 22:02:36 +01:00
aac29a4074 Refactor more stuff around 2025-03-27 21:58:52 +01:00
8a40f463f7 Implement file command association 2025-03-27 21:54:46 +01:00
8d4db1da91 Clean up code add some log lines and tidy up expandglobs 2025-03-27 21:49:28 +01:00
d41e2afe17 Update 2025-03-27 21:43:36 +01:00
76457d22cf Partially rework reading args to modify command loading 2025-03-27 21:39:16 +01:00
912950d463 Remove the vestiges of xml and json 2025-03-27 21:31:45 +01:00
25326ea11b Remove xml and json
They are simply not as useful as regex at all
There is nothing they can do regex cannot
And they have one massive penalty: the encoding
Which often results in MASSIVE diffs
2025-03-27 21:28:20 +01:00
df212b7fcc Remove jsonpath and xpath 2025-03-27 21:27:47 +01:00
f4a963760a Add dumptable helper function 2025-03-27 20:07:59 +01:00
d236811cb9 Introduce a new logging level for lua values 2025-03-27 20:06:50 +01:00
da93770334 Add strsplit lua helper 2025-03-27 19:56:31 +01:00
d9f54a8354 Fix test again 2025-03-27 19:49:57 +01:00
dc8da8ab63 Fix overlapping capture groups 2025-03-27 19:43:06 +01:00
24262a7dca Remove old unused xml files 2025-03-27 19:31:54 +01:00
d77b13c363 Update regression test 2025-03-27 19:31:20 +01:00
a9c60a3698 Neatly align log columns 2025-03-27 19:26:14 +01:00
66bcf21d79 Add goroutine numbers to log lines 2025-03-27 19:19:39 +01:00
e847e5c3ce Make little better logging 2025-03-27 18:53:02 +01:00
9a70c9696e Fix logger 2025-03-27 18:46:28 +01:00
9cea103042 Implement a more better logging solution 2025-03-27 17:53:43 +01:00
81d8259dfc Comment out some xml tests for now
We're not working on it for now
2025-03-27 17:46:43 +01:00
5c5fbac63f Make doublestar a little cleaner 2025-03-27 17:21:13 +01:00
3e818e61c7 Add string.format shortcut to lua 2025-03-27 15:38:07 +01:00
001470ffe4 Fix up regression tests 2025-03-27 15:37:57 +01:00
d88a76c4e2 Fix logging of groups 2025-03-26 22:26:02 +01:00
d3a1f1bd96 Rework regex grouping to avoid changing the same area twice 2025-03-26 22:24:19 +01:00
07a5f3f1a4 Add replaceCommands to avoid index suicide 2025-03-26 21:55:34 +01:00
e2257e082a Add a regression test 2025-03-26 21:55:17 +01:00
b3fce4244d Fix regex for numbers to support negative numbers 2025-03-26 18:30:21 +01:00
bd443067b6 Add support for !num inside of named capture groups 2025-03-26 14:04:39 +01:00
a9b6f7f984 Implement printing from lua 2025-03-26 13:37:39 +01:00
10c39b02a0 Fix some regex tests 2025-03-26 13:13:53 +01:00
7f4392b10e Implement "replacement" variable that simply replaces the match 2025-03-26 13:00:52 +01:00
7e19cf4e2c Rework named captures to be array
To comply with the whole reverse replacing
2025-03-26 12:50:55 +01:00
c5fb20e96a Implement named capture groups 2025-03-26 12:28:28 +01:00
a8c2257f20 Add named capture group tests 2025-03-26 12:17:01 +01:00
b63b4d1352 Add some more shorthands for regex 2025-03-26 12:06:04 +01:00
6a3d44ccd0 Redo what claude removed 2025-03-26 11:42:00 +01:00
c22e6ff41f Code polish 2025-03-26 11:40:23 +01:00
068c64d714 Fix up file reseting 2025-03-26 11:10:43 +01:00
2c7a4f5d97 Add a lot more logs to regex
What the fuck is going on?
2025-03-26 03:30:08 +01:00
0d7d251e76 Implement git reset 2025-03-26 03:23:16 +01:00
0d8c447ff6 Add support for git ie. automatically resetting changes to ensure clean slate 2025-03-26 03:22:05 +01:00
41 changed files with 8969 additions and 7398 deletions

3
.gitignore vendored
View File

@@ -1 +1,4 @@
*.exe
.qodo
*.sqlite
testfiles

105
.vscode/launch.json vendored
View File

@@ -5,16 +5,111 @@
"version": "0.2.0",
"configurations": [
{
"name": "Launch Package",
"name": "Launch Package (Barotrauma)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"*.yml",
]
},
{
"name": "Launch Package (Payday 2)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
"args": [
"-loglevel",
"trace",
"*.yml",
]
},
{
"name": "Launch Package (Barotrauma cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"cookassistant.yml",
]
},
{
"name": "Launch Package (Quasimorph cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
"args": [
"cook.yml",
]
},
{
"name": "Launch Package (Rimworld cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
"args": [
"cookVehicles.yml",
]
},
{
"name": "Launch Package (Workspace)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"args": [
"-mode=json",
"$..name",
"v='pero'",
"test.json"
"tester.yml",
]
},
{
"name": "Launch Package (Avorion)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
"args": [
"*.yml",
]
},
{
"name": "Launch Package (Minecraft)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Minecraft",
"args": [
"cook_tacz.yml",
]
},
{
"name": "Launch Package (ICARUS)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-ICARUS/Icarus/Saved/IME3/Mods",
"args": [
"-loglevel",
"trace",
"cook_processorrecipes.yml",
]
}
]

View File

@@ -1,651 +0,0 @@
<?xml version="1.0" encoding="utf-8"?>
<Talents>
<Talent identifier="powerarmor">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.powerarmor">
<Replace tag="[bonusmovement]" value="25" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHasItem tags="deepdivinglarge" />
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
</Abilities>
</AbilityGroupInterval>
<AddedRecipe itemidentifier="exosuit"/>
</Talent>
<Talent identifier="foolhardy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="foolhardy" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="berserker">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="berserker" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="mudraptorwrestler">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.mudraptorwrestler">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattypeself">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData weapontype="NoWeapon,Melee" />
<AbilityConditionCharacter>
<Conditional group="eq mudraptor" />
</AbilityConditionCharacter>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="heavylifting">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.heavylifting">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHoldingItem tags="alienartifact,crate"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="iamthatguy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.iamthatguy">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.skillbonus">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
<Abilities>
<CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="heavywrench"/>
</Talent>
<Talent identifier="robotics">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.robotics"/>
<Description tag="talentdescription.roboticsreminder">
<Replace tag="[amount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="defensebotspawner"/>
<AddedRecipe itemidentifier="defensebotammobox"/>
</Talent>
<Talent identifier="ironstorm">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.ironstorm">
<Replace tag="[chance]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="scrapcannon"/>
</Talent>
<Talent identifier="residualwaste">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.residualwaste">
<Replace tag="[chance]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomChance="0.2"/>
<!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
<AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="massproduction">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.massproduction">
<Replace tag="[chance]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
<Conditions>
<AbilityConditionServerRandom randomChance="0.4" />
</Conditions>
<Abilities>
<CharacterAbilityRemoveRandomIngredient>
<AbilityConditionItem category="Material"/>
</CharacterAbilityRemoveRandomIngredient>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="toolmaintenance">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.toolmaintenance">
<Replace tag="[amount]" value="1" color="gui.green"/>
</Description>
<!-- Give once when unlocking the talent -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupEffect>
<!-- Give every 60 seconds for late comers -->
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="miner">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
<Description tag="talentdescription.miner">
<Replace tag="[probability]" value="320" color="gui.green"/>
</Description>
<Description tag="talentdescription.gainoredetachspeed">
<Replace tag="[amount]" value="1600" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomchance="12.8"/>
<AbilityConditionItem tags="ore"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="retrofit">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.retrofit" />
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ironman">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="ironhelmet"/>
<AddedRecipe itemidentifier="makeshiftarmor"/>
</Talent>
<Talent identifier="oiledmachinery">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.oiledmachinery">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="pumpndump">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.pumpndump">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<conditions>
<AbilityConditionItem tags="pump"/>
</conditions>
<Abilities>
<CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ballastdenizen">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.ballastdenizen">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="engineengineer">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.engineengineer">
<Replace tag="[amount]" value="2.5" color="gui.green"/>
<Replace tag="[max]" value="5" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="1" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="2" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="3" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="4" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="5" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="6" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="7" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel minlevel="8" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="multifunctional">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.multifunctional">
<Replace tag="[powerincrease]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="wrenchitem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="crowbaritem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="salvagecrew">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.bonusxponmission">
<Replace tag="[xpbonus]" value="30" color="gui.green"/>
<Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
</Description>
<Description tag="talentdescription.salvagecrew">
<Replace tag="[swimbonus]" value="50" color="gui.green"/>
<Replace tag="[resistanceamount]" value="10" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
<Conditions>
<AbilityConditionMission missiontype="Salvage"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="1.3"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionInSubmarine submarinetype="Wreck" />
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="This" disabledeltatime="true">
<Affliction identifier="salvagecrew" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.machinemaniac">
<Replace tag="[bonus]" value="80" color="gui.green"/>
<Replace tag="[amount]" value="3" color="gui.orange"/>
</Description>
<Description tag="talentdescription.machinemaniac.30">
<Replace tag="[requirement]" value="12" color="gui.green"/>
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
<Replace tag="[xpamount]" value="500" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.50">
<Replace tag="[requirement]" value="20" color="gui.green"/>
<Replace tag="[level]" value="1" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.100">
<Replace tag="[requirement]" value="40" color="gui.green"/>
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<!-- Give the player stats that tracks if the rewards should be given -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
</Conditions>
<Abilities>
<CharacterAbilityGiveExperience amount="2000"/>
<CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
</Conditions>
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="tinkerer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.increasemaxrepairmechanical">
<Replace tag="[percentage]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="modularrepairs">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
</Description>
<Description tag="talentdescription.freeupgrade">
<Replace tag="[level]" value="1" color="gui.green"/>
<Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="repairpack"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="hullfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="25" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="fixfoamgrenade"/>
<AddedRecipe itemidentifier="handheldstatusmonitor"/>
</Talent>
<Talent identifier="letitdrain">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.letitdrain"/>
<Description tag="talentdescription.letitdrainreminder">
<Replace tag="[itemcount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="portablepump"/>
</Talent>
<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="scrapsavant">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
<Description tag="talentdescription.doublescrapoutput" />
<Description tag="talentdescription.findadditionalscrap">
<Replace tag="[probability]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionItem tags="scrap"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
<Conditions>
<AbilityConditionItemInSubmarine submarinetype="Wreck"/>
<AbilityConditionItem tags="container"/>
</Conditions>
<Abilities>
<CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
<StatusEffects>
<StatusEffect type="OnAbility" target="UseTarget" >
<SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
</StatusEffect>
</StatusEffects>
</CharacterAbilitySpawnItemsToContainer>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="safetyfirst">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="safetyharness"/>
</Talent>
</Talents>

View File

@@ -0,0 +1,28 @@
package main
import (
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
)
func main() {
// Initialize logger with DEBUG level
logger.Init(logger.LevelDebug)
// Test different log levels
logger.Info("This is an info message")
logger.Debug("This is a debug message")
logger.Warning("This is a warning message")
logger.Error("This is an error message")
logger.Trace("This is a trace message (not visible at DEBUG level)")
// Test with a goroutine
logger.SafeGo(func() {
time.Sleep(10 * time.Millisecond)
logger.Info("Message from goroutine")
})
// Wait for goroutine to complete
time.Sleep(20 * time.Millisecond)
}

View File

@@ -1,6 +1,7 @@
package main
import (
"cook/utils"
"os"
"path/filepath"
"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
files, err := expandFilePatterns(tc.patterns)
// Convert string patterns to map[string]struct{} for ExpandGLobs
patternMap := make(map[string]struct{})
for _, pattern := range tc.patterns {
patternMap[pattern] = struct{}{}
}
files, err := utils.ExpandGLobs(patternMap)
if err != nil {
t.Fatalf("expandFilePatterns failed: %v", err)
t.Fatalf("ExpandGLobs failed: %v", err)
}
if len(files) != tc.expected {

36
go.mod
View File

@@ -1,18 +1,36 @@
module modify
module cook
go 1.24.1
go 1.23.2
require (
github.com/PaesslerAG/jsonpath v0.1.1
github.com/antchfx/xmlquery v1.4.4
git.site.quack-lab.dev/dave/cylogger v1.3.0
github.com/bmatcuk/doublestar/v4 v4.8.1
github.com/stretchr/testify v1.10.0
github.com/yuin/gopher-lua v1.1.1
gopkg.in/yaml.v3 v3.0.1
gorm.io/gorm v1.30.0
)
require (
github.com/PaesslerAG/gval v1.0.0 // indirect
github.com/antchfx/xpath v1.3.3 // indirect
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da // indirect
golang.org/x/net v0.33.0 // indirect
golang.org/x/text v0.21.0 // indirect
github.com/davecgh/go-spew v1.1.1 // indirect
github.com/google/go-cmp v0.6.0 // indirect
github.com/hexops/valast v1.5.0 // indirect
github.com/jinzhu/inflection v1.0.0 // indirect
github.com/jinzhu/now v1.1.5 // indirect
github.com/kr/pretty v0.3.1 // indirect
github.com/mattn/go-sqlite3 v1.14.22 // indirect
github.com/pmezard/go-difflib v1.0.0 // indirect
github.com/rogpeppe/go-internal v1.14.1 // indirect
github.com/tidwall/gjson v1.18.0 // indirect
github.com/tidwall/match v1.1.1 // indirect
github.com/tidwall/pretty v1.2.0 // indirect
github.com/tidwall/sjson v1.2.5 // indirect
golang.org/x/mod v0.21.0 // indirect
golang.org/x/sync v0.11.0 // indirect
golang.org/x/text v0.22.0 // indirect
golang.org/x/tools v0.26.0 // indirect
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
mvdan.cc/gofumpt v0.4.0 // indirect
)
require gorm.io/driver/sqlite v1.6.0

140
go.sum
View File

@@ -1,82 +1,68 @@
github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw=
git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk=
github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da h1:oI5xCqsCo564l8iNU+DwB5epxmsaqB+rhGL0m5jtYqE=
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE=
github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps=
github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM=
github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs=
github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
github.com/tidwall/gjson v1.14.2/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk=
github.com/tidwall/gjson v1.18.0 h1:FIDeeyB800efLX89e5a8Y0BNH+LOngJyGrIWxG2FKQY=
github.com/tidwall/gjson v1.18.0/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk=
github.com/tidwall/match v1.1.1 h1:+Ho715JplO36QYgwN9PGYNhgZvoUSc9X2c80KVTi+GA=
github.com/tidwall/match v1.1.1/go.mod h1:eRSPERbgtNPcGhD8UCthc6PmLEQXEWd3PRB5JTxsfmM=
github.com/tidwall/pretty v1.2.0 h1:RWIZEg2iJ8/g6fDDYzMpobmaoGh5OLl4AXtGUGPcqCs=
github.com/tidwall/pretty v1.2.0/go.mod h1:ITEVvHYasfjBbM0u2Pg8T2nJnzm8xPwvNhhsoaGGjNU=
github.com/tidwall/sjson v1.2.5 h1:kLy8mja+1c9jlljvWTlSazM7cKDRfJuR/bOJhcY5NcY=
github.com/tidwall/sjson v1.2.5/go.mod h1:Fvgq9kS/6ociJEDnK0Fk1cpYF4FIW6ZF7LAe+6jwd28=
github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
golang.org/x/net v0.33.0 h1:74SYHlV8BIgHIFC/LrYkOGIwL19eTYXQ5wc6TBuO36I=
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo=
golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0=
golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY=
golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w=
golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ=
golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=

753
main.go
View File

@@ -1,178 +1,703 @@
package main
import (
"errors"
"flag"
"fmt"
"log"
"os"
"sort"
"sync"
"sync/atomic"
"time"
"github.com/bmatcuk/doublestar/v4"
"cook/processor"
"cook/utils"
"modify/processor"
"gopkg.in/yaml.v3"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// mainLogger is a scoped logger for the main package.
var mainLogger = logger.Default.WithPrefix("main")
type GlobalStats struct {
TotalMatches int
TotalModifications int
ProcessedFiles int
FailedFiles int
TotalMatches int64
TotalModifications int64
ProcessedFiles int64
FailedFiles int64
ModificationsPerCommand sync.Map
}
var stats GlobalStats
var logger *log.Logger
var (
jsonFlag = flag.Bool("json", false, "Process JSON files")
xmlFlag = flag.Bool("xml", false, "Process XML files")
stats GlobalStats = GlobalStats{
ModificationsPerCommand: sync.Map{},
}
)
func init() {
log.SetFlags(log.Lmicroseconds | log.Lshortfile)
logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
stats = GlobalStats{}
}
func main() {
// TODO: Implement some sort of git integration
// Maybe use go-git
// Specify a -git flag
// If we are operating with git then:
// Inmitialize a repo if one doesn't exist (try to open right?)
// For each file matched by glob first figure out if it's already tracked
// If not tracked then track it and commit (either it alone or maybe multiple together somehow)
// Then reset the file (to undo previous modifications)
// THEN change the file
// In addition add a -undo flag that will ONLY reset the files without changing them
// Only for the ones matched by glob
// ^ important because binary files would fuck us up
flag.Usage = func() {
CreateExampleConfig()
fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nOptions:\n")
fmt.Fprintf(os.Stderr, " -reset\n")
fmt.Fprintf(os.Stderr, " Reset files to their original state\n")
fmt.Fprintf(os.Stderr, " -loglevel string\n")
fmt.Fprintf(os.Stderr, " Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
fmt.Fprintf(os.Stderr, " -json\n")
fmt.Fprintf(os.Stderr, " Process JSON files\n")
fmt.Fprintf(os.Stderr, " -xml\n")
fmt.Fprintf(os.Stderr, " Process XML files\n")
fmt.Fprintf(os.Stderr, " -mode string\n")
fmt.Fprintf(os.Stderr, " Processing mode: regex, xml, json (default \"regex\")\n")
fmt.Fprintf(os.Stderr, " Enable JSON mode for processing JSON files\n")
fmt.Fprintf(os.Stderr, "\nExamples:\n")
fmt.Fprintf(os.Stderr, " Regex mode (default):\n")
fmt.Fprintf(os.Stderr, " %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " XML mode:\n")
fmt.Fprintf(os.Stderr, " %s -xml \"//value\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " %s \"<value>(\\\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " JSON mode:\n")
fmt.Fprintf(os.Stderr, " %s -json \"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
fmt.Fprintf(os.Stderr, " %s -json data.json\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
fmt.Fprintf(os.Stderr, " s1, s2, etc. are used to refer to capture groups as strings.\n")
fmt.Fprintf(os.Stderr, " Helper functions: num(str) converts string to number, str(num) converts number to string\n")
fmt.Fprintf(os.Stderr, " is_number(str) checks if a string is numeric\n")
fmt.Fprintf(os.Stderr, " For XML and JSON, the captured values are exposed as 'v', which can be of any type we capture (string, number, table).\n")
fmt.Fprintf(os.Stderr, " If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n")
fmt.Fprintf(os.Stderr, " You can use any valid Lua code, including if statements, loops, etc.\n")
fmt.Fprintf(os.Stderr, " Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
fmt.Fprintf(os.Stderr, "\nLua Functions Available:\n")
fmt.Fprintf(os.Stderr, "%s\n", processor.GetLuaFunctionsHelp())
}
// TODO: Fix bed shitting when doing *.yml in barotrauma directory
flag.Parse()
args := flag.Args()
if len(args) < 3 {
log.Printf("At least %d arguments are required", 3)
logger.InitFlag()
mainLogger.Info("Initializing with log level: %s", logger.GetLevel().String())
mainLogger.Trace("Full argv: %v", os.Args)
if flag.NArg() == 0 {
flag.Usage()
return
}
// Get the appropriate pattern and expression based on mode
var pattern, luaExpr string
var filePatterns []string
pattern = args[0]
luaExpr = args[1]
filePatterns = args[2:]
// Prepare the Lua expression
originalLuaExpr := luaExpr
luaExpr = processor.BuildLuaScript(luaExpr)
if originalLuaExpr != luaExpr {
logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
}
// Expand file patterns with glob support
files, err := expandFilePatterns(filePatterns)
mainLogger.Debug("Getting database connection")
db, err := utils.GetDB()
if err != nil {
fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
mainLogger.Error("Failed to get database: %v", err)
return
}
mainLogger.Debug("Database connection established")
workdone, err := HandleSpecialArgs(args, err, db)
if err != nil {
mainLogger.Error("Failed to handle special args: %v", err)
return
}
if workdone {
mainLogger.Info("Special arguments handled, exiting.")
return
}
if len(files) == 0 {
fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
// The plan is:
// Load all commands
mainLogger.Debug("Loading commands from arguments")
mainLogger.Trace("Arguments: %v", args)
commands, err := utils.LoadCommands(args)
if err != nil || len(commands) == 0 {
mainLogger.Error("Failed to load commands: %v", err)
flag.Usage()
return
}
// Collect global modifiers from special entries and filter them out
vars := map[string]interface{}{}
filtered := make([]utils.ModifyCommand, 0, len(commands))
for _, c := range commands {
if len(c.Modifiers) > 0 && c.Name == "" && c.Regex == "" && len(c.Regexes) == 0 && c.Lua == "" && len(c.Files) == 0 {
for k, v := range c.Modifiers {
vars[k] = v
}
continue
}
filtered = append(filtered, c)
}
if len(vars) > 0 {
mainLogger.Info("Loaded %d global modifiers", len(vars))
processor.SetVariables(vars)
}
commands = filtered
mainLogger.Info("Loaded %d commands", len(commands))
// Create the processor based on mode
var proc processor.Processor
switch {
case *xmlFlag:
proc = &processor.XMLProcessor{}
logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
pattern, luaExpr, len(files))
case *jsonFlag:
proc = &processor.JSONProcessor{}
logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
pattern, luaExpr, len(files))
default:
proc = &processor.RegexProcessor{}
logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
pattern, luaExpr, len(files))
if *utils.Filter != "" {
mainLogger.Info("Filtering commands by name: %s", *utils.Filter)
commands = utils.FilterCommands(commands, *utils.Filter)
mainLogger.Info("Filtered %d commands", len(commands))
}
var wg sync.WaitGroup
// Process each file
for _, file := range files {
wg.Add(1)
go func(file string) {
defer wg.Done()
logger.Printf("Processing file: %s", file)
// Then aggregate all the globs and deduplicate them
mainLogger.Debug("Aggregating globs and deduplicating")
globs := utils.AggregateGlobs(commands)
mainLogger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
// It's a bit fucked, maybe I could do better to call it from proc... But it'll do for now
modCount, matchCount, err := processor.Process(proc, file, pattern, luaExpr)
if err != nil {
fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
stats.FailedFiles++
for _, command := range commands {
mainLogger.Trace("Command: %s", command.Name)
if len(command.Regexes) > 0 {
mainLogger.Trace("Regexes: %v", command.Regexes)
} else {
logger.Printf("Successfully processed file: %s", file)
stats.ProcessedFiles++
stats.TotalMatches += matchCount
stats.TotalModifications += modCount
mainLogger.Trace("Regex: %s", command.Regex)
}
}(file)
mainLogger.Trace("Files: %v", command.Files)
mainLogger.Trace("Lua: %s", command.Lua)
mainLogger.Trace("Reset: %t", command.Reset)
mainLogger.Trace("Isolate: %t", command.Isolate)
mainLogger.Trace("LogLevel: %s", command.LogLevel)
}
// Resolve all the files for all the globs
mainLogger.Info("Found %d unique file patterns", len(globs))
mainLogger.Debug("Expanding glob patterns to files")
files, err := utils.ExpandGLobs(globs)
if err != nil {
mainLogger.Error("Failed to expand file patterns: %v", err)
return
}
mainLogger.Info("Found %d files to process", len(files))
mainLogger.Trace("Files to process: %v", files)
// Somehow connect files to commands via globs..
// For each file check every glob of every command
// Maybe memoize this part
// That way we know what commands affect what files
mainLogger.Debug("Associating files with commands")
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
mainLogger.Error("Failed to associate files with commands: %v", err)
return
}
mainLogger.Debug("Files associated with commands")
mainLogger.Trace("File-command associations: %v", associations)
// Per-file association summary for better visibility when debugging
for file, assoc := range associations {
cmdNames := make([]string, 0, len(assoc.Commands))
for _, c := range assoc.Commands {
cmdNames = append(cmdNames, c.Name)
}
isoNames := make([]string, 0, len(assoc.IsolateCommands))
for _, c := range assoc.IsolateCommands {
isoNames = append(isoNames, c.Name)
}
mainLogger.Debug("File %q has %d regular and %d isolate commands", file, len(assoc.Commands), len(assoc.IsolateCommands))
mainLogger.Trace("\tRegular: %v", cmdNames)
mainLogger.Trace("\tIsolate: %v", isoNames)
}
mainLogger.Debug("Resetting files where necessary")
err = utils.ResetWhereNecessary(associations, db)
if err != nil {
mainLogger.Error("Failed to reset files where necessary: %v", err)
return
}
mainLogger.Debug("Files reset where necessary")
// Then for each file run all commands associated with the file
workers := make(chan struct{}, *utils.ParallelFiles)
wg := sync.WaitGroup{}
mainLogger.Debug("Starting file processing with %d parallel workers", *utils.ParallelFiles)
// Add performance tracking
startTime := time.Now()
// Create a map to store loggers for each command
commandLoggers := make(map[string]*logger.Logger)
for _, command := range commands {
// Create a named logger for each command
cmdName := command.Name
if cmdName == "" {
// If no name is provided, use a short version of the regex pattern
if len(command.Regex) > 20 {
cmdName = command.Regex[:17] + "..."
} else {
cmdName = command.Regex
}
}
// Parse the log level for this specific command
cmdLogLevel := logger.ParseLevel(command.LogLevel)
// Create a logger with the command name as a field
commandLoggers[command.Name] = logger.Default.WithField("command", cmdName)
commandLoggers[command.Name].SetLevel(cmdLogLevel)
mainLogger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
}
for file, association := range associations {
workers <- struct{}{}
wg.Add(1)
logger.SafeGoWithArgs(func(args ...interface{}) {
defer func() { <-workers }()
defer wg.Done()
// Track per-file processing time
fileStartTime := time.Now()
mainLogger.Debug("Reading file %q", file)
fileData, err := os.ReadFile(file)
if err != nil {
mainLogger.Error("Failed to read file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
fileDataStr := string(fileData)
mainLogger.Trace("File %q content: %s", file, utils.LimitString(fileDataStr, 500))
isChanged := false
mainLogger.Debug("Running isolate commands for file %q", file)
fileDataStr, err = RunIsolateCommands(association, file, fileDataStr)
if err != nil && err != NothingToDo {
mainLogger.Error("Failed to run isolate commands for file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
if err != NothingToDo {
isChanged = true
}
mainLogger.Debug("Running other commands for file %q", file)
fileDataStr, err = RunOtherCommands(file, fileDataStr, association, commandLoggers)
if err != nil && err != NothingToDo {
mainLogger.Error("Failed to run other commands for file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
if err != NothingToDo {
isChanged = true
}
if isChanged {
mainLogger.Debug("Saving file %q to database", file)
err = db.SaveFile(file, fileData)
if err != nil {
mainLogger.Error("Failed to save file %q to database: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
mainLogger.Debug("File %q saved to database", file)
}
mainLogger.Debug("Writing file %q", file)
err = os.WriteFile(file, []byte(fileDataStr), 0644)
if err != nil {
mainLogger.Error("Failed to write file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
mainLogger.Debug("File %q written", file)
// Only increment ProcessedFiles once per file, after all processing is complete
atomic.AddInt64(&stats.ProcessedFiles, 1)
mainLogger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
}, file, commands)
}
wg.Wait()
processingTime := time.Since(startTime)
mainLogger.Info("Processing completed in %v", processingTime)
processedFiles := atomic.LoadInt64(&stats.ProcessedFiles)
if processedFiles > 0 {
mainLogger.Info("Average time per file: %v", processingTime/time.Duration(processedFiles))
}
// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
// Do that with logger.WithField("loglevel", level.String())
// Since each command also has its own log level
// TODO: Maybe even figure out how to run individual commands...?
// TODO: What to do with git? Figure it out ....
// if *gitFlag {
// mainLogger.Info("Git integration enabled, setting up git repository")
// err := setupGit()
// if err != nil {
// mainLogger.Error("Failed to setup git: %v", err)
// fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
// return
// }
// }
// mainLogger.Debug("Expanding file patterns")
// files, err := expandFilePatterns(filePatterns)
// if err != nil {
// mainLogger.Error("Failed to expand file patterns: %v", err)
// fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
// return
// }
// if *gitFlag {
// mainLogger.Info("Cleaning up git files before processing")
// err := cleanupGitFiles(files)
// if err != nil {
// mainLogger.Error("Failed to cleanup git files: %v", err)
// fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
// return
// }
// }
// if *resetFlag {
// mainLogger.Info("Files reset to their original state, nothing more to do")
// log.Printf("Files reset to their original state, nothing more to do")
// return
// }
// Print summary
if stats.TotalModifications == 0 {
fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
totalModifications := atomic.LoadInt64(&stats.TotalModifications)
if totalModifications == 0 {
mainLogger.Warning("No modifications were made in any files")
} else {
fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
}
}
failedFiles := atomic.LoadInt64(&stats.FailedFiles)
mainLogger.Info("Operation complete! Modified %d values in %d/%d files",
totalModifications, processedFiles, processedFiles+failedFiles)
sortedCommands := []string{}
stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
sortedCommands = append(sortedCommands, key.(string))
return true
})
sort.Strings(sortedCommands)
func expandFilePatterns(patterns []string) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
for _, pattern := range patterns {
matches, _ := doublestar.Glob(os.DirFS("."), pattern)
for _, m := range matches {
if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
filesMap[m], files = true, append(files, m)
for _, command := range sortedCommands {
count, _ := stats.ModificationsPerCommand.Load(command)
if count.(int) > 0 {
mainLogger.Info("\tCommand %q made %d modifications", command, count)
} else {
mainLogger.Warning("\tCommand %q made no modifications", command)
}
}
}
}
if len(files) > 0 {
logger.Printf("Found %d files to process", len(files))
func HandleSpecialArgs(args []string, err error, db utils.DB) (bool, error) {
handleSpecialArgsLogger := logger.Default.WithPrefix("HandleSpecialArgs")
handleSpecialArgsLogger.Debug("Handling special arguments: %v", args)
switch args[0] {
case "reset":
handleSpecialArgsLogger.Info("Resetting all files")
err = utils.ResetAllFiles(db)
if err != nil {
handleSpecialArgsLogger.Error("Failed to reset all files: %v", err)
return true, err
}
return files, nil
handleSpecialArgsLogger.Info("All files reset")
return true, nil
case "dump":
handleSpecialArgsLogger.Info("Dumping all files from database")
err = db.RemoveAllFiles()
if err != nil {
handleSpecialArgsLogger.Error("Failed to remove all files from database: %v", err)
return true, err
}
handleSpecialArgsLogger.Info("All files removed from database")
return true, nil
}
handleSpecialArgsLogger.Debug("No special arguments handled, returning false")
return false, nil
}
func CreateExampleConfig() {
createExampleConfigLogger := logger.Default.WithPrefix("CreateExampleConfig")
createExampleConfigLogger.Debug("Creating example configuration file")
commands := []utils.ModifyCommand{
// Global modifiers only entry (no name/regex/lua/files)
{
Modifiers: map[string]interface{}{
"foobar": 4,
"multiply": 1.5,
"prefix": "NEW_",
"enabled": true,
},
},
// Multi-regex example using $variable in Lua
{
Name: "RFToolsMultiply",
Regexes: []string{"generatePerTick = !num", "ticksPer\\w+ = !num", "generatorRFPerTick = !num"},
Lua: "* $foobar",
Files: []string{"polymc/instances/**/rftools*.toml", `polymc\\instances\\**\\rftools*.toml`},
Reset: true,
// LogLevel defaults to INFO
},
// Named capture groups with arithmetic and string ops
{
Name: "UpdateAmountsAndItems",
Regex: `(?P<amount>!num)\s+units\s+of\s+(?P<item>[A-Za-z_\-]+)`,
Lua: `amount = amount * $multiply; item = upper(item); return true`,
Files: []string{"data/**/*.txt"},
// INFO log level
},
// Full replacement via Lua 'replacement' variable
{
Name: "BumpMinorVersion",
Regex: `version\s*=\s*"(?P<major>!num)\.(?P<minor>!num)\.(?P<patch>!num)"`,
Lua: `replacement = format("version=\"%s.%s.%s\"", major, num(minor)+1, 0); return true`,
Files: []string{"config/*.ini", "config/*.cfg"},
},
// Multiline regex example (DOTALL is auto-enabled). Captures numeric in nested XML.
{
Name: "XMLNestedValueMultiply",
Regex: `<item>\s*\s*<name>!any<\/name>\s*\s*<value>(!num)<\/value>\s*\s*<\/item>`,
Lua: `* $multiply`,
Files: []string{"data/**/*.xml"},
// Demonstrates multiline regex in YAML
},
// Multiline regexES array, with different patterns handled by same Lua
{
Name: "MultiLinePatterns",
Regexes: []string{
`<entry>\s*\n\s*<id>(?P<id>!num)</id>\s*\n\s*<score>(?P<score>!num)</score>\s*\n\s*</entry>`,
`\[block\]\nkey=(?P<key>[A-Za-z_]+)\nvalue=(?P<val>!num)`,
},
Lua: `if is_number(score) then score = score * 2 end; if is_number(val) then val = val * 3 end; return true`,
Files: []string{"examples/**/*.*"},
LogLevel: "DEBUG",
},
// Use equals operator shorthand and boolean variable
{
Name: "EnableFlags",
Regex: `enabled\s*=\s*(true|false)`,
Lua: `= $enabled`,
Files: []string{"**/*.toml"},
},
// Demonstrate NoDedup to allow overlapping replacements
{
Name: "OverlappingGroups",
Regex: `(?P<a>!num)(?P<b>!num)`,
Lua: `a = num(a) + 1; b = num(b) + 1; return true`,
Files: []string{"overlap/**/*.txt"},
NoDedup: true,
},
// Isolate command example operating on entire matched block
{
Name: "IsolateUppercaseBlock",
Regex: `BEGIN\n(?P<block>!any)\nEND`,
Lua: `block = upper(block); return true`,
Files: []string{"logs/**/*.log"},
Isolate: true,
LogLevel: "TRACE",
},
// Using !rep placeholder and arrays of files
{
Name: "RepeatPlaceholderExample",
Regex: `name: (.*) !rep(, .* , 2)`,
Lua: `-- no-op, just demonstrate placeholder; return false`,
Files: []string{"lists/**/*.yml", "lists/**/*.yaml"},
},
// Using string variable in Lua expression
{
Name: "PrefixKeys",
Regex: `(?P<key>[A-Za-z0-9_]+)\s*=`,
Lua: `key = $prefix .. key; return true`,
Files: []string{"**/*.properties"},
},
// JSON mode examples
{
Name: "JSONArrayMultiply",
JSON: true,
Lua: `for i, item in ipairs(data.items) do data.items[i].value = item.value * 2 end; return true`,
Files: []string{"data/**/*.json"},
},
{
Name: "JSONObjectUpdate",
JSON: true,
Lua: `data.version = "2.0.0"; data.enabled = true; return true`,
Files: []string{"config/**/*.json"},
},
{
Name: "JSONNestedModify",
JSON: true,
Lua: `if data.settings and data.settings.performance then data.settings.performance.multiplier = data.settings.performance.multiplier * 1.5 end; return true`,
Files: []string{"settings/**/*.json"},
},
}
data, err := yaml.Marshal(commands)
if err != nil {
createExampleConfigLogger.Error("Failed to marshal example config: %v", err)
return
}
createExampleConfigLogger.Debug("Writing example_cook.yml")
err = os.WriteFile("example_cook.yml", data, 0644)
if err != nil {
createExampleConfigLogger.Error("Failed to write example_cook.yml: %v", err)
return
}
createExampleConfigLogger.Info("Wrote example_cook.yml")
}
var NothingToDo = errors.New("nothing to do")
func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, commandLoggers map[string]*logger.Logger) (string, error) {
runOtherCommandsLogger := mainLogger.WithPrefix("RunOtherCommands").WithField("file", file)
runOtherCommandsLogger.Debug("Running other commands for file")
runOtherCommandsLogger.Trace("File data before modifications: %s", utils.LimitString(fileDataStr, 200))
// Separate JSON and regex commands for different processing approaches
jsonCommands := []utils.ModifyCommand{}
regexCommands := []utils.ModifyCommand{}
for _, command := range association.Commands {
if command.JSON || *utils.JSON {
jsonCommands = append(jsonCommands, command)
} else {
regexCommands = append(regexCommands, command)
}
}
// Process JSON commands sequentially (each operates on the entire file)
for _, command := range jsonCommands {
cmdLogger := logger.Default
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
}
cmdLogger.Debug("Processing file with JSON mode for command %q", command.Name)
newModifications, err := processor.ProcessJSON(fileDataStr, command, file)
if err != nil {
runOtherCommandsLogger.Error("Failed to process file with JSON command %q: %v", command.Name, err)
continue
}
// Apply JSON modifications immediately
if len(newModifications) > 0 {
var count int
fileDataStr, count = utils.ExecuteModifications(newModifications, fileDataStr)
atomic.AddInt64(&stats.TotalModifications, int64(count))
cmdLogger.Debug("Applied %d JSON modifications for command %q", count, command.Name)
}
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
}
// Aggregate regex modifications and execute them
modifications := []utils.ReplaceCommand{}
numCommandsConsidered := 0
for _, command := range regexCommands {
cmdLogger := logger.Default
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
}
patterns := command.Regexes
if len(patterns) == 0 {
patterns = []string{command.Regex}
}
for idx, pattern := range patterns {
tmpCmd := command
tmpCmd.Regex = pattern
cmdLogger.Debug("Begin processing file with command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
numCommandsConsidered++
newModifications, err := processor.ProcessRegex(fileDataStr, tmpCmd, file)
if err != nil {
runOtherCommandsLogger.Error("Failed to process file with command %q: %v", command.Name, err)
continue
}
modifications = append(modifications, newModifications...)
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
cmdLogger.Debug("Command %q generated %d modifications (pattern %d/%d)", command.Name, len(newModifications), idx+1, len(patterns))
cmdLogger.Trace("Modifications generated by command %q: %v", command.Name, newModifications)
if len(newModifications) == 0 {
cmdLogger.Debug("No modifications yielded by command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
}
}
}
runOtherCommandsLogger.Debug("Aggregated %d modifications from %d command-pattern runs", len(modifications), numCommandsConsidered)
runOtherCommandsLogger.Trace("All aggregated modifications: %v", modifications)
if len(modifications) == 0 {
runOtherCommandsLogger.Warning("No modifications found for file")
return fileDataStr, NothingToDo
}
runOtherCommandsLogger.Debug("Executing %d modifications for file", len(modifications))
// Sort commands in reverse order for safe replacements
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
runOtherCommandsLogger.Trace("File data after modifications: %s", utils.LimitString(fileDataStr, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
runOtherCommandsLogger.Info("Executed %d modifications for file", count)
return fileDataStr, nil
}
func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string) (string, error) {
runIsolateCommandsLogger := mainLogger.WithPrefix("RunIsolateCommands").WithField("file", file)
runIsolateCommandsLogger.Debug("Running isolate commands for file")
runIsolateCommandsLogger.Trace("File data before isolate modifications: %s", utils.LimitString(fileDataStr, 200))
anythingDone := false
for _, isolateCommand := range association.IsolateCommands {
// Check if this isolate command should use JSON mode
if isolateCommand.JSON || *utils.JSON {
runIsolateCommandsLogger.Debug("Begin processing file with JSON isolate command %q", isolateCommand.Name)
modifications, err := processor.ProcessJSON(fileDataStr, isolateCommand, file)
if err != nil {
runIsolateCommandsLogger.Error("Failed to process file with JSON isolate command %q: %v", isolateCommand.Name, err)
continue
}
if len(modifications) == 0 {
runIsolateCommandsLogger.Debug("JSON isolate command %q produced no modifications", isolateCommand.Name)
continue
}
anythingDone = true
runIsolateCommandsLogger.Debug("Executing %d JSON isolate modifications for file", len(modifications))
runIsolateCommandsLogger.Trace("JSON isolate modifications: %v", modifications)
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
runIsolateCommandsLogger.Trace("File data after JSON isolate modifications: %s", utils.LimitString(fileDataStr, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
runIsolateCommandsLogger.Info("Executed %d JSON isolate modifications for file", count)
} else {
// Regular regex processing for isolate commands
runIsolateCommandsLogger.Debug("Begin processing file with isolate command %q", isolateCommand.Regex)
patterns := isolateCommand.Regexes
if len(patterns) == 0 {
patterns = []string{isolateCommand.Regex}
}
for idx, pattern := range patterns {
tmpCmd := isolateCommand
tmpCmd.Regex = pattern
modifications, err := processor.ProcessRegex(fileDataStr, tmpCmd, file)
if err != nil {
runIsolateCommandsLogger.Error("Failed to process file with isolate command %q (pattern %d/%d): %v", isolateCommand.Name, idx+1, len(patterns), err)
continue
}
if len(modifications) == 0 {
runIsolateCommandsLogger.Debug("Isolate command %q produced no modifications (pattern %d/%d)", isolateCommand.Name, idx+1, len(patterns))
continue
}
anythingDone = true
runIsolateCommandsLogger.Debug("Executing %d isolate modifications for file", len(modifications))
runIsolateCommandsLogger.Trace("Isolate modifications: %v", modifications)
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
runIsolateCommandsLogger.Trace("File data after isolate modifications: %s", utils.LimitString(fileDataStr, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
runIsolateCommandsLogger.Info("Executed %d isolate modifications for file", count)
}
}
}
if !anythingDone {
runIsolateCommandsLogger.Debug("No isolate modifications were made for file")
return fileDataStr, NothingToDo
}
return fileDataStr, nil
}

View File

@@ -1,165 +1,634 @@
package processor
import (
"cook/utils"
"encoding/json"
"fmt"
"log"
"modify/processor/jsonpath"
"sort"
"strconv"
"strings"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/tidwall/gjson"
lua "github.com/yuin/gopher-lua"
)
// JSONProcessor implements the Processor interface for JSON documents
type JSONProcessor struct{}
// jsonLogger is a scoped logger for the processor/json package.
var jsonLogger = logger.Default.WithPrefix("processor/json")
// ProcessContent implements the Processor interface for JSONProcessor
func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse JSON document
// ProcessJSON applies Lua processing to JSON content
func ProcessJSON(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
processJsonLogger := jsonLogger.WithPrefix("ProcessJSON").WithField("commandName", command.Name).WithField("file", filename)
processJsonLogger.Debug("Starting JSON processing for file")
processJsonLogger.Trace("Initial file content length: %d", len(content))
var commands []utils.ReplaceCommand
startTime := time.Now()
// Parse JSON content
var jsonData interface{}
err := json.Unmarshal([]byte(content), &jsonData)
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
processJsonLogger.Error("Failed to parse JSON content: %v", err)
return commands, fmt.Errorf("failed to parse JSON: %v", err)
}
processJsonLogger.Debug("Successfully parsed JSON content")
// Find nodes matching the JSONPath pattern
nodes, err := jsonpath.Get(jsonData, pattern)
if err != nil {
return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
modCount := 0
for _, node := range nodes {
log.Printf("Processing node at path: %s with value: %v", node.Path, node.Value)
// Initialize Lua
// Create Lua state
L, err := NewLuaState()
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
processJsonLogger.Error("Error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
log.Println("Lua state initialized successfully.")
err = p.ToLua(L, node.Value)
// Set filename global
L.SetGlobal("file", lua.LString(filename))
// Convert JSON data to Lua table
luaTable, err := ToLuaTable(L, jsonData)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
processJsonLogger.Error("Failed to convert JSON to Lua table: %v", err)
return commands, fmt.Errorf("failed to convert JSON to Lua table: %v", err)
}
log.Printf("Converted node value to Lua: %v", node.Value)
originalScript := luaExpr
fullScript := BuildLuaScript(luaExpr)
log.Printf("Original script: %q, Full script: %q", originalScript, fullScript)
// Set the JSON data as a global variable
L.SetGlobal("data", luaTable)
processJsonLogger.Debug("Set JSON data as Lua global 'data'")
// Execute Lua script
log.Printf("Executing Lua script: %q", fullScript)
if err := L.DoString(fullScript); err != nil {
return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
// Build and execute Lua script for JSON mode
luaExpr := BuildJSONLuaScript(command.Lua)
processJsonLogger.Debug("Built Lua script from expression: %q", command.Lua)
processJsonLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
if err := L.DoString(luaExpr); err != nil {
processJsonLogger.Error("Lua script execution failed: %v\nScript: %s", err, utils.LimitString(luaExpr, 200))
return commands, fmt.Errorf("lua script execution failed: %v", err)
}
log.Println("Lua script executed successfully.")
processJsonLogger.Debug("Lua script executed successfully")
// Get modified value
result, err := p.FromLua(L)
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
processJsonLogger.Debug("Skipping - no modifications indicated by Lua script")
return commands, nil
}
// Get the modified data from Lua
modifiedData := L.GetGlobal("data")
if modifiedData.Type() != lua.LTTable {
processJsonLogger.Error("Expected 'data' to be a table after Lua processing, got %s", modifiedData.Type().String())
return commands, fmt.Errorf("expected 'data' to be a table after Lua processing")
}
// Convert back to Go interface
goData, err := FromLua(L, modifiedData)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
processJsonLogger.Error("Failed to convert Lua table back to Go: %v", err)
return commands, fmt.Errorf("failed to convert Lua table back to Go: %v", err)
}
log.Printf("Retrieved modified value from Lua: %v", result)
modified := false
modified = L.GetGlobal("modified").String() == "true"
if !modified {
log.Printf("No changes made to node at path: %s", node.Path)
commands, err = applyJSONChanges(content, jsonData, goData)
if err != nil {
processJsonLogger.Error("Failed to apply JSON changes: %v", err)
return commands, fmt.Errorf("failed to apply JSON changes: %v", err)
}
processJsonLogger.Debug("Total JSON processing time: %v", time.Since(startTime))
processJsonLogger.Debug("Generated %d total modifications", len(commands))
return commands, nil
}
// applyJSONChanges compares original and modified data and applies changes surgically
func applyJSONChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
var commands []utils.ReplaceCommand
appliedCommands, err := applyChanges(content, originalData, modifiedData)
if err == nil && len(appliedCommands) > 0 {
return appliedCommands, nil
}
return commands, fmt.Errorf("failed to make any changes to the json")
}
// applyChanges attempts to make surgical changes while preserving exact formatting
func applyChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
var commands []utils.ReplaceCommand
// Find all changes between original and modified data
changes := findDeepChanges("", originalData, modifiedData)
jsonLogger.Debug("applyChanges: Found %d changes: %v", len(changes), changes)
if len(changes) == 0 {
return commands, nil
}
// Sort removal operations by index in descending order to avoid index shifting
var removals []string
var additions []string
var valueChanges []string
for path := range changes {
if strings.HasSuffix(path, "@remove") {
removals = append(removals, path)
} else if strings.HasSuffix(path, "@add") {
additions = append(additions, path)
} else {
valueChanges = append(valueChanges, path)
}
}
jsonLogger.Debug("applyChanges: %d removals, %d additions, %d value changes", len(removals), len(additions), len(valueChanges))
// Apply removals first (from end to beginning to avoid index shifting)
for _, removalPath := range removals {
actualPath := strings.TrimSuffix(removalPath, "@remove")
index := extractIndexFromRemovalPath(removalPath)
arrayPath := getArrayPathFromElementPath(actualPath)
// Get the array element to remove
result := gjson.Get(content, actualPath)
if !result.Exists() {
continue
}
// Apply the modification to the JSON data
err = p.updateJSONValue(jsonData, node.Path, result)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
// Find the exact byte range to remove (including comma/formatting)
startPos, endPos := findArrayElementRemovalRange(content, arrayPath, index)
if startPos >= 0 && endPos > startPos {
commands = append(commands, utils.ReplaceCommand{
From: startPos,
To: endPos,
With: "", // Remove the element
})
}
log.Printf("Updated JSON at path: %s with new value: %v", node.Path, result)
modCount++
}
// Convert the modified JSON back to a string with same formatting
var jsonBytes []byte
jsonBytes, err = json.MarshalIndent(jsonData, "", " ")
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
}
return string(jsonBytes), modCount, matchCount, nil
// Apply additions (new fields)
for _, additionPath := range additions {
actualPath := strings.TrimSuffix(additionPath, "@add")
newValue := changes[additionPath]
jsonLogger.Debug("Processing addition: path=%s, value=%v", actualPath, newValue)
// Find the parent object to add the field to
parentPath := getParentPath(actualPath)
fieldName := getFieldName(actualPath)
jsonLogger.Debug("Parent path: %s, field name: %s", parentPath, fieldName)
// Get the parent object
var parentResult gjson.Result
if parentPath == "" {
// Adding to root object - get the entire JSON
parentResult = gjson.Parse(content)
} else {
parentResult = gjson.Get(content, parentPath)
}
// updateJSONValue updates a value in the JSON structure based on its JSONPath
func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
// Special handling for root node
if path == "$" {
// For the root node, we'll copy the value to the jsonData reference
// This is a special case since we can't directly replace the interface{} variable
if !parentResult.Exists() {
jsonLogger.Debug("Parent path %s does not exist, skipping", parentPath)
continue
}
// We need to handle different types of root elements
switch rootValue := newValue.(type) {
// Find where to insert the new field (at the end of the object)
startPos := int(parentResult.Index + len(parentResult.Raw) - 1) // Before closing brace
jsonLogger.Debug("Inserting at pos %d", startPos)
// Convert the new value to JSON string
newValueStr := convertValueToJSONString(newValue)
// Insert the new field
insertText := fmt.Sprintf(`,"%s":%s`, fieldName, newValueStr)
jsonLogger.Debug("Inserting text: %q", insertText)
commands = append(commands, utils.ReplaceCommand{
From: startPos,
To: startPos,
With: insertText,
})
jsonLogger.Debug("Added addition command: From=%d, To=%d, With=%q", startPos, startPos, insertText)
}
// Apply value changes (in reverse order to avoid position shifting)
sort.Slice(valueChanges, func(i, j int) bool {
// Get positions for comparison
resultI := gjson.Get(content, valueChanges[i])
resultJ := gjson.Get(content, valueChanges[j])
return resultI.Index > resultJ.Index // Descending order
})
for _, path := range valueChanges {
newValue := changes[path]
jsonLogger.Debug("Processing value change: path=%s, value=%v", path, newValue)
// Get the current value and its position in the original JSON
result := gjson.Get(content, path)
if !result.Exists() {
jsonLogger.Debug("Path %s does not exist, skipping", path)
continue // Skip if path doesn't exist
}
// Get the exact byte positions of this value
startPos := result.Index
endPos := startPos + len(result.Raw)
jsonLogger.Debug("Found value at pos %d-%d: %q", startPos, endPos, result.Raw)
// Convert the new value to JSON string
newValueStr := convertValueToJSONString(newValue)
jsonLogger.Debug("Converting to: %q", newValueStr)
// Create a replacement command for this specific value
commands = append(commands, utils.ReplaceCommand{
From: int(startPos),
To: int(endPos),
With: newValueStr,
})
jsonLogger.Debug("Added command: From=%d, To=%d, With=%q", int(startPos), int(endPos), newValueStr)
}
return commands, nil
}
// extractIndexFromRemovalPath extracts the array index from a removal path like "Rows.0.Inputs.1@remove"
func extractIndexFromRemovalPath(path string) int {
parts := strings.Split(strings.TrimSuffix(path, "@remove"), ".")
if len(parts) > 0 {
lastPart := parts[len(parts)-1]
if index, err := strconv.Atoi(lastPart); err == nil {
return index
}
}
return -1
}
// getArrayPathFromElementPath converts "Rows.0.Inputs.1" to "Rows.0.Inputs"
func getArrayPathFromElementPath(elementPath string) string {
parts := strings.Split(elementPath, ".")
if len(parts) > 0 {
return strings.Join(parts[:len(parts)-1], ".")
}
return ""
}
// getParentPath extracts the parent path from a full path like "Rows.0.Inputs.1"
func getParentPath(fullPath string) string {
parts := strings.Split(fullPath, ".")
if len(parts) > 0 {
return strings.Join(parts[:len(parts)-1], ".")
}
return ""
}
// getFieldName extracts the field name from a full path like "Rows.0.Inputs.1"
func getFieldName(fullPath string) string {
parts := strings.Split(fullPath, ".")
if len(parts) > 0 {
return parts[len(parts)-1]
}
return ""
}
// convertValueToJSONString converts a Go interface{} to a JSON string representation
func convertValueToJSONString(value interface{}) string {
switch v := value.(type) {
case string:
return `"` + strings.ReplaceAll(v, `"`, `\"`) + `"`
case float64:
if v == float64(int64(v)) {
return strconv.FormatInt(int64(v), 10)
}
return strconv.FormatFloat(v, 'f', -1, 64)
case bool:
return strconv.FormatBool(v)
case nil:
return "null"
default:
// For complex types, we need to avoid json.Marshal
// This should not happen if we're doing true surgical edits
return ""
}
}
// findArrayElementRemovalRange finds the exact byte range to remove for an array element
func findArrayElementRemovalRange(content, arrayPath string, elementIndex int) (int, int) {
// Get the array using gjson
arrayResult := gjson.Get(content, arrayPath)
if !arrayResult.Exists() || !arrayResult.IsArray() {
return -1, -1
}
// Get all array elements
elements := arrayResult.Array()
if elementIndex >= len(elements) {
return -1, -1
}
// Get the target element
elementResult := elements[elementIndex]
startPos := int(elementResult.Index)
endPos := int(elementResult.Index + len(elementResult.Raw))
// Handle comma removal properly
if elementIndex == 0 && len(elements) > 1 {
// First element but not the only one - remove comma after
for i := endPos; i < len(content) && i < endPos+50; i++ {
if content[i] == ',' {
endPos = i + 1
break
}
}
} else if elementIndex == len(elements)-1 && len(elements) > 1 {
// Last element and not the only one - remove comma before
prevElementEnd := int(elements[elementIndex-1].Index + len(elements[elementIndex-1].Raw))
for i := prevElementEnd; i < startPos && i < len(content); i++ {
if content[i] == ',' {
startPos = i
break
}
}
}
// If it's the only element, don't remove any commas
return startPos, endPos
}
// findDeepChanges recursively finds all paths that need to be changed
func findDeepChanges(basePath string, original, modified interface{}) map[string]interface{} {
changes := make(map[string]interface{})
switch orig := original.(type) {
case map[string]interface{}:
// For objects, we need to copy over all keys
rootMap, ok := jsonData.(map[string]interface{})
if !ok {
// If the original wasn't a map, completely replace it with the new map
// This is handled by the jsonpath.Set function
return jsonpath.Set(jsonData, path, newValue)
if mod, ok := modified.(map[string]interface{}); ok {
// Check for new keys added in modified data
for key, modValue := range mod {
var currentPath string
if basePath == "" {
currentPath = key
} else {
currentPath = basePath + "." + key
}
// Clear the original map
for k := range rootMap {
delete(rootMap, k)
if origValue, exists := orig[key]; exists {
// Key exists in both, check if value changed
switch modValue.(type) {
case map[string]interface{}, []interface{}:
// Recursively check nested structures
nestedChanges := findDeepChanges(currentPath, origValue, modValue)
for nestedPath, nestedValue := range nestedChanges {
changes[nestedPath] = nestedValue
}
default:
// Primitive value - check if changed
if !deepEqual(origValue, modValue) {
changes[currentPath] = modValue
}
}
} else {
// New key added - mark for addition
changes[currentPath+"@add"] = modValue
}
}
}
case []interface{}:
if mod, ok := modified.([]interface{}); ok {
// Handle array changes by detecting specific element operations
if len(orig) != len(mod) {
// Array length changed - detect if it's element removal
if len(orig) > len(mod) {
// Element(s) removed - find which ones by comparing content
removedIndices := findRemovedArrayElements(orig, mod)
for _, removedIndex := range removedIndices {
var currentPath string
if basePath == "" {
currentPath = fmt.Sprintf("%d@remove", removedIndex)
} else {
currentPath = fmt.Sprintf("%s.%d@remove", basePath, removedIndex)
}
changes[currentPath] = nil // Mark for removal
}
} else {
// Elements added - more complex, skip for now
}
} else {
// Same length - check individual elements for value changes
for i, modValue := range mod {
var currentPath string
if basePath == "" {
currentPath = strconv.Itoa(i)
} else {
currentPath = basePath + "." + strconv.Itoa(i)
}
// Copy all keys from the new map
for k, v := range rootValue {
rootMap[k] = v
if i < len(orig) {
// Index exists in both, check if value changed
switch modValue.(type) {
case map[string]interface{}, []interface{}:
// Recursively check nested structures
nestedChanges := findDeepChanges(currentPath, orig[i], modValue)
for nestedPath, nestedValue := range nestedChanges {
changes[nestedPath] = nestedValue
}
return nil
default:
// Primitive value - check if changed
if !deepEqual(orig[i], modValue) {
changes[currentPath] = modValue
}
}
}
}
}
}
default:
// For primitive types, compare directly
if !deepEqual(original, modified) {
if basePath == "" {
changes[""] = modified
} else {
changes[basePath] = modified
}
}
}
return changes
}
// findRemovedArrayElements compares two arrays and returns indices of removed elements
func findRemovedArrayElements(original, modified []interface{}) []int {
var removedIndices []int
// Simple approach: find elements in original that don't exist in modified
for i, origElement := range original {
found := false
for _, modElement := range modified {
if deepEqual(origElement, modElement) {
found = true
break
}
}
if !found {
removedIndices = append(removedIndices, i)
}
}
return removedIndices
}
// deepEqual performs deep comparison of two values
func deepEqual(a, b interface{}) bool {
if a == nil && b == nil {
return true
}
if a == nil || b == nil {
return false
}
switch av := a.(type) {
case map[string]interface{}:
if bv, ok := b.(map[string]interface{}); ok {
if len(av) != len(bv) {
return false
}
for k, v := range av {
if !deepEqual(v, bv[k]) {
return false
}
}
return true
}
return false
case []interface{}:
if bv, ok := b.([]interface{}); ok {
if len(av) != len(bv) {
return false
}
for i, v := range av {
if !deepEqual(v, bv[i]) {
return false
}
}
return true
}
return false
default:
return a == b
}
}
// ToLuaTable converts a Go interface{} to a Lua table recursively
func ToLuaTable(L *lua.LState, data interface{}) (*lua.LTable, error) {
toLuaTableLogger := jsonLogger.WithPrefix("ToLuaTable")
toLuaTableLogger.Debug("Converting Go interface to Lua table")
toLuaTableLogger.Trace("Input data type: %T", data)
switch v := data.(type) {
case map[string]interface{}:
toLuaTableLogger.Debug("Converting map to Lua table")
table := L.CreateTable(0, len(v))
for key, value := range v {
luaValue, err := ToLuaValue(L, value)
if err != nil {
toLuaTableLogger.Error("Failed to convert map value for key %q: %v", key, err)
return nil, err
}
table.RawSetString(key, luaValue)
}
return table, nil
case []interface{}:
// For arrays, we need to handle similarly
rootArray, ok := jsonData.([]interface{})
if !ok {
// If the original wasn't an array, use jsonpath.Set
return jsonpath.Set(jsonData, path, newValue)
toLuaTableLogger.Debug("Converting slice to Lua table")
table := L.CreateTable(len(v), 0)
for i, value := range v {
luaValue, err := ToLuaValue(L, value)
if err != nil {
toLuaTableLogger.Error("Failed to convert slice value at index %d: %v", i, err)
return nil, err
}
table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
}
return table, nil
// Clear and recreate the array
*&rootArray = rootValue
return nil
case string:
toLuaTableLogger.Debug("Converting string to Lua string")
return nil, fmt.Errorf("expected table or array, got string")
case float64:
toLuaTableLogger.Debug("Converting float64 to Lua number")
return nil, fmt.Errorf("expected table or array, got number")
case bool:
toLuaTableLogger.Debug("Converting bool to Lua boolean")
return nil, fmt.Errorf("expected table or array, got boolean")
case nil:
toLuaTableLogger.Debug("Converting nil to Lua nil")
return nil, fmt.Errorf("expected table or array, got nil")
default:
// For other types, use jsonpath.Set
return jsonpath.Set(jsonData, path, newValue)
toLuaTableLogger.Error("Unsupported type for Lua table conversion: %T", v)
return nil, fmt.Errorf("unsupported type for Lua table conversion: %T", v)
}
}
// For non-root paths, use the regular Set method
err := jsonpath.Set(jsonData, path, newValue)
// ToLuaValue converts a Go interface{} to a Lua value
func ToLuaValue(L *lua.LState, data interface{}) (lua.LValue, error) {
toLuaValueLogger := jsonLogger.WithPrefix("ToLuaValue")
toLuaValueLogger.Debug("Converting Go interface to Lua value")
toLuaValueLogger.Trace("Input data type: %T", data)
switch v := data.(type) {
case map[string]interface{}:
toLuaValueLogger.Debug("Converting map to Lua table")
table := L.CreateTable(0, len(v))
for key, value := range v {
luaValue, err := ToLuaValue(L, value)
if err != nil {
return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
toLuaValueLogger.Error("Failed to convert map value for key %q: %v", key, err)
return lua.LNil, err
}
return nil
table.RawSetString(key, luaValue)
}
return table, nil
// ToLua converts JSON values to Lua variables
func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
table, err := ToLua(L, data)
case []interface{}:
toLuaValueLogger.Debug("Converting slice to Lua table")
table := L.CreateTable(len(v), 0)
for i, value := range v {
luaValue, err := ToLuaValue(L, value)
if err != nil {
return err
toLuaValueLogger.Error("Failed to convert slice value at index %d: %v", i, err)
return lua.LNil, err
}
L.SetGlobal("v", table)
return nil
table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
}
return table, nil
// FromLua retrieves values from Lua
func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
luaValue := L.GetGlobal("v")
return FromLua(L, luaValue)
case string:
toLuaValueLogger.Debug("Converting string to Lua string")
return lua.LString(v), nil
case float64:
toLuaValueLogger.Debug("Converting float64 to Lua number")
return lua.LNumber(v), nil
case bool:
toLuaValueLogger.Debug("Converting bool to Lua boolean")
return lua.LBool(v), nil
case nil:
toLuaValueLogger.Debug("Converting nil to Lua nil")
return lua.LNil, nil
default:
toLuaValueLogger.Error("Unsupported type for Lua value conversion: %T", v)
return lua.LNil, fmt.Errorf("unsupported type for Lua value conversion: %T", v)
}
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,490 +0,0 @@
package jsonpath
import (
"fmt"
"strconv"
)
// JSONStep represents a single step in a JSONPath query
type JSONStep struct {
Type StepType
Key string // For Child/RecursiveDescent
Index int // For Index (use -1 for wildcard "*")
}
// JSONNode represents a value in the JSON data with its path
type JSONNode struct {
Value interface{} // The value found at the path
Path string // The exact JSONPath where the value was found
}
// StepType defines the types of steps in a JSONPath
type StepType int
const (
RootStep StepType = iota // $ - The root element
ChildStep // .key - Direct child access
RecursiveDescentStep // ..key - Recursive search for key
WildcardStep // .* - All children of an object
IndexStep // [n] - Array index access (or [*] for all elements)
)
// TraversalMode determines how the traversal behaves
type TraversalMode int
const (
CollectMode TraversalMode = iota // Just collect matched nodes
ModifyFirstMode // Modify first matching node
ModifyAllMode // Modify all matching nodes
)
// ParseJSONPath parses a JSONPath string into a sequence of steps
func ParseJSONPath(path string) ([]JSONStep, error) {
if len(path) == 0 || path[0] != '$' {
return nil, fmt.Errorf("path must start with $; received: %q", path)
}
steps := []JSONStep{}
i := 0
for i < len(path) {
switch path[i] {
case '$':
steps = append(steps, JSONStep{Type: RootStep})
i++
case '.':
i++
if i < len(path) && path[i] == '.' {
// Recursive descent
i++
key, nextPos := readKey(path, i)
steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
i = nextPos
} else {
// Child step or wildcard
key, nextPos := readKey(path, i)
if key == "*" {
steps = append(steps, JSONStep{Type: WildcardStep})
} else {
steps = append(steps, JSONStep{Type: ChildStep, Key: key})
}
i = nextPos
}
case '[':
// Index step
i++
indexStr, nextPos := readIndex(path, i)
if indexStr == "*" {
steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
} else {
index, err := strconv.Atoi(indexStr)
if err != nil {
return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
}
steps = append(steps, JSONStep{Type: IndexStep, Index: index})
}
i = nextPos + 1 // Skip closing ]
default:
return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
}
}
return steps, nil
}
// readKey extracts a key name from the path
func readKey(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == '.' || path[i] == '[' {
break
}
}
return path[start:i], i
}
// readIndex extracts an array index or wildcard from the path
func readIndex(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == ']' {
break
}
}
return path[start:i], i
}
// Get retrieves values with their paths from data at the specified JSONPath
// Each returned JSONNode contains both the value and its exact path in the data structure
func Get(data interface{}, path string) ([]JSONNode, error) {
steps, err := ParseJSONPath(path)
if err != nil {
return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
results := []JSONNode{}
err = traverseWithPaths(data, steps, &results, "$")
if err != nil {
return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
}
return results, nil
}
// Set updates the value at the specified JSONPath in the original data structure.
// It only modifies the first matching node.
func Set(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// SetAll updates all matching values at the specified JSONPath.
func SetAll(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// setWithPath modifies values while tracking paths
func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
if node == nil || *success && mode == ModifyFirstMode {
return nil
}
// Skip root step
actualSteps := steps
if len(steps) > 0 && steps[0].Type == RootStep {
actualSteps = steps[1:]
}
// If we have no steps left, we're setting the root value
if len(actualSteps) == 0 {
// For the root node, we need to handle it differently depending on what's passed in
// since we can't directly replace the interface{} variable
// We'll signal success and let the JSONProcessor handle updating the root
*success = true
return nil
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
childPath := currentPath + "." + step.Key
if isLastStep {
// We've reached the target, set the value
m[step.Key] = value
*success = true
return nil
}
// Create intermediate nodes if necessary
child, exists := m[step.Key]
if !exists {
// Create missing intermediate node
if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
child = []interface{}{}
} else {
child = map[string]interface{}{}
}
m[step.Key] = child
}
err := setWithPath(child, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
arr[i] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
arr[step.Index] = value
*success = true
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
}
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
m[step.Key] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(val, remainingSteps, success, value, directPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
// Skip keys we've already processed directly
if step.Key != "*" && k == step.Key {
continue
}
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
m[k] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(v, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
return nil
}
// traverseWithPaths tracks both nodes and their paths during traversal
func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
if len(steps) == 0 || node == nil {
return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
}
// Skip root step
actualSteps := steps
if steps[0].Type == RootStep {
if len(steps) == 1 {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
return nil
}
actualSteps = steps[1:]
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
child, exists := m[step.Key]
if !exists {
return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
}
childPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: child, Path: childPath})
} else {
err := traverseWithPaths(child, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node is not an array; actual type: %T", node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
} else {
return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: val, Path: directPath})
} else {
err := traverseWithPaths(val, remainingSteps, results, directPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
}
}
}
}
// For wildcard, collect this node
if step.Key == "*" && isLastStep {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
*results = append(*results, JSONNode{Value: v, Path: childPath})
} else {
err := traverseWithPaths(v, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
}
return nil
}

View File

@@ -1,577 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
func TestGetWithPathsBasic(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
error bool
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
{
name: "nonexistent path",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
},
path: "$.user.email",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
if !tt.error {
t.Errorf("GetWithPaths() returned error: %v", err)
}
return
}
// For nonexistent path, we expect empty slice
if tt.name == "nonexistent path" {
if len(result) > 0 {
t.Errorf("GetWithPaths() returned %v, expected empty result", result)
}
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For wildcard results, we need to check containment rather than exact order
if tt.name == "wildcard" || tt.name == "recursive descent" {
// For each expected item, check if it exists in the results by both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
found = true
break
}
}
if !found {
t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
}
}
} else {
// Otherwise check exact equality of both values and paths
for i, expected := range tt.expected {
if !reflect.DeepEqual(result[i].Value, expected.Value) {
t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
}
if result[i].Path != expected.Path {
t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := Set(data, "$.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("nested property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
}
err := Set(data, "$.user.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
user, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user["name"] != "Jane" {
t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
}
})
t.Run("array element", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
}
err := Set(data, "$.users[0].name", "Bob")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user0["name"] != "Bob" {
t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
}
})
t.Run("complex value", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
}
newProfile := map[string]interface{}{
"email": "john.doe@example.com",
"phone": "123-456-7890",
}
err := Set(data, "$.user.profile", newProfile)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
profile, ok := userMap["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Profile is not a map")
}
if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
t.Errorf("Set() failed: expected profile to be updated with new values")
}
})
t.Run("create new property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if email, exists := userMap["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
}
})
t.Run("create nested properties", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.contact.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
contact, ok := userMap["contact"].(map[string]interface{})
if !ok {
t.Fatalf("Contact is not a map")
}
if email, exists := contact["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
}
})
t.Run("create array and element", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
// This should create an empty addresses array, but won't be able to set index 0
// since the array is empty
err := Set(data, "$.user.addresses[0].street", "123 Main St")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
})
t.Run("multiple targets (should only update first)", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := Set(data, "$.users[*].active", false)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User0 is not a map")
}
user1, ok := users[1].(map[string]interface{})
if !ok {
t.Fatalf("User1 is not a map")
}
// Only the first one should be changed
if active, exists := user0["active"]; !exists || active != false {
t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
}
// The second one should remain unchanged
if active, exists := user1["active"]; !exists || active != true {
t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
}
})
t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
}
err := Set(data, "$", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Data should be unchanged
if data["name"] != "John" {
t.Errorf("Data was modified when setting on root")
}
})
}
func TestSetAll(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := SetAll(data, "$.name", "Jane")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("all array elements", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := SetAll(data, "$.users[*].active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
// Both elements should be updated
for i, user := range users {
userMap, ok := user.(map[string]interface{})
if !ok {
t.Fatalf("User%d is not a map", i)
}
if active, exists := userMap["active"]; !exists || active != false {
t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
}
}
})
t.Run("recursive descent", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
"admin": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
}
err := SetAll(data, "$..active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Check user profile
userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access user.profile")
}
if active, exists := userProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
}
// Check admin profile
adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access admin.profile")
}
if active, exists := adminProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
}
})
}
func TestGetWithPathsExtended(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
t.Errorf("GetWithPaths() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// Check if value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Check if path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -1,318 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
var testData = map[string]interface{}{
"store": map[string]interface{}{
"book": []interface{}{
map[string]interface{}{
"title": "The Fellowship of the Ring",
"price": 22.99,
},
map[string]interface{}{
"title": "The Two Towers",
"price": 23.45,
},
},
"bicycle": map[string]interface{}{
"color": "red",
"price": 199.95,
},
},
}
func TestParser(t *testing.T) {
tests := []struct {
path string
steps []JSONStep
wantErr bool
}{
{
path: "$.store.bicycle.color",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "bicycle"},
{Type: ChildStep, Key: "color"},
},
},
{
path: "$..price",
steps: []JSONStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Key: "price"},
},
},
{
path: "$.store.book[*].title",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: -1}, // Wildcard
{Type: ChildStep, Key: "title"},
},
},
{
path: "$.store.book[0]",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: 0},
},
},
{
path: "invalid.path",
wantErr: true,
},
{
path: "$.store.book[abc]",
wantErr: true,
},
}
for _, tt := range tests {
t.Run(tt.path, func(t *testing.T) {
steps, err := ParseJSONPath(tt.path)
if (err != nil) != tt.wantErr {
t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
}
if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
}
})
}
}
func TestEvaluator(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
error bool
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
{
name: "wildcard_recursive",
path: "$..*",
expected: []JSONNode{
// These will be compared by value only, paths will be validated separately
{Value: testData["store"].(map[string]interface{})["book"]},
{Value: testData["store"].(map[string]interface{})["bicycle"]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
{Value: "The Fellowship of the Ring"},
{Value: 22.99},
{Value: "The Two Towers"},
{Value: 23.45},
{Value: "red"},
{Value: 199.95},
},
},
{
name: "invalid_index",
path: "$.store.book[5]",
expected: []JSONNode{},
error: true,
},
{
name: "nonexistent_property",
path: "$.store.nonexistent",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Use GetWithPaths directly
result, err := Get(testData, tt.path)
if err != nil {
if !tt.error {
t.Errorf("Get() returned error: %v", err)
}
return
}
// Special handling for wildcard recursive test
if tt.name == "wildcard_recursive" {
// Skip length check for wildcard recursive since it might vary
// Just verify that each expected item is in the results
// Validate values match and paths are filled in
for _, e := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, e.Value) {
found = true
break
}
}
if !found {
t.Errorf("Expected value %v not found in results", e.Value)
}
}
return
}
if len(result) != len(tt.expected) {
t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
}
// Validate both values and paths
for i, e := range tt.expected {
if i < len(result) {
if !reflect.DeepEqual(result[i].Value, e.Value) {
t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
}
if result[i].Path != e.Path {
t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
}
}
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("empty_data", func(t *testing.T) {
result, err := Get(nil, "$.a.b")
if err == nil {
t.Errorf("Expected error for empty data")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("empty_path", func(t *testing.T) {
_, err := ParseJSONPath("")
if err == nil {
t.Error("Expected error for empty path")
}
})
t.Run("numeric_keys", func(t *testing.T) {
data := map[string]interface{}{
"42": "answer",
}
result, err := Get(data, "$.42")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) == 0 || result[0].Value != "answer" {
t.Errorf("Expected 'answer', got %v", result)
}
})
}
func TestGetWithPaths(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(testData, tt.path)
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// First verify the value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Then verify the path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -2,196 +2,164 @@ package processor
import (
"fmt"
"os"
"path/filepath"
"io"
"net/http"
"regexp"
"strings"
"github.com/antchfx/xmlquery"
"cook/utils"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua"
)
// Processor defines the interface for all file processors
type Processor interface {
// Process handles processing a file with the given pattern and Lua expression
// Now implemented as a base function in processor.go
// Process(filename string, pattern string, luaExpr string) (int, int, error)
// processorLogger is a scoped logger for the processor package.
var processorLogger = logger.Default.WithPrefix("processor")
// ProcessContent handles processing a string content directly with the given pattern and Lua expression
// Returns the modified content, modification count, match count, and any error
ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
// Maybe we make this an interface again for the shits and giggles
// We will see, it could easily be...
// ToLua converts processor-specific data to Lua variables
ToLua(L *lua.LState, data interface{}) error
var globalVariables = map[string]interface{}{}
// FromLua retrieves modified data from Lua
FromLua(L *lua.LState) (interface{}, error)
func SetVariables(vars map[string]interface{}) {
for k, v := range vars {
globalVariables[k] = v
}
// ModificationRecord tracks a single value modification
type ModificationRecord struct {
File string
OldValue string
NewValue string
Operation string
Context string
}
func NewLuaState() (*lua.LState, error) {
newLStateLogger := processorLogger.WithPrefix("NewLuaState")
newLStateLogger.Debug("Creating new Lua state")
L := lua.NewState()
// defer L.Close()
// Load math library
newLStateLogger.Debug("Loading Lua math library")
L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil {
newLStateLogger.Error("Failed to load Lua math library: %v", err)
return nil, fmt.Errorf("error loading Lua math library: %v", err)
}
newLStateLogger.Debug("Lua math library loaded")
// Initialize helper functions
newLStateLogger.Debug("Initializing Lua helper functions")
if err := InitLuaHelpers(L); err != nil {
newLStateLogger.Error("Failed to initialize Lua helper functions: %v", err)
return nil, err
}
newLStateLogger.Debug("Lua helper functions initialized")
return L, nil
}
func Process(p Processor, filename string, pattern string, luaExpr string) (int, int, error) {
// Read file content
cwd, err := os.Getwd()
if err != nil {
return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
}
fullPath := filepath.Join(cwd, filename)
content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ToLua converts a struct or map to a Lua table recursively
func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
switch v := data.(type) {
case *xmlquery.Node:
luaTable := L.NewTable()
luaTable.RawSetString("text", lua.LString(v.Data))
// Should be a map, simple key value pairs
attr, err := ToLua(L, v.Attr)
if err != nil {
return nil, err
}
luaTable.RawSetString("attr", attr)
return luaTable, nil
case map[string]interface{}:
luaTable := L.NewTable()
for key, value := range v {
luaValue, err := ToLua(L, value)
if err != nil {
return nil, err
}
luaTable.RawSetString(key, luaValue)
}
return luaTable, nil
case []interface{}:
luaTable := L.NewTable()
for i, value := range v {
luaValue, err := ToLua(L, value)
if err != nil {
return nil, err
}
luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
}
return luaTable, nil
case string:
return lua.LString(v), nil
case bool:
return lua.LBool(v), nil
// Inject global variables
if len(globalVariables) > 0 {
newLStateLogger.Debug("Injecting %d global variables into Lua state", len(globalVariables))
for k, v := range globalVariables {
switch val := v.(type) {
case int:
L.SetGlobal(k, lua.LNumber(float64(val)))
case int64:
L.SetGlobal(k, lua.LNumber(float64(val)))
case float32:
L.SetGlobal(k, lua.LNumber(float64(val)))
case float64:
return lua.LNumber(v), nil
case nil:
return lua.LNil, nil
default:
return nil, fmt.Errorf("unsupported data type: %T", data)
L.SetGlobal(k, lua.LNumber(val))
case string:
L.SetGlobal(k, lua.LString(val))
case bool:
if val {
L.SetGlobal(k, lua.LTrue)
} else {
L.SetGlobal(k, lua.LFalse)
}
default:
// Fallback to string representation
L.SetGlobal(k, lua.LString(fmt.Sprintf("%v", val)))
}
}
}
newLStateLogger.Debug("New Lua state created successfully")
return L, nil
}
// FromLua converts a Lua table to a struct or map recursively
func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
fromLuaLogger := processorLogger.WithPrefix("FromLua").WithField("luaType", luaValue.Type().String())
fromLuaLogger.Debug("Converting Lua value to Go interface")
switch v := luaValue.(type) {
// Well shit...
// Tables in lua are both maps and arrays
// As arrays they are ordered and as maps, obviously, not
// So when we parse them to a go map we fuck up the order for arrays
// We have to find a better way....
case *lua.LTable:
fromLuaLogger.Debug("Processing Lua table")
isArray, err := IsLuaTableArray(L, v)
if err != nil {
fromLuaLogger.Error("Failed to determine if Lua table is array: %v", err)
return nil, err
}
fromLuaLogger.Debug("Lua table is array: %t", isArray)
if isArray {
fromLuaLogger.Debug("Converting Lua table to Go array")
result := make([]interface{}, 0)
v.ForEach(func(key lua.LValue, value lua.LValue) {
converted, _ := FromLua(L, value)
result = append(result, converted)
})
fromLuaLogger.Trace("Converted Go array: %v", result)
return result, nil
} else {
fromLuaLogger.Debug("Converting Lua table to Go map")
result := make(map[string]interface{})
v.ForEach(func(key lua.LValue, value lua.LValue) {
converted, _ := FromLua(L, value)
result[key.String()] = converted
})
fromLuaLogger.Trace("Converted Go map: %v", result)
return result, nil
}
case lua.LString:
fromLuaLogger.Debug("Converting Lua string to Go string")
fromLuaLogger.Trace("Lua string: %q", string(v))
return string(v), nil
case lua.LBool:
fromLuaLogger.Debug("Converting Lua boolean to Go boolean")
fromLuaLogger.Trace("Lua boolean: %t", bool(v))
return bool(v), nil
case lua.LNumber:
fromLuaLogger.Debug("Converting Lua number to Go float64")
fromLuaLogger.Trace("Lua number: %f", float64(v))
return float64(v), nil
default:
fromLuaLogger.Debug("Unsupported Lua type, returning nil")
return nil, nil
}
}
func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
isLuaTableArrayLogger := processorLogger.WithPrefix("IsLuaTableArray")
isLuaTableArrayLogger.Debug("Checking if Lua table is an array")
isLuaTableArrayLogger.Trace("Lua table input: %v", v)
L.SetGlobal("table_to_check", v)
// Use our predefined helper function from InitLuaHelpers
err := L.DoString(`is_array = isArray(table_to_check)`)
if err != nil {
isLuaTableArrayLogger.Error("Error determining if table is an array: %v", err)
return false, fmt.Errorf("error determining if table is array: %w", err)
}
// Check the result of our Lua function
isArray := L.GetGlobal("is_array")
// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
if !lua.LVIsFalse(isArray) {
return true, nil
}
return false, nil
result := !lua.LVIsFalse(isArray)
isLuaTableArrayLogger.Debug("Lua table is array: %t", result)
isLuaTableArrayLogger.Trace("isArray result Lua value: %v", isArray)
return result, nil
}
// InitLuaHelpers initializes common Lua helper functions
func InitLuaHelpers(L *lua.LState) error {
initLuaHelpersLogger := processorLogger.WithPrefix("InitLuaHelpers")
initLuaHelpersLogger.Debug("Loading Lua helper functions")
helperScript := `
-- Custom Lua helpers for math operations
function min(a, b) return math.min(a, b) end
@@ -204,6 +172,40 @@ function floor(x) return math.floor(x) end
function ceil(x) return math.ceil(x) end
function upper(s) return string.upper(s) end
function lower(s) return string.lower(s) end
function format(s, ...) return string.format(s, ...) end
function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
-- String split helper
function strsplit(inputstr, sep)
if sep == nil then
sep = "%s"
end
local t = {}
for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
table.insert(t, str)
end
return t
end
---@param table table
---@param depth number?
function DumpTable(table, depth)
if depth == nil then
depth = 0
end
if (depth > 200) then
print("Error: Depth > 200 in dumpTable()")
return
end
for k, v in pairs(table) do
if (type(v) == "table") then
print(string.rep(" ", depth) .. k .. ":")
DumpTable(v, depth + 1)
else
print(string.rep(" ", depth) .. k .. ": ", v)
end
end
end
-- String to number conversion helper
function num(str)
@@ -237,23 +239,22 @@ end
modified = false
`
if err := L.DoString(helperScript); err != nil {
initLuaHelpersLogger.Error("Failed to load Lua helper functions: %v", err)
return fmt.Errorf("error loading helper functions: %v", err)
}
initLuaHelpersLogger.Debug("Lua helper functions loaded")
initLuaHelpersLogger.Debug("Setting up Lua print function to Go")
L.SetGlobal("print", L.NewFunction(printToGo))
L.SetGlobal("fetch", L.NewFunction(fetch))
L.SetGlobal("re", L.NewFunction(EvalRegex))
initLuaHelpersLogger.Debug("Lua print and fetch functions bound to Go")
return nil
}
// Helper utility functions
// LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string {
s = strings.ReplaceAll(s, "\n", "\\n")
if len(s) <= maxLen {
return s
}
return s[:maxLen-3] + "..."
}
func PrependLuaAssignment(luaExpr string) string {
prependLuaAssignmentLogger := processorLogger.WithPrefix("PrependLuaAssignment").WithField("originalLuaExpr", luaExpr)
prependLuaAssignmentLogger.Debug("Prepending Lua assignment if necessary")
// Auto-prepend v1 for expressions starting with operators
if strings.HasPrefix(luaExpr, "*") ||
strings.HasPrefix(luaExpr, "/") ||
@@ -262,28 +263,32 @@ func PrependLuaAssignment(luaExpr string) string {
strings.HasPrefix(luaExpr, "^") ||
strings.HasPrefix(luaExpr, "%") {
luaExpr = "v1 = v1" + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1 = v1' due to operator prefix")
} else if strings.HasPrefix(luaExpr, "=") {
// Handle direct assignment with = operator
luaExpr = "v1 " + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1' due to direct assignment operator")
}
// Add assignment if needed
if !strings.Contains(luaExpr, "=") {
luaExpr = "v1 = " + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1 =' as no assignment was found")
}
prependLuaAssignmentLogger.Trace("Final Lua expression after prepending: %q", luaExpr)
return luaExpr
}
// BuildLuaScript prepares a Lua expression from shorthand notation
func BuildLuaScript(luaExpr string) string {
buildLuaScriptLogger := processorLogger.WithPrefix("BuildLuaScript").WithField("inputLuaExpr", luaExpr)
buildLuaScriptLogger.Debug("Building full Lua script from expression")
// Perform $var substitutions from globalVariables
luaExpr = replaceVariables(luaExpr)
luaExpr = PrependLuaAssignment(luaExpr)
// This allows the user to specify whether or not they modified a value
// If they do nothing we assume they did modify (no return at all)
// If they return before our return then they themselves specify what they did
// If nothing is returned lua assumes nil
// So we can say our value was modified if the return value is either nil or true
// If the return value is false then the user wants to keep the original
fullScript := fmt.Sprintf(`
function run()
%s
@@ -291,22 +296,272 @@ func BuildLuaScript(luaExpr string) string {
local res = run()
modified = res == nil or res
`, luaExpr)
buildLuaScriptLogger.Trace("Generated full Lua script: %q", utils.LimitString(fullScript, 200))
return fullScript
}
// Max returns the maximum of two integers
func Max(a, b int) int {
if a > b {
return a
}
return b
// BuildJSONLuaScript prepares a Lua expression for JSON mode
func BuildJSONLuaScript(luaExpr string) string {
buildJsonLuaScriptLogger := processorLogger.WithPrefix("BuildJSONLuaScript").WithField("inputLuaExpr", luaExpr)
buildJsonLuaScriptLogger.Debug("Building full Lua script for JSON mode from expression")
// Perform $var substitutions from globalVariables
luaExpr = replaceVariables(luaExpr)
fullScript := fmt.Sprintf(`
function run()
%s
end
local res = run()
modified = res == nil or res
`, luaExpr)
buildJsonLuaScriptLogger.Trace("Generated full JSON Lua script: %q", utils.LimitString(fullScript, 200))
return fullScript
}
// Min returns the minimum of two integers
func Min(a, b int) int {
if a < b {
return a
func replaceVariables(expr string) string {
// $varName -> literal value
varNameRe := regexp.MustCompile(`\$(\w+)`)
return varNameRe.ReplaceAllStringFunc(expr, func(m string) string {
name := varNameRe.FindStringSubmatch(m)[1]
if v, ok := globalVariables[name]; ok {
switch val := v.(type) {
case int, int64, float32, float64:
return fmt.Sprintf("%v", val)
case bool:
if val {
return "true"
} else {
return "false"
}
return b
case string:
// Quote strings for Lua literal
return fmt.Sprintf("%q", val)
default:
return fmt.Sprintf("%q", fmt.Sprintf("%v", val))
}
}
return m
})
}
func printToGo(L *lua.LState) int {
printToGoLogger := processorLogger.WithPrefix("printToGo")
printToGoLogger.Debug("Lua print function called, redirecting to Go logger")
top := L.GetTop()
args := make([]interface{}, top)
for i := 1; i <= top; i++ {
args[i-1] = L.Get(i)
}
// Format the message with proper spacing between arguments
var parts []string
for _, arg := range args {
parts = append(parts, fmt.Sprintf("%v", arg))
}
message := strings.Join(parts, " ")
printToGoLogger.Trace("Lua print message: %q", message)
// Use the LUA log level with a script tag
logger.Lua("%s", message)
printToGoLogger.Debug("Message logged from Lua")
return 0
}
func fetch(L *lua.LState) int {
fetchLogger := processorLogger.WithPrefix("fetch")
fetchLogger.Debug("Lua fetch function called")
// Get URL from first argument
url := L.ToString(1)
if url == "" {
fetchLogger.Error("Fetch failed: URL is required")
L.Push(lua.LNil)
L.Push(lua.LString("URL is required"))
return 2
}
fetchLogger.Debug("Fetching URL: %q", url)
// Get options from second argument if provided
var method string = "GET"
var headers map[string]string = make(map[string]string)
var body string = ""
if L.GetTop() > 1 {
options := L.ToTable(2)
if options != nil {
fetchLogger.Debug("Processing fetch options")
// Get method
if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
method = methodVal.String()
fetchLogger.Trace("Method from options: %q", method)
}
// Get headers
if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
if headersTable, ok := headersVal.(*lua.LTable); ok {
fetchLogger.Trace("Processing headers table")
headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
headers[key.String()] = value.String()
fetchLogger.Trace("Header: %q = %q", key.String(), value.String())
})
}
fetchLogger.Trace("All headers: %v", headers)
}
// Get body
if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
body = bodyVal.String()
fetchLogger.Trace("Body from options: %q", utils.LimitString(body, 100))
}
}
}
fetchLogger.Debug("Fetch request details: Method=%q, URL=%q, BodyLength=%d, Headers=%v", method, url, len(body), headers)
// Create HTTP request
req, err := http.NewRequest(method, url, strings.NewReader(body))
if err != nil {
fetchLogger.Error("Error creating HTTP request: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
return 2
}
// Set headers
for key, value := range headers {
req.Header.Set(key, value)
}
fetchLogger.Debug("HTTP request created and headers set")
fetchLogger.Trace("HTTP Request: %+v", req)
// Make request
client := &http.Client{}
resp, err := client.Do(req)
if err != nil {
fetchLogger.Error("Error making HTTP request: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
return 2
}
defer func() {
fetchLogger.Debug("Closing HTTP response body")
resp.Body.Close()
}()
fetchLogger.Debug("HTTP request executed. Status Code: %d", resp.StatusCode)
// Read response body
bodyBytes, err := io.ReadAll(resp.Body)
if err != nil {
fetchLogger.Error("Error reading response body: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
return 2
}
fetchLogger.Trace("Response body length: %d", len(bodyBytes))
// Create response table
responseTable := L.NewTable()
responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
responseTable.RawSetString("statusText", lua.LString(resp.Status))
responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
fetchLogger.Debug("Created Lua response table")
// Set headers in response
headersTable := L.NewTable()
for key, values := range resp.Header {
headersTable.RawSetString(key, lua.LString(values[0]))
fetchLogger.Trace("Response header: %q = %q", key, values[0])
}
responseTable.RawSetString("headers", headersTable)
fetchLogger.Trace("Full response table: %v", responseTable)
L.Push(responseTable)
fetchLogger.Debug("Pushed response table to Lua stack")
return 1
}
func EvalRegex(L *lua.LState) int {
evalRegexLogger := processorLogger.WithPrefix("evalRegex")
evalRegexLogger.Debug("Lua evalRegex function called")
defer func() {
if r := recover(); r != nil {
evalRegexLogger.Error("Panic in EvalRegex: %v", r)
// Push empty table on panic
emptyTable := L.NewTable()
L.Push(emptyTable)
}
}()
pattern := L.ToString(1)
input := L.ToString(2)
evalRegexLogger.Debug("Pattern: %q, Input: %q", pattern, input)
re := regexp.MustCompile(pattern)
matches := re.FindStringSubmatch(input)
evalRegexLogger.Debug("Go regex matches: %v (count: %d)", matches, len(matches))
matchesTable := L.NewTable()
for i, match := range matches {
matchesTable.RawSetInt(i, lua.LString(match))
evalRegexLogger.Debug("Set table[%d] = %q", i, match)
}
L.Push(matchesTable)
evalRegexLogger.Debug("Pushed matches table to Lua stack")
return 1
}
// GetLuaFunctionsHelp returns a comprehensive help string for all available Lua functions
func GetLuaFunctionsHelp() string {
return `Lua Functions Available in Global Environment:
MATH FUNCTIONS:
min(a, b) - Returns the minimum of two numbers
max(a, b) - Returns the maximum of two numbers
round(x, n) - Rounds x to n decimal places (default 0)
floor(x) - Returns the floor of x
ceil(x) - Returns the ceiling of x
STRING FUNCTIONS:
upper(s) - Converts string to uppercase
lower(s) - Converts string to lowercase
format(s, ...) - Formats string using Lua string.format
trim(s) - Removes leading/trailing whitespace
strsplit(inputstr, sep) - Splits string by separator (default: whitespace)
num(str) - Converts string to number (returns 0 if invalid)
str(num) - Converts number to string
is_number(str) - Returns true if string is numeric
TABLE FUNCTIONS:
DumpTable(table, depth) - Prints table structure recursively
isArray(t) - Returns true if table is a sequential array
HTTP FUNCTIONS:
fetch(url, options) - Makes HTTP request, returns response table
options: {method="GET", headers={}, body=""}
returns: {status, statusText, ok, body, headers}
REGEX FUNCTIONS:
re(pattern, input) - Applies regex pattern to input string
returns: table with matches (index 0 = full match, 1+ = groups)
UTILITY FUNCTIONS:
print(...) - Prints arguments to Go logger
EXAMPLES:
round(3.14159, 2) -> 3.14
strsplit("a,b,c", ",") -> {"a", "b", "c"}
upper("hello") -> "HELLO"
min(5, 3) -> 3
num("123") -> 123
is_number("abc") -> false
fetch("https://api.example.com/data")
re("(\\w+)@(\\w+)", "user@domain.com") -> {"user@domain.com", "user", "domain.com"}`
}

162
processor/processor_test.go Normal file
View File

@@ -0,0 +1,162 @@
package processor_test
import (
"fmt"
"testing"
"github.com/stretchr/testify/assert"
lua "github.com/yuin/gopher-lua"
"cook/processor"
)
// Happy Path: Function correctly returns all regex capture groups as Lua table when given valid pattern and input.
func TestEvalRegex_CaptureGroupsReturned(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `(\w+)-(\d+)`
input := "test-42"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
result := processor.EvalRegex(L)
assert.Equal(t, 0, result, "Expected return value to be 0")
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
expected := []string{"test-42", "test", "42"}
for i, v := range expected {
val := tbl.RawGetString(fmt.Sprintf("%d", i))
assert.Equal(t, lua.LString(v), val, "Expected index %d to be %q", i, v)
}
}
// Happy Path: Function returns an empty Lua table when regex pattern does not match input string.
func TestEvalRegex_NoMatchReturnsEmptyTable(t *testing.T) {
L := lua.NewState()
defer L.Close()
L.Push(lua.LString(`(foo)(bar)`))
L.Push(lua.LString("no-match-here"))
result := processor.EvalRegex(L)
assert.Equal(t, 0, result)
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
count := 0
tbl.ForEach(func(k, v lua.LValue) {
count++
})
assert.Zero(t, count, "Expected no items in the table for non-matching input")
}
// Happy Path: Function handles patterns with no capture groups by returning the full match in the Lua table.
func TestEvalRegex_NoCaptureGroups(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `foo\d+`
input := "foo123"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
result := processor.EvalRegex(L)
assert.Equal(t, 0, result)
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
fullMatch := tbl.RawGetString("0")
assert.Equal(t, lua.LString("foo123"), fullMatch)
// There should be only the full match (index 0)
count := 0
tbl.ForEach(func(k, v lua.LValue) {
count++
})
assert.Equal(t, 1, count)
}
// Edge Case: Function panics or errors when given an invalid regex pattern.
func TestEvalRegex_InvalidPattern(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `([a-z` // invalid regex
L.Push(lua.LString(pattern))
L.Push(lua.LString("someinput"))
defer func() {
if r := recover(); r == nil {
t.Error("Expected panic for invalid regex pattern, but did not panic")
}
}()
processor.EvalRegex(L)
}
// Edge Case: Function returns an empty Lua table when input string is empty.
func TestEvalRegex_EmptyInputString(t *testing.T) {
L := lua.NewState()
defer L.Close()
L.Push(lua.LString(`(foo)`))
L.Push(lua.LString(""))
result := processor.EvalRegex(L)
assert.Equal(t, 0, result)
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
// Should be empty
count := 0
tbl.ForEach(func(k, v lua.LValue) {
count++
})
assert.Zero(t, count, "Expected empty table when input is empty")
}
// Edge Case: Function handles nil or missing arguments gracefully without causing a runtime panic.
func TestEvalRegex_MissingArguments(t *testing.T) {
L := lua.NewState()
defer L.Close()
defer func() {
if r := recover(); r != nil {
t.Errorf("Did not expect panic when arguments are missing, got: %v", r)
}
}()
// No arguments pushed at all
processor.EvalRegex(L)
// Should just not match anything or produce empty table, but must not panic
}
func TestEvalComplexRegex(t *testing.T) {
// 23:47:35.567068 processor.go:369 [g:22 ] [LUA] Pistol_Round ^((Bulk_)?(Pistol|Rifle).*?Round.*?)$
L := lua.NewState()
defer L.Close()
pattern := `^((Bulk_)?(Pistol|Rifle).*?Round.*?)$`
input := "Pistol_Round"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
processor.EvalRegex(L)
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
count := 0
tbl.ForEach(func(k, v lua.LValue) {
fmt.Println(k, v)
count++
})
assert.Equal(t, 1, count)
}

View File

@@ -1,104 +1,108 @@
package processor
import (
"cook/utils"
"fmt"
"regexp"
"strconv"
"strings"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua"
)
// RegexProcessor implements the Processor interface using regex patterns
type RegexProcessor struct{}
// regexLogger is a scoped logger for the processor/regex package.
var regexLogger = logger.Default.WithPrefix("processor/regex")
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
captures, ok := data.([]string)
if !ok {
return fmt.Errorf("expected []string for captures, got %T", data)
}
// Set variables for each capture group, starting from v1/s1 for the first capture
for i := 0; i < len(captures); i++ {
// Set string version (always available as s1, s2, etc.)
L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
// Try to convert to number and set v1, v2, etc.
if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
}
}
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Get the modified values after Lua execution
modifications := make(map[int]string)
// Check for modifications to v1-v12 and s1-s12
for i := 0; i < 12; i++ {
// Check both v and s variables to see if any were modified
vVarName := fmt.Sprintf("v%d", i+1)
sVarName := fmt.Sprintf("s%d", i+1)
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
// If our value is a number then it's very likely we want it to be a number
// And not a string
// If we do want it to be a string we will cast it into a string in lua
// wait that wouldn't work... Casting v to a string would not load it here
if vLuaVal.Type() == lua.LTNumber {
modifications[i] = vLuaVal.String()
continue
}
if sLuaVal.Type() == lua.LTString {
modifications[i] = sLuaVal.String()
continue
}
}
return modifications, nil
type CaptureGroup struct {
Name string
Value string
Updated string
Range [2]int
}
// ProcessContent applies regex replacement with Lua processing
func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
}
// The filename here exists ONLY so we can pass it to the lua environment
// It's not used for anything else
func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
processRegexLogger := regexLogger.WithPrefix("ProcessRegex").WithField("commandName", command.Name).WithField("file", filename)
processRegexLogger.Debug("Starting regex processing for file")
processRegexLogger.Trace("Initial file content length: %d", len(content))
processRegexLogger.Trace("Command details: %+v", command)
var commands []utils.ReplaceCommand
// Start timing the regex processing
startTime := time.Now()
// We don't HAVE to do this multiple times for a pattern
// But it's quick enough for us to not care
pattern := resolveRegexPlaceholders(command.Regex)
processRegexLogger.Debug("Resolved regex placeholders. Pattern: %s", pattern)
// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
// But it's a compromise that allows us to use | in yaml
// Otherwise we would have to escape every god damn pair of quotation marks
// And a bunch of other shit
pattern = strings.TrimSpace(pattern)
processRegexLogger.Debug("Trimmed regex pattern: %s", pattern)
patternCompileStart := time.Now()
compiledPattern, err := regexp.Compile(pattern)
if err != nil {
return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
processRegexLogger.Error("Error compiling pattern %q: %v", pattern, err)
return commands, fmt.Errorf("error compiling pattern: %v", err)
}
processRegexLogger.Debug("Compiled pattern successfully in %v", time.Since(patternCompileStart))
previous := luaExpr
luaExpr = BuildLuaScript(luaExpr)
fmt.Printf("Changing Lua expression from: %s to: %s\n", previous, luaExpr)
L, err := NewLuaState()
if err != nil {
return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
// Initialize Lua environment
modificationCount := 0
// Same here, it's just string concatenation, it won't kill us
// More important is that we don't fuck up the command
// But we shouldn't be able to since it's passed by value
previousLuaExpr := command.Lua
luaExpr := BuildLuaScript(command.Lua)
processRegexLogger.Debug("Transformed Lua expression: %q → %q", previousLuaExpr, luaExpr)
processRegexLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
// Process all regex matches
result := content
matchFindStart := time.Now()
indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
matchFindDuration := time.Since(matchFindStart)
processRegexLogger.Debug("Found %d matches in content of length %d (search took %v)",
len(indices), len(content), matchFindDuration)
processRegexLogger.Trace("Match indices: %v", indices)
// Log pattern complexity metrics
patternComplexity := estimatePatternComplexity(pattern)
processRegexLogger.Debug("Pattern complexity estimate: %d", patternComplexity)
if len(indices) == 0 {
processRegexLogger.Warning("No matches found for regex: %q", pattern)
processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
// We walk backwards because we're replacing something with something else that might be longer
// And in the case it is longer than the original all indicces past that change will be fucked up
// By going backwards we fuck up all the indices to the end of the file that we don't care about
// Because there either aren't any (last match) or they're already modified (subsequent matches)
for i := len(indices) - 1; i >= 0; i-- {
matchIndices := indices[i]
for i, matchIndices := range indices {
matchLogger := processRegexLogger.WithField("matchNum", i+1)
matchLogger.Debug("Processing match %d of %d", i+1, len(indices))
matchLogger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
L, err := NewLuaState()
if err != nil {
matchLogger.Error("Error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
}
L.SetGlobal("file", lua.LString(filename))
// Hmm... Maybe we don't want to defer this..
// Maybe we want to close them every iteration
// We'll leave it as is for now
defer L.Close()
matchLogger.Trace("Lua state created successfully for match %d", i+1)
// Why we're doing this whole song and dance of indices is to properly handle empty matches
// Plus it's a little cleaner to surgically replace our matches
// If we were to use string.replace and encountered an empty match there'd be nothing to replace
@@ -106,61 +110,390 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
// So when we're cutting open the array we say 0:7 + modified + 7:end
// As if concatenating in the middle of the array
// Plus it supports lookarounds
match := content[matchIndices[0]:matchIndices[1]]
matchContent := content[matchIndices[0]:matchIndices[1]]
matchPreview := utils.LimitString(matchContent, 50)
matchLogger.Trace("Matched content: %q (length: %d)", matchPreview, len(matchContent))
groups := matchIndices[2:]
if len(groups) <= 0 {
fmt.Println("No capture groups for lua to chew on")
matchLogger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
continue
}
if len(groups)%2 == 1 {
fmt.Println("Odd number of indices of groups, what the fuck?")
matchLogger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
continue
}
captures := make([]string, 0, len(groups)/2)
// Count how many valid groups we have
validGroups := 0
for j := 0; j < len(groups); j += 2 {
captures = append(captures, content[groups[j]:groups[j+1]])
if groups[j] != -1 && groups[j+1] != -1 {
validGroups++
}
}
matchLogger.Debug("Found %d valid capture groups in match", validGroups)
if err := p.ToLua(L, captures); err != nil {
fmt.Println("Error setting Lua variables:", err)
for _, index := range groups {
if index == -1 {
matchLogger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
continue
}
}
// We have to use array to preserve order
// Very important for the reconstruction step
// Because we must overwrite the values in reverse order
// See comments a few dozen lines above for more details
captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
groupNames := compiledPattern.SubexpNames()[1:]
for i, name := range groupNames {
start := groups[i*2]
end := groups[i*2+1]
if start == -1 || end == -1 {
matchLogger.Debug("Skipping empty or unmatched capture group #%d (name: %q)", i+1, name)
continue
}
value := content[start:end]
captureGroups = append(captureGroups, &CaptureGroup{
Name: name,
Value: value,
Range: [2]int{start, end},
})
// Include name info in log if available
if name != "" {
matchLogger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
} else {
matchLogger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
}
}
// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
if !command.NoDedup {
matchLogger.Debug("Deduplicating capture groups as specified in command settings")
captureGroups = deduplicateGroups(captureGroups)
matchLogger.Trace("Capture groups after deduplication: %v", captureGroups)
} else {
matchLogger.Debug("Skipping deduplication of capture groups (NoDedup is true)")
}
if err := toLua(L, captureGroups); err != nil {
matchLogger.Error("Failed to set Lua variables for capture groups: %v", err)
continue
}
matchLogger.Debug("Set %d capture groups as Lua variables", len(captureGroups))
matchLogger.Trace("Lua globals set for capture groups")
if err := L.DoString(luaExpr); err != nil {
fmt.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
matchLogger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
err, utils.LimitString(luaExpr, 200), captureGroups)
continue
}
matchLogger.Debug("Lua script executed successfully")
// Get modifications from Lua
modResult, err := p.FromLua(L)
updatedCaptureGroups, err := fromLua(L, captureGroups)
if err != nil {
fmt.Println("Error getting modifications:", err)
continue
}
// Apply modifications to the matched text
modsMap, ok := modResult.(map[int]string)
if !ok || len(modsMap) == 0 {
fmt.Println("No modifications to apply")
matchLogger.Error("Failed to retrieve modifications from Lua: %v", err)
continue
}
matchLogger.Debug("Retrieved updated values from Lua")
matchLogger.Trace("Updated capture groups from Lua: %v", updatedCaptureGroups)
replacement := ""
replacementVar := L.GetGlobal("replacement")
if replacementVar.Type() != lua.LTNil {
replacement = replacementVar.String()
matchLogger.Debug("Using global replacement variable from Lua: %q", replacement)
}
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
matchLogger.Debug("Skipping match - no modifications indicated by Lua script")
continue
}
if replacement == "" {
// Apply the modifications to the original match
replacement := match
for i := len(modsMap) - 1; i >= 0; i-- {
newVal := modsMap[i]
replacement = matchContent
// Count groups that were actually modified
modifiedGroupsCount := 0
for _, capture := range updatedCaptureGroups {
if capture.Value != capture.Updated {
modifiedGroupsCount++
}
}
matchLogger.Info("%d of %d capture groups identified for modification", modifiedGroupsCount, len(updatedCaptureGroups))
for _, capture := range updatedCaptureGroups {
if capture.Value == capture.Updated {
matchLogger.Debug("Capture group unchanged: %s", utils.LimitString(capture.Value, 50))
continue
}
// Log what changed with context
matchLogger.Debug("Capture group %q scheduled for modification: %q → %q",
capture.Name, utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
// Indices of the group are relative to content
// To relate them to match we have to subtract the match start index
groupStart := groups[i*2] - matchIndices[0]
groupEnd := groups[i*2+1] - matchIndices[0]
replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
commands = append(commands, utils.ReplaceCommand{
From: capture.Range[0],
To: capture.Range[1],
With: capture.Updated,
})
matchLogger.Trace("Added replacement command: %+v", commands[len(commands)-1])
}
} else {
matchLogger.Debug("Using full replacement string from Lua: %q", utils.LimitString(replacement, 50))
commands = append(commands, utils.ReplaceCommand{
From: matchIndices[0],
To: matchIndices[1],
With: replacement,
})
matchLogger.Trace("Added full replacement command: %+v", commands[len(commands)-1])
}
}
modificationCount++
result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
processRegexLogger.Debug("Generated %d total modifications", len(commands))
return commands, nil
}
return result, modificationCount, len(indices), nil
func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
deduplicateGroupsLogger := regexLogger.WithPrefix("deduplicateGroups")
deduplicateGroupsLogger.Debug("Starting deduplication of capture groups")
deduplicateGroupsLogger.Trace("Input capture groups: %v", captureGroups)
// Preserve input order and drop any group that overlaps with an already accepted group
accepted := make([]*CaptureGroup, 0, len(captureGroups))
for _, group := range captureGroups {
groupLogger := deduplicateGroupsLogger.WithField("groupName", group.Name).WithField("groupRange", group.Range)
groupLogger.Debug("Processing capture group")
overlaps := false
for _, kept := range accepted {
// Overlap if start < keptEnd and end > keptStart (adjacent is allowed)
if group.Range[0] < kept.Range[1] && group.Range[1] > kept.Range[0] {
overlaps = true
break
}
}
if overlaps {
groupLogger.Warning("Overlapping capture group detected and skipped.")
continue
}
groupLogger.Debug("Capture group does not overlap with previously accepted groups. Adding.")
accepted = append(accepted, group)
}
deduplicateGroupsLogger.Debug("Finished deduplication. Original %d groups, %d deduplicated.", len(captureGroups), len(accepted))
deduplicateGroupsLogger.Trace("Deduplicated groups: %v", accepted)
return accepted
}
// The order of these replaces is important
// This one handles !num-s inside of named capture groups
// If it were not here our !num in a named capture group would
// Expand to another capture group in the capture group
// We really only want one (our named) capture group
func resolveRegexPlaceholders(pattern string) string {
resolveLogger := regexLogger.WithPrefix("resolveRegexPlaceholders").WithField("originalPattern", utils.LimitString(pattern, 100))
resolveLogger.Debug("Resolving regex placeholders in pattern")
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
resolveLogger.Debug("Prepended '(?s)' to pattern for single-line mode")
}
namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
funcLogger := resolveLogger.WithPrefix("namedGroupNumReplace").WithField("match", utils.LimitString(match, 50))
funcLogger.Debug("Processing named group !num placeholder")
parts := namedGroupNum.FindStringSubmatch(match)
if len(parts) != 3 {
funcLogger.Warning("Unexpected number of submatches for namedGroupNum: %d. Returning original match.", len(parts))
return match
}
replacement := `-?\d*\.?\d+`
funcLogger.Trace("Replacing !num in named group with: %q", replacement)
return parts[1] + replacement
})
resolveLogger.Debug("Handled named group !num placeholders")
pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
resolveLogger.Debug("Replaced !num with numeric capture group")
pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
resolveLogger.Debug("Replaced !any with non-greedy wildcard")
repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
// !rep(pattern, count) repeats the pattern n times
// Inserting !any between each repetition
pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
funcLogger := resolveLogger.WithPrefix("repPatternReplace").WithField("match", utils.LimitString(match, 50))
funcLogger.Debug("Processing !rep placeholder")
parts := repPattern.FindStringSubmatch(match)
if len(parts) != 3 {
funcLogger.Warning("Unexpected number of submatches for repPattern: %d. Returning original match.", len(parts))
return match
}
repeatedPattern := parts[1]
countStr := parts[2]
repetitions, err := strconv.Atoi(countStr)
if err != nil {
funcLogger.Error("Failed to parse repetition count %q: %v. Returning original match.", countStr, err)
return match
}
var finalReplacement string
if repetitions > 0 {
finalReplacement = strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
} else {
finalReplacement = ""
}
funcLogger.Trace("Replaced !rep with %d repetitions of %q: %q", repetitions, utils.LimitString(repeatedPattern, 30), utils.LimitString(finalReplacement, 100))
return finalReplacement
})
resolveLogger.Debug("Handled !rep placeholders")
resolveLogger.Debug("Finished resolving regex placeholders")
resolveLogger.Trace("Final resolved pattern: %q", utils.LimitString(pattern, 100))
return pattern
}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func toLua(L *lua.LState, data interface{}) error {
toLuaLogger := regexLogger.WithPrefix("toLua")
toLuaLogger.Debug("Setting capture groups as Lua variables")
captureGroups, ok := data.([]*CaptureGroup)
if !ok {
toLuaLogger.Error("Invalid data type for toLua. Expected []*CaptureGroup, got %T", data)
return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
}
toLuaLogger.Trace("Input capture groups: %v", captureGroups)
groupindex := 0
for _, capture := range captureGroups {
groupLogger := toLuaLogger.WithField("captureGroup", capture.Name).WithField("value", utils.LimitString(capture.Value, 50))
groupLogger.Debug("Processing capture group for Lua")
if capture.Name == "" {
// We don't want to change the name of the capture group
// Even if it's empty
tempName := fmt.Sprintf("%d", groupindex+1)
groupindex++
groupLogger.Debug("Unnamed capture group, assigning temporary name: %q", tempName)
L.SetGlobal("s"+tempName, lua.LString(capture.Value))
groupLogger.Trace("Set Lua global s%s = %q", tempName, capture.Value)
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal("v"+tempName, lua.LNumber(val))
groupLogger.Trace("Set Lua global v%s = %f", tempName, val)
} else {
groupLogger.Trace("Value %q is not numeric, skipping v%s assignment", capture.Value, tempName)
}
} else {
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal(capture.Name, lua.LNumber(val))
groupLogger.Trace("Set Lua global %s = %f (numeric)", capture.Name, val)
} else {
L.SetGlobal(capture.Name, lua.LString(capture.Value))
groupLogger.Trace("Set Lua global %s = %q (string)", capture.Name, capture.Value)
}
}
}
toLuaLogger.Debug("Finished setting capture groups as Lua variables")
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
fromLuaLogger := regexLogger.WithPrefix("fromLua")
fromLuaLogger.Debug("Retrieving modifications from Lua for capture groups")
fromLuaLogger.Trace("Initial capture groups: %v", captureGroups)
captureIndex := 0
for _, capture := range captureGroups {
groupLogger := fromLuaLogger.WithField("originalCaptureName", capture.Name).WithField("originalValue", utils.LimitString(capture.Value, 50))
groupLogger.Debug("Processing capture group to retrieve updated value")
if capture.Name == "" {
// This case means it was an unnamed capture group originally.
// We need to reconstruct the original temporary name to fetch its updated value.
// The name will be set to an integer if it was empty, then incremented.
// So, we use the captureIndex to get the correct 'vX' and 'sX' variables.
tempName := fmt.Sprintf("%d", captureIndex+1)
groupLogger.Debug("Retrieving updated value for unnamed group (temp name: %q)", tempName)
vVarName := fmt.Sprintf("v%s", tempName)
sVarName := fmt.Sprintf("s%s", tempName)
captureIndex++
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
groupLogger.Trace("Lua values for unnamed group: v=%v, s=%v", vLuaVal, sLuaVal)
if sLuaVal.Type() == lua.LTString {
capture.Updated = sLuaVal.String()
groupLogger.Trace("Updated value from s%s (string): %q", tempName, capture.Updated)
}
// Numbers have priority
if vLuaVal.Type() == lua.LTNumber {
capture.Updated = vLuaVal.String()
groupLogger.Trace("Updated value from v%s (numeric): %q", tempName, capture.Updated)
}
} else {
// Easy shit, directly use the named capture group
updatedValue := L.GetGlobal(capture.Name)
if updatedValue.Type() != lua.LTNil {
capture.Updated = updatedValue.String()
groupLogger.Trace("Updated value for named group %q: %q", capture.Name, capture.Updated)
} else {
groupLogger.Debug("Named capture group %q not found in Lua globals or is nil. Keeping original value.", capture.Name)
capture.Updated = capture.Value // Keep original if not found or nil
}
}
groupLogger.Debug("Finished processing capture group. Original: %q, Updated: %q", utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
}
fromLuaLogger.Debug("Finished retrieving modifications from Lua")
fromLuaLogger.Trace("Final updated capture groups: %v", captureGroups)
return captureGroups, nil
}
// estimatePatternComplexity gives a rough estimate of regex pattern complexity
// This can help identify potentially problematic patterns
func estimatePatternComplexity(pattern string) int {
estimateComplexityLogger := regexLogger.WithPrefix("estimatePatternComplexity").WithField("pattern", utils.LimitString(pattern, 100))
estimateComplexityLogger.Debug("Estimating regex pattern complexity")
complexity := len(pattern)
// Add complexity for potentially expensive operations
complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
complexity += strings.Count(pattern, "[^") * 3 // Negated character class
complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
complexity += strings.Count(pattern, "(") * 2 // Capture groups
complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
complexity += strings.Count(pattern, "{") * 2 // Counted repetition
estimateComplexityLogger.Debug("Estimated pattern complexity: %d", complexity)
return complexity
}

File diff suppressed because it is too large Load Diff

View File

@@ -0,0 +1,599 @@
package processor
import (
"cook/utils"
"testing"
)
func TestSurgicalJSONEditing(t *testing.T) {
tests := []struct {
name string
content string
luaCode string
expected string
}{
{
name: "Modify single field",
content: `{
"name": "test",
"value": 42,
"description": "original"
}`,
luaCode: `
data.value = 84
modified = true
`,
expected: `{
"name": "test",
"value": 84,
"description": "original"
}`,
},
{
name: "Add new field",
content: `{
"name": "test",
"value": 42
}`,
luaCode: `
data.newField = "added"
modified = true
`,
expected: `{
"name": "test",
"value": 42
,"newField":"added"}`, // sjson.Set() adds new fields in compact format
},
{
name: "Modify nested field",
content: `{
"config": {
"settings": {
"enabled": false,
"timeout": 30
}
}
}`,
luaCode: `
data.config.settings.enabled = true
data.config.settings.timeout = 60
modified = true
`,
expected: `{
"config": {
"settings": {
"enabled": true,
"timeout": 60
}
}
}`,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
command := utils.ModifyCommand{
Name: "test",
Lua: tt.luaCode,
}
commands, err := ProcessJSON(tt.content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := tt.content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
// Check the actual result matches expected
if result != tt.expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", tt.expected, result)
}
})
}
}
func TestSurgicalJSONPreservesFormatting(t *testing.T) {
// Test that surgical editing preserves the original formatting structure
content := `{
"Defaults": {
"Behaviour": "None",
"Description": "",
"DisplayName": "",
"FlavorText": "",
"Icon": "None",
"MaxStack": 1,
"Override_Glow_Icon": "None",
"Weight": 0,
"bAllowZeroWeight": false
},
"RowStruct": "/Script/Icarus.ItemableData",
"Rows": [
{
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"MaxStack": 1000000,
"Name": "Item_Fiber",
"Weight": 10
}
]
}`
expected := `{
"Defaults": {
"Behaviour": "None",
"Description": "",
"DisplayName": "",
"FlavorText": "",
"Icon": "None",
"MaxStack": 1,
"Override_Glow_Icon": "None",
"Weight": 0,
"bAllowZeroWeight": false
},
"RowStruct": "/Script/Icarus.ItemableData",
"Rows": [
{
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"MaxStack": 1000000,
"Name": "Item_Fiber",
"Weight": 500
}
]
}`
command := utils.ModifyCommand{
Name: "test",
Lua: `
-- Modify the weight of the first item
data.Rows[1].Weight = 500
modified = true
`,
}
commands, err := ProcessJSON(content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
// Check that the result matches expected (preserves formatting and changes weight)
if result != expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
}
}
func TestSurgicalJSONPreservesFormatting2(t *testing.T) {
// Test that surgical editing preserves the original formatting structure
content := `
{
"RowStruct": "/Script/Icarus.ProcessorRecipe",
"Defaults": {
"bForceDisableRecipe": false,
"Requirement": {
"RowName": "None",
"DataTableName": "D_Talents"
},
"SessionRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"CharacterRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"RequiredMillijoules": 2500,
"RecipeSets": [],
"ResourceCostMultipliers": [],
"Inputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Container": {
"Value": "None"
},
"ResourceInputs": [],
"bSelectOutputItemRandomly": false,
"bContainsContainer": false,
"ItemIconOverride": {
"ItemStaticData": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"ItemDynamicData": [],
"ItemCustomStats": [],
"CustomProperties": {
"StaticWorldStats": [],
"StaticWorldHeldStats": [],
"Stats": [],
"Alterations": [],
"LivingItemSlots": []
},
"DatabaseGUID": "",
"ItemOwnerLookupId": -1,
"RuntimeTags": {
"GameplayTags": []
}
},
"Outputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemTemplate"
},
"Count": 1,
"DynamicProperties": []
}
],
"ResourceOutputs": [],
"Refundable": "Inherit",
"ExperienceMultiplier": 1,
"Audio": {
"RowName": "None",
"DataTableName": "D_CraftingAudioData"
}
},
"Rows": [
{
"Name": "Biofuel1",
"RecipeSets": [
{
"RowName": "Composter",
"DataTableName": "D_RecipeSets"
}
],
"Inputs": [
{
"Element": {
"RowName": "Raw_Meat",
"DataTableName": "D_ItemsStatic"
},
"Count": 2,
"DynamicProperties": []
},
{
"Element": {
"RowName": "Tree_Sap",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Outputs": [],
"Audio": {
"RowName": "Composter"
},
"ResourceOutputs": [
{
"Type": {
"Value": "Biofuel"
},
"RequiredUnits": 100
}
]
}
]
}
`
expected := `
{
"RowStruct": "/Script/Icarus.ProcessorRecipe",
"Defaults": {
"bForceDisableRecipe": false,
"Requirement": {
"RowName": "None",
"DataTableName": "D_Talents"
},
"SessionRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"CharacterRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"RequiredMillijoules": 2500,
"RecipeSets": [],
"ResourceCostMultipliers": [],
"Inputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Container": {
"Value": "None"
},
"ResourceInputs": [],
"bSelectOutputItemRandomly": false,
"bContainsContainer": false,
"ItemIconOverride": {
"ItemStaticData": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"ItemDynamicData": [],
"ItemCustomStats": [],
"CustomProperties": {
"StaticWorldStats": [],
"StaticWorldHeldStats": [],
"Stats": [],
"Alterations": [],
"LivingItemSlots": []
},
"DatabaseGUID": "",
"ItemOwnerLookupId": -1,
"RuntimeTags": {
"GameplayTags": []
}
},
"Outputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemTemplate"
},
"Count": 1,
"DynamicProperties": []
}
],
"ResourceOutputs": [],
"Refundable": "Inherit",
"ExperienceMultiplier": 1,
"Audio": {
"RowName": "None",
"DataTableName": "D_CraftingAudioData"
}
},
"Rows": [
{
"Name": "Biofuel1",
"RecipeSets": [
{
"RowName": "Composter",
"DataTableName": "D_RecipeSets"
}
],
"Inputs": [
{
"Element": {
"RowName": "Raw_Meat",
"DataTableName": "D_ItemsStatic"
},
"Count": 2,
"DynamicProperties": []
}
],
"Outputs": [],
"Audio": {
"RowName": "Composter"
},
"ResourceOutputs": [
{
"Type": {
"Value": "Biofuel"
},
"RequiredUnits": 100
}
]
}
]
}
`
command := utils.ModifyCommand{
Name: "test",
Lua: `
-- Define regex patterns for matching recipe names
local function matchesPattern(name, pattern)
local matches = re(pattern, name)
-- Check if matches table has any content (index 0 or 1 should exist if there's a match)
return matches and (matches[0] or matches[1])
end
-- Selection pattern for recipes that get multiplied
local selectionPattern = "(?-s)(Bulk_)?(Pistol|Rifle).*?Round.*?|(Carbon|Composite)_Paste.*|(Gold|Copper)_Wire|(Ironw|Copper)_Nail|(Platinum|Steel|Cold_Steel|Titanium)_Ingot|.*?Shotgun_Shell.*?|.*_Arrow|.*_Bolt|.*_Fertilizer_?\\d*|.*_Grenade|.*_Pill|.*_Tonic|Aluminum|Ammo_Casing|Animal_Fat|Carbon_Fiber|Composites|Concrete_Mix|Cured_Leather_?\\d?|Electronics|Epoxy_?\\d?|Glass\\d?|Gunpowder\\w*|Health_.*|Titanium_Plate|Organic_Resin|Platinum_Sheath|Refined_[a-zA-Z]+|Rope|Shotgun_Casing|Steel_Bloom\\d?|Tree_Sap\\w*"
-- Ingot pattern for recipes that get count set to 1
local ingotPattern = "(?-s)(Platinum|Steel|Cold_Steel|Titanium)_Ingot|Aluminum|Refined_[a-zA-Z]+|Glass\\d?"
local factor = 16
local bonus = 0.5
for _, row in ipairs(data.Rows) do
local recipeName = row.Name
-- Special case: Biofuel recipes - remove Tree_Sap input
if string.find(recipeName, "Biofuel") then
if row.Inputs then
for i = #row.Inputs, 1, -1 do
local input = row.Inputs[i]
if input.Element and input.Element.RowName and string.find(input.Element.RowName, "Tree_Sap") then
table.remove(row.Inputs, i)
print("Removing input 'Tree_Sap' from processor recipe '" .. recipeName .. "'")
end
end
end
end
-- Ingot recipes: set input and output counts to 1
if matchesPattern(recipeName, ingotPattern) then
if row.Inputs then
for _, input in ipairs(row.Inputs) do
input.Count = 1
end
end
if row.Outputs then
for _, output in ipairs(row.Outputs) do
output.Count = 1
end
end
end
-- Selected recipes: multiply inputs by factor, outputs by factor * (1 + bonus)
if matchesPattern(recipeName, selectionPattern) then
if row.Inputs then
for _, input in ipairs(row.Inputs) do
local oldCount = input.Count
input.Count = input.Count * factor
print("Recipe " .. recipeName .. " Input.Count: " .. oldCount .. " -> " .. input.Count)
end
end
if row.Outputs then
for _, output in ipairs(row.Outputs) do
local oldCount = output.Count
output.Count = math.floor(output.Count * factor * (1 + bonus))
print("Recipe " .. recipeName .. " Output.Count: " .. oldCount .. " -> " .. output.Count)
end
end
end
end
`,
}
commands, err := ProcessJSON(content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
// Check that the result matches expected (preserves formatting and changes weight)
if result != expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
}
}
func TestRetardedJSONEditing(t *testing.T) {
original := `{
"RowStruct": "/Script/Icarus.ItemableData",
"Defaults": {
"Behaviour": "None",
"DisplayName": "",
"Icon": "None",
"Override_Glow_Icon": "None",
"Description": "",
"FlavorText": "",
"Weight": 0,
"bAllowZeroWeight": false,
"MaxStack": 1
},
"Rows": [
{
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Weight": 10,
"MaxStack": 200,
"Name": "Item_Fiber"
}
]
}`
expected := `{
"RowStruct": "/Script/Icarus.ItemableData",
"Defaults": {
"Behaviour": "None",
"DisplayName": "",
"Icon": "None",
"Override_Glow_Icon": "None",
"Description": "",
"FlavorText": "",
"Weight": 0,
"bAllowZeroWeight": false,
"MaxStack": 1
},
"Rows": [
{
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Weight": 10,
"MaxStack": 1000000,
"Name": "Item_Fiber"
}
]
}`
command := utils.ModifyCommand{
Name: "test",
Lua: `
for _, row in ipairs(data.Rows) do
if row.MaxStack then
if string.find(row.Name, "Carrot") or string.find(row.Name, "Potato") then
row.MaxStack = 25
else
row.MaxStack = row.MaxStack * 10000
if row.MaxStack > 1000000 then
row.MaxStack = 1000000
end
end
end
end
`,
}
commands, err := ProcessJSON(original, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := original
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
// Check that the weight was changed
if result != expected {
t.Errorf("Expected:\n%s\nGot:\n%s", expected, result)
}
}

27
processor/test_helper.go Normal file
View File

@@ -0,0 +1,27 @@
package processor
import (
"io"
"os"
logger "git.site.quack-lab.dev/dave/cylogger"
)
func init() {
// Only modify logger in test mode
// This checks if we're running under 'go test'
if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
// Initialize logger with ERROR level for tests
// to minimize noise in test output
logger.Init(logger.LevelError)
// Optionally redirect logger output to discard
// This prevents logger output from interfering with test output
disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
if disableTestLogs {
// Create a new logger that writes to nowhere
silentLogger := logger.New(io.Discard, "", 0)
logger.Default = silentLogger
}
}
}

View File

@@ -1,412 +0,0 @@
package processor
import (
"fmt"
"log"
"modify/processor/xpath"
"strings"
"github.com/antchfx/xmlquery"
lua "github.com/yuin/gopher-lua"
)
// XMLProcessor implements the Processor interface for XML documents
type XMLProcessor struct{}
// ProcessContent implements the Processor interface for XMLProcessor
func (p *XMLProcessor) ProcessContent(content string, path string, luaExpr string) (string, int, int, error) {
// Parse XML document
// We can't really use encoding/xml here because it requires a pre defined struct
// And we HAVE TO parse dynamic unknown XML
doc, err := xmlquery.Parse(strings.NewReader(content))
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
}
// Find nodes matching the XPath pattern
nodes, err := xpath.Get(doc, path)
if err != nil {
return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
// Apply modifications to each node
modCount := 0
for _, node := range nodes {
L, err := NewLuaState()
if err != nil {
return content, 0, 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
err = p.ToLua(L, node)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
}
err = L.DoString(BuildLuaScript(luaExpr))
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
}
result, err := p.FromLua(L)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
}
log.Printf("%#v", result)
modified := false
modified = L.GetGlobal("modified").String() == "true"
if !modified {
log.Printf("No changes made to node at path: %s", node.Data)
continue
}
// Apply modification based on the result
if updatedValue, ok := result.(string); ok {
// If the result is a simple string, update the node value directly
xpath.Set(doc, path, updatedValue)
} else if nodeData, ok := result.(map[string]interface{}); ok {
// If the result is a map, apply more complex updates
updateNodeFromMap(node, nodeData)
}
modCount++
}
// Serialize the modified XML document to string
if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
// If we have an XML declaration, start with it
declaration := doc.FirstChild.OutputXML(true)
// Remove the firstChild (declaration) before serializing the rest of the document
doc.FirstChild = doc.FirstChild.NextSibling
return ConvertToNamedEntities(declaration + doc.OutputXML(true)), modCount, matchCount, nil
}
// Convert numeric entities to named entities for better readability
return ConvertToNamedEntities(doc.OutputXML(true)), modCount, matchCount, nil
}
func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
table, err := p.ToLuaTable(L, data)
if err != nil {
return err
}
L.SetGlobal("v", table)
return nil
}
// ToLua converts XML node values to Lua variables
func (p *XMLProcessor) ToLuaTable(L *lua.LState, data interface{}) (lua.LValue, error) {
// Check if data is an xmlquery.Node
node, ok := data.(*xmlquery.Node)
if !ok {
return nil, fmt.Errorf("expected xmlquery.Node, got %T", data)
}
// Create a simple table with essential data
table := L.NewTable()
// For element nodes, just provide basic info
L.SetField(table, "type", lua.LString(nodeTypeToString(node.Type)))
L.SetField(table, "name", lua.LString(node.Data))
L.SetField(table, "value", lua.LString(node.InnerText()))
// Add children if any
children := L.NewTable()
for child := node.FirstChild; child != nil; child = child.NextSibling {
childTable, err := p.ToLuaTable(L, child)
if err == nil {
children.Append(childTable)
}
}
L.SetField(table, "children", children)
attrs := L.NewTable()
if len(node.Attr) > 0 {
for _, attr := range node.Attr {
L.SetField(attrs, attr.Name.Local, lua.LString(attr.Value))
}
}
L.SetField(table, "attr", attrs)
return table, nil
}
// FromLua gets modified values from Lua
func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
luaValue := L.GetGlobal("v")
// Handle string values directly
if luaValue.Type() == lua.LTString {
return luaValue.String(), nil
}
// Handle tables (for attributes and more complex updates)
if luaValue.Type() == lua.LTTable {
return luaTableToMap(L, luaValue.(*lua.LTable)), nil
}
return luaValue.String(), nil
}
// Simple helper to convert a Lua table to a Go map
func luaTableToMap(L *lua.LState, table *lua.LTable) map[string]interface{} {
result := make(map[string]interface{})
table.ForEach(func(k, v lua.LValue) {
if k.Type() == lua.LTString {
key := k.String()
if v.Type() == lua.LTTable {
result[key] = luaTableToMap(L, v.(*lua.LTable))
} else {
result[key] = v.String()
}
}
})
return result
}
// Simple helper to convert node type to string
func nodeTypeToString(nodeType xmlquery.NodeType) string {
switch nodeType {
case xmlquery.ElementNode:
return "element"
case xmlquery.TextNode:
return "text"
case xmlquery.AttributeNode:
return "attribute"
default:
return "other"
}
}
// Helper function to update an XML node from a map
func updateNodeFromMap(node *xmlquery.Node, data map[string]interface{}) {
// Update node value if present
if value, ok := data["value"]; ok {
if strValue, ok := value.(string); ok {
// For element nodes, replace text content
if node.Type == xmlquery.ElementNode {
// Find the first text child if it exists
var textNode *xmlquery.Node
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type == xmlquery.TextNode {
textNode = child
break
}
}
if textNode != nil {
// Update existing text node
textNode.Data = strValue
} else {
// Create new text node
newText := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: strValue,
Parent: node,
}
// Insert at beginning of children
if node.FirstChild != nil {
newText.NextSibling = node.FirstChild
node.FirstChild.PrevSibling = newText
node.FirstChild = newText
} else {
node.FirstChild = newText
node.LastChild = newText
}
}
} else if node.Type == xmlquery.TextNode {
// Directly update text node
node.Data = strValue
} else if node.Type == xmlquery.AttributeNode {
// Update attribute value
if node.Parent != nil {
for i, attr := range node.Parent.Attr {
if attr.Name.Local == node.Data {
node.Parent.Attr[i].Value = strValue
break
}
}
}
}
}
}
// Update attributes if present
if attrs, ok := data["attr"].(map[string]interface{}); ok && node.Type == xmlquery.ElementNode {
for name, value := range attrs {
if strValue, ok := value.(string); ok {
// Look for existing attribute
found := false
for i, attr := range node.Attr {
if attr.Name.Local == name {
node.Attr[i].Value = strValue
found = true
break
}
}
// Add new attribute if not found
if !found {
node.Attr = append(node.Attr, xmlquery.Attr{
Name: struct {
Space, Local string
}{Local: name},
Value: strValue,
})
}
}
}
}
}
// Helper function to get a string representation of node type
func nodeTypeName(nodeType xmlquery.NodeType) string {
switch nodeType {
case xmlquery.ElementNode:
return "element"
case xmlquery.TextNode:
return "text"
case xmlquery.AttributeNode:
return "attribute"
case xmlquery.CommentNode:
return "comment"
case xmlquery.DeclarationNode:
return "declaration"
default:
return "unknown"
}
}
// ConvertToNamedEntities replaces numeric XML entities with their named counterparts
func ConvertToNamedEntities(xml string) string {
// Basic XML entities
replacements := map[string]string{
// Basic XML entities
"&#34;": "&quot;", // double quote
"&#39;": "&apos;", // single quote
"&#60;": "&lt;", // less than
"&#62;": "&gt;", // greater than
"&#38;": "&amp;", // ampersand
// Common symbols
"&#160;": "&nbsp;", // non-breaking space
"&#169;": "&copy;", // copyright
"&#174;": "&reg;", // registered trademark
"&#8364;": "&euro;", // euro
"&#163;": "&pound;", // pound
"&#165;": "&yen;", // yen
"&#162;": "&cent;", // cent
"&#167;": "&sect;", // section
"&#8482;": "&trade;", // trademark
"&#9824;": "&spades;", // spade
"&#9827;": "&clubs;", // club
"&#9829;": "&hearts;", // heart
"&#9830;": "&diams;", // diamond
// Special characters
"&#161;": "&iexcl;", // inverted exclamation
"&#191;": "&iquest;", // inverted question
"&#171;": "&laquo;", // left angle quotes
"&#187;": "&raquo;", // right angle quotes
"&#183;": "&middot;", // middle dot
"&#8226;": "&bull;", // bullet
"&#8230;": "&hellip;", // horizontal ellipsis
"&#8242;": "&prime;", // prime
"&#8243;": "&Prime;", // double prime
"&#8254;": "&oline;", // overline
"&#8260;": "&frasl;", // fraction slash
// Math symbols
"&#177;": "&plusmn;", // plus-minus
"&#215;": "&times;", // multiplication
"&#247;": "&divide;", // division
"&#8734;": "&infin;", // infinity
"&#8776;": "&asymp;", // almost equal
"&#8800;": "&ne;", // not equal
"&#8804;": "&le;", // less than or equal
"&#8805;": "&ge;", // greater than or equal
"&#8721;": "&sum;", // summation
"&#8730;": "&radic;", // square root
"&#8747;": "&int;", // integral
// Accented characters
"&#192;": "&Agrave;", // A grave
"&#193;": "&Aacute;", // A acute
"&#194;": "&Acirc;", // A circumflex
"&#195;": "&Atilde;", // A tilde
"&#196;": "&Auml;", // A umlaut
"&#197;": "&Aring;", // A ring
"&#198;": "&AElig;", // AE ligature
"&#199;": "&Ccedil;", // C cedilla
"&#200;": "&Egrave;", // E grave
"&#201;": "&Eacute;", // E acute
"&#202;": "&Ecirc;", // E circumflex
"&#203;": "&Euml;", // E umlaut
"&#204;": "&Igrave;", // I grave
"&#205;": "&Iacute;", // I acute
"&#206;": "&Icirc;", // I circumflex
"&#207;": "&Iuml;", // I umlaut
"&#208;": "&ETH;", // Eth
"&#209;": "&Ntilde;", // N tilde
"&#210;": "&Ograve;", // O grave
"&#211;": "&Oacute;", // O acute
"&#212;": "&Ocirc;", // O circumflex
"&#213;": "&Otilde;", // O tilde
"&#214;": "&Ouml;", // O umlaut
"&#216;": "&Oslash;", // O slash
"&#217;": "&Ugrave;", // U grave
"&#218;": "&Uacute;", // U acute
"&#219;": "&Ucirc;", // U circumflex
"&#220;": "&Uuml;", // U umlaut
"&#221;": "&Yacute;", // Y acute
"&#222;": "&THORN;", // Thorn
"&#223;": "&szlig;", // Sharp s
"&#224;": "&agrave;", // a grave
"&#225;": "&aacute;", // a acute
"&#226;": "&acirc;", // a circumflex
"&#227;": "&atilde;", // a tilde
"&#228;": "&auml;", // a umlaut
"&#229;": "&aring;", // a ring
"&#230;": "&aelig;", // ae ligature
"&#231;": "&ccedil;", // c cedilla
"&#232;": "&egrave;", // e grave
"&#233;": "&eacute;", // e acute
"&#234;": "&ecirc;", // e circumflex
"&#235;": "&euml;", // e umlaut
"&#236;": "&igrave;", // i grave
"&#237;": "&iacute;", // i acute
"&#238;": "&icirc;", // i circumflex
"&#239;": "&iuml;", // i umlaut
"&#240;": "&eth;", // eth
"&#241;": "&ntilde;", // n tilde
"&#242;": "&ograve;", // o grave
"&#243;": "&oacute;", // o acute
"&#244;": "&ocirc;", // o circumflex
"&#245;": "&otilde;", // o tilde
"&#246;": "&ouml;", // o umlaut
"&#248;": "&oslash;", // o slash
"&#249;": "&ugrave;", // u grave
"&#250;": "&uacute;", // u acute
"&#251;": "&ucirc;", // u circumflex
"&#252;": "&uuml;", // u umlaut
"&#253;": "&yacute;", // y acute
"&#254;": "&thorn;", // thorn
"&#255;": "&yuml;", // y umlaut
}
result := xml
for numeric, named := range replacements {
result = strings.ReplaceAll(result, numeric, named)
}
return result
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,4 +0,0 @@
// The package is now using github.com/antchfx/xmlquery for XPath parsing.
// The parsing functionality tests have been removed since we're now
// delegating XPath parsing to the xmlquery library.
package xpath

View File

@@ -1,4 +0,0 @@
// The package is now using github.com/antchfx/xmlquery for XPath parsing.
// The parsing functionality tests have been removed since we're now
// delegating XPath parsing to the xmlquery library.
package xpath

View File

@@ -1,133 +0,0 @@
package xpath
import (
"errors"
"fmt"
"github.com/antchfx/xmlquery"
)
// Get retrieves nodes from XML data using an XPath expression
func Get(node *xmlquery.Node, path string) ([]*xmlquery.Node, error) {
if node == nil {
return nil, errors.New("nil node provided")
}
// Execute xpath query directly
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return nil, fmt.Errorf("failed to execute XPath query: %v", err)
}
return nodes, nil
}
// Set updates a single node in the XML data using an XPath expression
func Set(node *xmlquery.Node, path string, value interface{}) error {
if node == nil {
return errors.New("nil node provided")
}
// Find the node to update
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return fmt.Errorf("failed to execute XPath query: %v", err)
}
if len(nodes) == 0 {
return fmt.Errorf("no nodes found for path: %s", path)
}
// Update the first matching node
updateNodeValue(nodes[0], value)
return nil
}
// SetAll updates all nodes that match the XPath expression
func SetAll(node *xmlquery.Node, path string, value interface{}) error {
if node == nil {
return errors.New("nil node provided")
}
// Find all nodes to update
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return fmt.Errorf("failed to execute XPath query: %v", err)
}
if len(nodes) == 0 {
return fmt.Errorf("no nodes found for path: %s", path)
}
// Update all matching nodes
for _, matchNode := range nodes {
updateNodeValue(matchNode, value)
}
return nil
}
// Helper function to update a node's value
func updateNodeValue(node *xmlquery.Node, value interface{}) {
strValue := fmt.Sprintf("%v", value)
// Handle different node types
switch node.Type {
case xmlquery.AttributeNode:
// For attribute nodes, update the attribute value
parent := node.Parent
if parent != nil {
for i, attr := range parent.Attr {
if attr.Name.Local == node.Data {
parent.Attr[i].Value = strValue
break
}
}
}
case xmlquery.TextNode:
// For text nodes, update the text content
node.Data = strValue
case xmlquery.ElementNode:
// For element nodes, clear existing text children and add a new text node
// First, remove all existing text children
var nonTextChildren []*xmlquery.Node
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type != xmlquery.TextNode {
nonTextChildren = append(nonTextChildren, child)
}
}
// Clear all children
node.FirstChild = nil
node.LastChild = nil
// Add a new text node
textNode := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: strValue,
Parent: node,
}
// Set the text node as the first child
node.FirstChild = textNode
node.LastChild = textNode
// Add back non-text children
for _, child := range nonTextChildren {
child.Parent = node
// If this is the first child being added back
if node.FirstChild == textNode && node.LastChild == textNode {
node.FirstChild.NextSibling = child
child.PrevSibling = node.FirstChild
node.LastChild = child
} else {
// Add to the end of the chain
node.LastChild.NextSibling = child
child.PrevSibling = node.LastChild
node.LastChild = child
}
}
}
}

View File

@@ -1,474 +0,0 @@
package xpath
import (
"strings"
"testing"
"github.com/antchfx/xmlquery"
)
// Parse test XML data once at the beginning for use in multiple tests
func parseTestXML(t *testing.T, xmlData string) *xmlquery.Node {
doc, err := xmlquery.Parse(strings.NewReader(xmlData))
if err != nil {
t.Fatalf("Failed to parse test XML: %v", err)
}
return doc
}
// XML test data as a string for our tests
var testXML = `
<store>
<book category="fiction">
<title lang="en">The Fellowship of the Ring</title>
<author>J.R.R. Tolkien</author>
<year>1954</year>
<price>22.99</price>
</book>
<book category="fiction">
<title lang="en">The Two Towers</title>
<author>J.R.R. Tolkien</author>
<year>1954</year>
<price>23.45</price>
</book>
<book category="technical">
<title lang="en">Learning XML</title>
<author>Erik T. Ray</author>
<year>2003</year>
<price>39.95</price>
</book>
<bicycle>
<color>red</color>
<price>199.95</price>
</bicycle>
</store>
`
func TestEvaluator(t *testing.T) {
// Parse the test XML data once for all test cases
doc := parseTestXML(t, testXML)
tests := []struct {
name string
path string
error bool
}{
{
name: "simple_element_access",
path: "/store/bicycle/color",
},
{
name: "recursive_element_access",
path: "//price",
},
{
name: "wildcard_element_access",
path: "/store/book/*",
},
{
name: "attribute_exists_predicate",
path: "//title[@lang]",
},
{
name: "attribute_equals_predicate",
path: "//title[@lang='en']",
},
{
name: "value_comparison_predicate",
path: "/store/book[price>35.00]/title",
error: true,
},
{
name: "last_predicate",
path: "/store/book[last()]/title",
error: true,
},
{
name: "last_minus_predicate",
path: "/store/book[last()-1]/title",
error: true,
},
{
name: "position_predicate",
path: "/store/book[position()<3]/title",
error: true,
},
{
name: "invalid_index",
path: "/store/book[10]/title",
error: true,
},
{
name: "nonexistent_element",
path: "/store/nonexistent",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(doc, tt.path)
// Handle expected errors
if tt.error {
if err == nil && len(result) == 0 {
// If we expected an error but got empty results instead, that's okay
return
}
if err != nil {
// If we got an error as expected, that's okay
return
}
} else if err != nil {
// If we didn't expect an error but got one, that's a test failure
t.Errorf("Get(%q) returned unexpected error: %v", tt.path, err)
return
}
// Special cases where we don't care about exact matches
switch tt.name {
case "wildcard_element_access":
// Just check that we got some elements
if len(result) == 0 {
t.Errorf("Expected multiple elements for wildcard, got none")
}
return
case "attribute_exists_predicate", "attribute_equals_predicate":
// Just check that we got some titles
if len(result) == 0 {
t.Errorf("Expected titles with lang attribute, got none")
}
// Ensure all are title elements
for _, node := range result {
if node.Data != "title" {
t.Errorf("Expected title elements, got: %s", node.Data)
}
}
return
case "nonexistent_element":
// Just check that we got empty results
if len(result) != 0 {
t.Errorf("Expected empty results for nonexistent element, got %d items", len(result))
}
return
}
// For other cases, just verify we got results
if len(result) == 0 {
t.Errorf("Expected results for path %s, got none", tt.path)
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("nil_node", func(t *testing.T) {
result, err := Get(nil, "/store/book")
if err == nil {
t.Errorf("Expected error for nil node")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("invalid_xml", func(t *testing.T) {
invalidXML, err := xmlquery.Parse(strings.NewReader("<invalid>xml"))
if err != nil {
// If parsing fails, that's expected
return
}
_, err = Get(invalidXML, "/store")
if err == nil {
t.Error("Expected error for invalid XML structure")
}
})
// For these tests with the simple XML, we expect just one result
simpleXML := `<root><book><title lang="en">Test</title></book></root>`
doc := parseTestXML(t, simpleXML)
t.Run("current_node", func(t *testing.T) {
result, err := Get(doc, "/root/book/.")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) > 1 {
t.Errorf("Expected at most 1 result, got %d", len(result))
}
if len(result) > 0 {
// Verify it's the book node
if result[0].Data != "book" {
t.Errorf("Expected book node, got %v", result[0].Data)
}
}
})
t.Run("attributes", func(t *testing.T) {
result, err := Get(doc, "/root/book/title/@lang")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 || result[0].InnerText() != "en" {
t.Errorf("Expected 'en', got %v", result[0].InnerText())
}
})
}
func TestGetWithPaths(t *testing.T) {
// Use a simplified, well-formed XML document
simpleXML := `<store>
<book category="fiction">
<title lang="en">The Book Title</title>
<author>Author Name</author>
<price>19.99</price>
</book>
<bicycle>
<color>red</color>
<price>199.95</price>
</bicycle>
</store>`
// Parse the XML for testing
doc := parseTestXML(t, simpleXML)
// Debug: Print the test XML
t.Logf("Test XML:\n%s", simpleXML)
tests := []struct {
name string
path string
expectedValue string
}{
{
name: "simple_element_access",
path: "/store/bicycle/color",
expectedValue: "red",
},
{
name: "attribute_access",
path: "/store/book/title/@lang",
expectedValue: "en",
},
{
name: "recursive_with_attribute",
path: "//title[@lang='en']",
expectedValue: "The Book Title",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Debug: Print the path we're looking for
t.Logf("Looking for path: %s", tt.path)
result, err := Get(doc, tt.path)
if err != nil {
t.Errorf("Get(%q) returned error: %v", tt.path, err)
return
}
// Debug: Print the results
t.Logf("Got %d results", len(result))
for i, r := range result {
t.Logf("Result %d: Node=%s, Value=%v", i, r.Data, r.InnerText())
}
// Check that we got results
if len(result) == 0 {
t.Errorf("Get(%q) returned no results", tt.path)
return
}
// For attribute access test, do more specific checks
if tt.name == "attribute_access" {
// Check the first result's value matches expected
if result[0].InnerText() != tt.expectedValue {
t.Errorf("Attribute value: got %v, expected %s", result[0].InnerText(), tt.expectedValue)
}
}
// For simple element access, check the text content
if tt.name == "simple_element_access" {
if text := result[0].InnerText(); text != tt.expectedValue {
t.Errorf("Element text: got %s, expected %s", text, tt.expectedValue)
}
}
// For recursive with attribute test, check title elements with lang="en"
if tt.name == "recursive_with_attribute" {
for _, node := range result {
// Check the node is a title
if node.Data != "title" {
t.Errorf("Expected title element, got %s", node.Data)
}
// Check text content
if text := node.InnerText(); text != tt.expectedValue {
t.Errorf("Text content: got %s, expected %s", text, tt.expectedValue)
}
// Check attributes - find the lang attribute
hasLang := false
for _, attr := range node.Attr {
if attr.Name.Local == "lang" && attr.Value == "en" {
hasLang = true
break
}
}
if !hasLang {
t.Errorf("Expected lang=\"en\" attribute, but it was not found")
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple element", func(t *testing.T) {
xmlData := `<root><name>John</name></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(doc, "/root/name")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 {
t.Errorf("Expected 1 result, got %d", len(result))
return
}
// Check text content
if text := result[0].InnerText(); text != "Jane" {
t.Errorf("Expected text 'Jane', got '%s'", text)
}
})
t.Run("attribute", func(t *testing.T) {
xmlData := `<root><element id="123"></element></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/element/@id", "456")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(doc, "/root/element/@id")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 {
t.Errorf("Expected 1 result, got %d", len(result))
return
}
// For attributes, check the inner text
if text := result[0].InnerText(); text != "456" {
t.Errorf("Expected attribute value '456', got '%s'", text)
}
})
t.Run("indexed element", func(t *testing.T) {
xmlData := `<root><items><item>first</item><item>second</item></items></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/items/item[1]", "changed")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change using XPath that specifically targets the first item
result, err := Get(doc, "/root/items/item[1]")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if we have results
if len(result) == 0 {
t.Errorf("Expected at least one result for /root/items/item[1]")
return
}
// Check text content
if text := result[0].InnerText(); text != "changed" {
t.Errorf("Expected text 'changed', got '%s'", text)
}
})
}
func TestSetAll(t *testing.T) {
t.Run("multiple elements", func(t *testing.T) {
xmlData := `<root><items><item>first</item><item>second</item></items></root>`
doc := parseTestXML(t, xmlData)
err := SetAll(doc, "//item", "changed")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Verify all items are changed
result, err := Get(doc, "//item")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 2 {
t.Errorf("Expected 2 results, got %d", len(result))
return
}
// Check each node
for i, node := range result {
if text := node.InnerText(); text != "changed" {
t.Errorf("Item %d: expected text 'changed', got '%s'", i, text)
}
}
})
t.Run("attributes", func(t *testing.T) {
xmlData := `<root><item id="1"/><item id="2"/></root>`
doc := parseTestXML(t, xmlData)
err := SetAll(doc, "//item/@id", "new")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Verify all attributes are changed
result, err := Get(doc, "//item/@id")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 2 {
t.Errorf("Expected 2 results, got %d", len(result))
return
}
// For attributes, check inner text
for i, node := range result {
if text := node.InnerText(); text != "new" {
t.Errorf("Attribute %d: expected value 'new', got '%s'", i, text)
}
}
})
}

View File

@@ -0,0 +1,137 @@
package regression
import (
"cook/processor"
"cook/utils"
"os"
"path/filepath"
"testing"
)
func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
command := utils.ModifyCommand{
Regex: regex,
Lua: lua,
LogLevel: "TRACE",
}
commands, err := processor.ProcessRegex(content, command, "test")
if err != nil {
return "", 0, 0, err
}
result, modifications := utils.ExecuteModifications(commands, content)
return result, modifications, len(commands), nil
}
func TestTalentsMechanicOutOfRange(t *testing.T) {
given := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
actual := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="30" color="gui.green"/>
<Replace tag="[duration]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="20"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
if matches != 4 {
t.Errorf("Expected 4 matches, got %d", matches)
}
if mods != 4 {
t.Errorf("Expected 4 modifications, got %d", mods)
}
if result != actual {
t.Errorf("expected %s, got %s", actual, result)
}
}
func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
cwd, err := os.Getwd()
if err != nil {
t.Fatalf("Error getting current working directory: %v", err)
}
given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
// We don't really care how many god damn matches there are as long as the result is correct
// if matches != 45 {
// t.Errorf("Expected 45 match, got %d", matches)
// }
//
// if mods != 45 {
// t.Errorf("Expected 45 modification, got %d", mods)
// }
if string(result) != string(expected) {
t.Errorf("expected %s, got %s", expected, result)
}
}

View File

@@ -17,6 +17,7 @@ echo "Tag: $TAG"
echo "Building the thing..."
go build -o chef.exe .
go install .
echo "Creating a release..."
TOKEN="$GITEA_API_KEY"

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

View File

@@ -1,12 +0,0 @@
<config>
<item>
<value>75</value>
<multiplier>2</multiplier>
<divider>4</divider>
</item>
<item>
<value>150</value>
<multiplier>3</multiplier>
<divider>2</divider>
</item>
</config>

View File

@@ -1,37 +0,0 @@
<?xml version="1.0" encoding="UTF-8"?>
<testdata>
<!-- Numeric values -->
<item>
<id>1</id>
<value>200</value>
<price>24.99</price>
<quantity>5</quantity>
</item>
<!-- Text values -->
<item>
<id>2</id>
<name>Test Product</name>
<description>This is a test product description</description>
<category>Test</category>
</item>
<!-- Mixed content -->
<item>
<id>3</id>
<name>Mixed Product</name>
<price>19.99</price>
<code>PRD-123</code>
<tags>sale,discount,new</tags>
</item>
<!-- Empty and special values -->
<item>
<id>4</id>
<value></value>
<specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
<multiline>Line 1
Line 2
Line 3</multiline>
</item>
</testdata>

11
test_surgical.yml Normal file
View File

@@ -0,0 +1,11 @@
- name: SurgicalWeightTest
json: true
lua: |
-- This demonstrates surgical JSON editing
-- Only the Weight field of Item_Fiber will be modified
data.Rows[1].Weight = 999
modified = true
files:
- 'D_Itemable.json'
reset: false
loglevel: INFO

1252
testfiles/OutpostItems.xml Normal file

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

157
utils/db.go Normal file
View File

@@ -0,0 +1,157 @@
package utils
import (
"path/filepath"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
"gorm.io/driver/sqlite"
"gorm.io/gorm"
gormlogger "gorm.io/gorm/logger"
)
// dbLogger is a scoped logger for the utils/db package.
var dbLogger = logger.Default.WithPrefix("utils/db")
type DB interface {
DB() *gorm.DB
Raw(sql string, args ...any) *gorm.DB
SaveFile(filePath string, fileData []byte) error
GetFile(filePath string) ([]byte, error)
GetAllFiles() ([]FileSnapshot, error)
RemoveAllFiles() error
}
type FileSnapshot struct {
Date time.Time `gorm:"primaryKey"`
FilePath string `gorm:"primaryKey"`
FileData []byte `gorm:"type:blob"`
}
type DBWrapper struct {
db *gorm.DB
}
var globalDB *DBWrapper
func GetDB() (DB, error) {
getDBLogger := dbLogger.WithPrefix("GetDB")
getDBLogger.Debug("Attempting to get database connection")
var err error
dbFile := filepath.Join("data.sqlite")
getDBLogger.Debug("Opening database file: %q", dbFile)
db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
// SkipDefaultTransaction: true,
PrepareStmt: true,
Logger: gormlogger.Default.LogMode(gormlogger.Silent),
})
if err != nil {
getDBLogger.Error("Failed to open database: %v", err)
return nil, err
}
getDBLogger.Debug("Database opened successfully, running auto migration")
if err := db.AutoMigrate(&FileSnapshot{}); err != nil {
getDBLogger.Error("Auto migration failed: %v", err)
return nil, err
}
getDBLogger.Debug("Auto migration completed")
globalDB = &DBWrapper{db: db}
getDBLogger.Debug("Database wrapper initialized")
return globalDB, nil
}
// Just a wrapper
func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
rawLogger := dbLogger.WithPrefix("Raw").WithField("sql", sql)
rawLogger.Debug("Executing raw SQL query with args: %v", args)
return db.db.Raw(sql, args...)
}
func (db *DBWrapper) DB() *gorm.DB {
dbLogger.WithPrefix("DB").Debug("Returning GORM DB instance")
return db.db
}
func (db *DBWrapper) FileExists(filePath string) (bool, error) {
fileExistsLogger := dbLogger.WithPrefix("FileExists").WithField("filePath", filePath)
fileExistsLogger.Debug("Checking if file exists in database")
var count int64
err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
if err != nil {
fileExistsLogger.Error("Error checking if file exists: %v", err)
return false, err
}
fileExistsLogger.Debug("File exists: %t", count > 0)
return count > 0, err
}
func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
saveFileLogger := dbLogger.WithPrefix("SaveFile").WithField("filePath", filePath)
saveFileLogger.Debug("Attempting to save file to database")
saveFileLogger.Trace("File data length: %d", len(fileData))
exists, err := db.FileExists(filePath)
if err != nil {
saveFileLogger.Error("Error checking if file exists: %v", err)
return err
}
if exists {
saveFileLogger.Debug("File already exists, skipping save")
return nil
}
saveFileLogger.Debug("Creating new file snapshot in database")
err = db.db.Create(&FileSnapshot{
Date: time.Now(),
FilePath: filePath,
FileData: fileData,
}).Error
if err != nil {
saveFileLogger.Error("Failed to create file snapshot: %v", err)
} else {
saveFileLogger.Debug("File saved successfully to database")
}
return err
}
func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
getFileLogger := dbLogger.WithPrefix("GetFile").WithField("filePath", filePath)
getFileLogger.Debug("Getting file from database")
var fileSnapshot FileSnapshot
err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
if err != nil {
// Downgrade not-found to warning to avoid noisy errors during first run
getFileLogger.Warning("Failed to get file from database: %v", err)
return nil, err
}
getFileLogger.Debug("File found in database")
getFileLogger.Trace("Retrieved file data length: %d", len(fileSnapshot.FileData))
return fileSnapshot.FileData, nil
}
func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
getAllFilesLogger := dbLogger.WithPrefix("GetAllFiles")
getAllFilesLogger.Debug("Getting all files from database")
var fileSnapshots []FileSnapshot
err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
if err != nil {
getAllFilesLogger.Error("Failed to get all files from database: %v", err)
return nil, err
}
getAllFilesLogger.Debug("Found %d files in database", len(fileSnapshots))
getAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
return fileSnapshots, nil
}
func (db *DBWrapper) RemoveAllFiles() error {
removeAllFilesLogger := dbLogger.WithPrefix("RemoveAllFiles")
removeAllFilesLogger.Debug("Removing all files from database")
err := db.db.Exec("DELETE FROM file_snapshots").Error
if err != nil {
removeAllFilesLogger.Error("Failed to remove all files from database: %v", err)
} else {
removeAllFilesLogger.Debug("All files removed from database")
}
return err
}

152
utils/file.go Normal file
View File

@@ -0,0 +1,152 @@
package utils
import (
"os"
"path/filepath"
"strconv"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// fileLogger is a scoped logger for the utils/file package.
var fileLogger = logger.Default.WithPrefix("utils/file")
func CleanPath(path string) string {
cleanPathLogger := fileLogger.WithPrefix("CleanPath")
cleanPathLogger.Debug("Cleaning path: %q", path)
cleanPathLogger.Trace("Original path: %q", path)
path = filepath.Clean(path)
path = strings.ReplaceAll(path, "\\", "/")
cleanPathLogger.Trace("Cleaned path result: %q", path)
return path
}
func ToAbs(path string) string {
toAbsLogger := fileLogger.WithPrefix("ToAbs")
toAbsLogger.Debug("Converting path to absolute: %q", path)
toAbsLogger.Trace("Input path: %q", path)
if filepath.IsAbs(path) {
toAbsLogger.Debug("Path is already absolute, cleaning it.")
cleanedPath := CleanPath(path)
toAbsLogger.Trace("Already absolute path after cleaning: %q", cleanedPath)
return cleanedPath
}
cwd, err := os.Getwd()
if err != nil {
toAbsLogger.Error("Error getting current working directory: %v", err)
return CleanPath(path)
}
toAbsLogger.Trace("Current working directory: %q", cwd)
cleanedPath := CleanPath(filepath.Join(cwd, path))
toAbsLogger.Trace("Converted absolute path result: %q", cleanedPath)
return cleanedPath
}
// LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string {
limitStringLogger := fileLogger.WithPrefix("LimitString").WithField("originalLength", len(s)).WithField("maxLength", maxLen)
limitStringLogger.Debug("Limiting string length")
s = strings.ReplaceAll(s, "\n", "\\n")
if len(s) <= maxLen {
limitStringLogger.Trace("String length (%d) is within max length (%d), no truncation", len(s), maxLen)
return s
}
limited := s[:maxLen-3] + "..."
limitStringLogger.Trace("String truncated from %d to %d characters: %q", len(s), len(limited), limited)
return limited
}
// StrToFloat converts a string to a float64, returning 0 on error.
func StrToFloat(s string) float64 {
strToFloatLogger := fileLogger.WithPrefix("StrToFloat").WithField("inputString", s)
strToFloatLogger.Debug("Attempting to convert string to float")
f, err := strconv.ParseFloat(s, 64)
if err != nil {
strToFloatLogger.Warning("Failed to convert string %q to float, returning 0: %v", s, err)
return 0
}
strToFloatLogger.Trace("Successfully converted %q to float: %f", s, f)
return f
}
func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
resetWhereNecessaryLogger := fileLogger.WithPrefix("ResetWhereNecessary")
resetWhereNecessaryLogger.Debug("Starting reset where necessary operation")
resetWhereNecessaryLogger.Trace("File-command associations input: %v", associations)
dirtyFiles := make(map[string]struct{})
for _, association := range associations {
resetWhereNecessaryLogger.Debug("Processing association for file: %q", association.File)
for _, command := range association.Commands {
resetWhereNecessaryLogger.Debug("Checking command %q for reset requirement", command.Name)
resetWhereNecessaryLogger.Trace("Command details: %v", command)
if command.Reset {
resetWhereNecessaryLogger.Debug("Command %q requires reset for file %q, marking as dirty", command.Name, association.File)
dirtyFiles[association.File] = struct{}{}
}
}
for _, command := range association.IsolateCommands {
resetWhereNecessaryLogger.Debug("Checking isolate command %q for reset requirement", command.Name)
resetWhereNecessaryLogger.Trace("Isolate command details: %v", command)
if command.Reset {
resetWhereNecessaryLogger.Debug("Isolate command %q requires reset for file %q, marking as dirty", command.Name, association.File)
dirtyFiles[association.File] = struct{}{}
}
}
}
resetWhereNecessaryLogger.Debug("Identified %d files that need to be reset", len(dirtyFiles))
resetWhereNecessaryLogger.Trace("Dirty files identified: %v", dirtyFiles)
for file := range dirtyFiles {
resetWhereNecessaryLogger.Debug("Resetting file %q", file)
fileData, err := db.GetFile(file)
if err != nil {
resetWhereNecessaryLogger.Warning("Failed to get original content for file %q from database: %v", file, err)
// Seed the snapshot from current disk content if missing, then use it as fallback
currentData, readErr := os.ReadFile(file)
if readErr != nil {
resetWhereNecessaryLogger.Warning("Additionally failed to read current file content for %q: %v", file, readErr)
continue
}
// Best-effort attempt to save baseline; ignore errors to avoid blocking reset
if saveErr := db.SaveFile(file, currentData); saveErr != nil {
resetWhereNecessaryLogger.Warning("Failed to seed baseline snapshot for %q: %v", file, saveErr)
}
fileData = currentData
}
resetWhereNecessaryLogger.Trace("Retrieved original file data length for %q: %d", file, len(fileData))
resetWhereNecessaryLogger.Debug("Writing original content back to file %q", file)
err = os.WriteFile(file, fileData, 0644)
if err != nil {
resetWhereNecessaryLogger.Warning("Failed to write original content back to file %q: %v", file, err)
continue
}
resetWhereNecessaryLogger.Debug("Successfully reset file %q", file)
}
resetWhereNecessaryLogger.Debug("Finished reset where necessary operation")
return nil
}
func ResetAllFiles(db DB) error {
resetAllFilesLogger := fileLogger.WithPrefix("ResetAllFiles")
resetAllFilesLogger.Debug("Starting reset all files operation")
fileSnapshots, err := db.GetAllFiles()
if err != nil {
resetAllFilesLogger.Error("Failed to get all file snapshots from database: %v", err)
return err
}
resetAllFilesLogger.Debug("Found %d files in database to reset", len(fileSnapshots))
resetAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
for _, fileSnapshot := range fileSnapshots {
resetAllFilesLogger.Debug("Resetting file %q", fileSnapshot.FilePath)
err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
if err != nil {
resetAllFilesLogger.Warning("Failed to write file %q to disk: %v", fileSnapshot.FilePath, err)
continue
}
resetAllFilesLogger.Debug("File %q written to disk successfully", fileSnapshot.FilePath)
}
resetAllFilesLogger.Debug("Finished reset all files operation")
return nil
}

21
utils/flags.go Normal file
View File

@@ -0,0 +1,21 @@
package utils
import (
"flag"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// flagsLogger is a scoped logger for the utils/flags package.
var flagsLogger = logger.Default.WithPrefix("utils/flags")
var (
ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
Filter = flag.String("f", "", "Filter commands before running them")
JSON = flag.Bool("json", false, "Enable JSON mode for processing JSON files")
)
func init() {
flagsLogger.Debug("Initializing flags")
flagsLogger.Trace("ParallelFiles initial value: %d, Filter initial value: %q, JSON initial value: %t", *ParallelFiles, *Filter, *JSON)
}

375
utils/modifycommand.go Normal file
View File

@@ -0,0 +1,375 @@
package utils
import (
"fmt"
"os"
"path/filepath"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/bmatcuk/doublestar/v4"
"gopkg.in/yaml.v3"
)
// modifyCommandLogger is a scoped logger for the utils/modifycommand package.
var modifyCommandLogger = logger.Default.WithPrefix("utils/modifycommand")
type ModifyCommand struct {
Name string `yaml:"name,omitempty"`
Regex string `yaml:"regex,omitempty"`
Regexes []string `yaml:"regexes,omitempty"`
Lua string `yaml:"lua,omitempty"`
Files []string `yaml:"files,omitempty"`
Reset bool `yaml:"reset,omitempty"`
LogLevel string `yaml:"loglevel,omitempty"`
Isolate bool `yaml:"isolate,omitempty"`
NoDedup bool `yaml:"nodedup,omitempty"`
Disabled bool `yaml:"disable,omitempty"`
JSON bool `yaml:"json,omitempty"`
Modifiers map[string]interface{} `yaml:"modifiers,omitempty"`
}
type CookFile []ModifyCommand
func (c *ModifyCommand) Validate() error {
validateLogger := modifyCommandLogger.WithPrefix("Validate").WithField("commandName", c.Name)
validateLogger.Debug("Validating command")
// For JSON mode, regex patterns are not required
if !c.JSON {
if c.Regex == "" && len(c.Regexes) == 0 {
validateLogger.Error("Validation failed: Regex pattern is required for non-JSON mode")
return fmt.Errorf("pattern is required for non-JSON mode")
}
}
if c.Lua == "" {
validateLogger.Error("Validation failed: Lua expression is required")
return fmt.Errorf("lua expression is required")
}
if len(c.Files) == 0 {
validateLogger.Error("Validation failed: At least one file is required")
return fmt.Errorf("at least one file is required")
}
if c.LogLevel == "" {
validateLogger.Debug("LogLevel not specified, defaulting to INFO")
c.LogLevel = "INFO"
}
validateLogger.Debug("Command validated successfully")
return nil
}
// Ehh.. Not much better... Guess this wasn't the big deal
var matchesMemoTable map[string]bool = make(map[string]bool)
func Matches(path string, glob string) (bool, error) {
matchesLogger := modifyCommandLogger.WithPrefix("Matches").WithField("path", path).WithField("glob", glob)
matchesLogger.Debug("Checking if path matches glob")
key := fmt.Sprintf("%s:%s", path, glob)
if matches, ok := matchesMemoTable[key]; ok {
matchesLogger.Debug("Found match in memo table: %t", matches)
return matches, nil
}
matches, err := doublestar.Match(glob, path)
if err != nil {
matchesLogger.Error("Failed to match glob: %v", err)
return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
}
matchesMemoTable[key] = matches
matchesLogger.Debug("Match result: %t, storing in memo table", matches)
return matches, nil
}
func SplitPattern(pattern string) (string, string) {
splitPatternLogger := modifyCommandLogger.WithPrefix("SplitPattern").WithField("pattern", pattern)
splitPatternLogger.Debug("Splitting pattern")
splitPatternLogger.Trace("Original pattern: %q", pattern)
static, pattern := doublestar.SplitPattern(pattern)
cwd, err := os.Getwd()
if err != nil {
splitPatternLogger.Error("Error getting current working directory: %v", err)
return "", ""
}
splitPatternLogger.Trace("Current working directory: %q", cwd)
if static == "" {
splitPatternLogger.Debug("Static part is empty, defaulting to current working directory")
static = cwd
}
if !filepath.IsAbs(static) {
splitPatternLogger.Debug("Static part is not absolute, joining with current working directory")
static = filepath.Join(cwd, static)
static = filepath.Clean(static)
splitPatternLogger.Trace("Static path after joining and cleaning: %q", static)
}
static = strings.ReplaceAll(static, "\\", "/")
splitPatternLogger.Trace("Final static path: %q, Remaining pattern: %q", static, pattern)
return static, pattern
}
type FileCommandAssociation struct {
File string
IsolateCommands []ModifyCommand
Commands []ModifyCommand
}
func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
associateFilesLogger := modifyCommandLogger.WithPrefix("AssociateFilesWithCommands")
associateFilesLogger.Debug("Associating files with commands")
associateFilesLogger.Trace("Input files: %v", files)
associateFilesLogger.Trace("Input commands: %v", commands)
associationCount := 0
fileCommands := make(map[string]FileCommandAssociation)
for _, file := range files {
file = strings.ReplaceAll(file, "\\", "/")
associateFilesLogger.Debug("Processing file: %q", file)
fileCommands[file] = FileCommandAssociation{
File: file,
IsolateCommands: []ModifyCommand{},
Commands: []ModifyCommand{},
}
for _, command := range commands {
associateFilesLogger.Debug("Checking command %q for file %q", command.Name, file)
for _, glob := range command.Files {
glob = strings.ReplaceAll(glob, "\\", "/")
static, pattern := SplitPattern(glob)
associateFilesLogger.Trace("Glob parts for %q → static=%q pattern=%q", glob, static, pattern)
// Build absolute path for the current file to compare with static
cwd, err := os.Getwd()
if err != nil {
associateFilesLogger.Warning("Failed to get CWD when matching %q for file %q: %v", glob, file, err)
continue
}
var absFile string
if filepath.IsAbs(file) {
absFile = filepath.Clean(file)
} else {
absFile = filepath.Clean(filepath.Join(cwd, file))
}
absFile = strings.ReplaceAll(absFile, "\\", "/")
associateFilesLogger.Trace("Absolute file path resolved for matching: %q", absFile)
// Only match if the file is under the static root
if !(strings.HasPrefix(absFile, static+"/") || absFile == static) {
associateFilesLogger.Trace("Skipping glob %q for file %q because file is outside static root %q", glob, file, static)
continue
}
patternFile := strings.TrimPrefix(absFile, static+`/`)
associateFilesLogger.Trace("Pattern-relative path used for match: %q", patternFile)
matches, err := Matches(patternFile, pattern)
if err != nil {
associateFilesLogger.Warning("Failed to match glob %q with file %q: %v", glob, file, err)
continue
}
if matches {
associateFilesLogger.Debug("File %q matches glob %q. Associating with command %q", file, glob, command.Name)
association := fileCommands[file]
if command.Isolate {
associateFilesLogger.Debug("Command %q is an isolate command, adding to isolate list", command.Name)
association.IsolateCommands = append(association.IsolateCommands, command)
} else {
associateFilesLogger.Debug("Command %q is a regular command, adding to regular list", command.Name)
association.Commands = append(association.Commands, command)
}
fileCommands[file] = association
associationCount++
} else {
associateFilesLogger.Trace("File %q did not match glob %q (pattern=%q, rel=%q)", file, glob, pattern, patternFile)
}
}
}
currentFileCommands := fileCommands[file]
associateFilesLogger.Debug("Finished processing file %q. Found %d regular commands and %d isolate commands", file, len(currentFileCommands.Commands), len(currentFileCommands.IsolateCommands))
associateFilesLogger.Trace("Commands for file %q: %v", file, currentFileCommands.Commands)
associateFilesLogger.Trace("Isolate commands for file %q: %v", file, currentFileCommands.IsolateCommands)
}
associateFilesLogger.Info("Completed association. Found %d total associations for %d files and %d commands", associationCount, len(files), len(commands))
return fileCommands, nil
}
func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
aggregateGlobsLogger := modifyCommandLogger.WithPrefix("AggregateGlobs")
aggregateGlobsLogger.Debug("Aggregating glob patterns from commands")
aggregateGlobsLogger.Trace("Input commands for aggregation: %v", commands)
globs := make(map[string]struct{})
for _, command := range commands {
aggregateGlobsLogger.Debug("Processing command %q for glob patterns", command.Name)
for _, glob := range command.Files {
resolvedGlob := strings.Replace(glob, "~", os.Getenv("HOME"), 1)
resolvedGlob = strings.ReplaceAll(resolvedGlob, "\\", "/")
aggregateGlobsLogger.Trace("Adding glob: %q (resolved to %q)", glob, resolvedGlob)
globs[resolvedGlob] = struct{}{}
}
}
aggregateGlobsLogger.Debug("Finished aggregating globs. Found %d unique glob patterns", len(globs))
aggregateGlobsLogger.Trace("Aggregated unique globs: %v", globs)
return globs
}
func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
expandGlobsLogger := modifyCommandLogger.WithPrefix("ExpandGLobs")
expandGlobsLogger.Debug("Expanding glob patterns to actual files")
expandGlobsLogger.Trace("Input patterns for expansion: %v", patterns)
var files []string
filesMap := make(map[string]bool)
cwd, err := os.Getwd()
if err != nil {
expandGlobsLogger.Error("Failed to get current working directory: %v", err)
return nil, fmt.Errorf("failed to get current working directory: %w", err)
}
expandGlobsLogger.Debug("Current working directory: %q", cwd)
for pattern := range patterns {
expandGlobsLogger.Debug("Processing glob pattern: %q", pattern)
static, pattern := SplitPattern(pattern)
matches, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
expandGlobsLogger.Warning("Error expanding glob %q in %q: %v", pattern, static, err)
continue
}
expandGlobsLogger.Debug("Found %d matches for pattern %q", len(matches), pattern)
expandGlobsLogger.Trace("Raw matches for pattern %q: %v", pattern, matches)
for _, m := range matches {
m = filepath.Join(static, m)
info, err := os.Stat(m)
if err != nil {
expandGlobsLogger.Warning("Error getting file info for %q: %v", m, err)
continue
}
if !info.IsDir() && !filesMap[m] {
expandGlobsLogger.Trace("Adding unique file to list: %q", m)
filesMap[m], files = true, append(files, m)
}
}
}
if len(files) > 0 {
expandGlobsLogger.Debug("Finished expanding globs. Found %d unique files to process", len(files))
expandGlobsLogger.Trace("Unique files to process: %v", files)
} else {
expandGlobsLogger.Warning("No files found after expanding glob patterns.")
}
return files, nil
}
func LoadCommands(args []string) ([]ModifyCommand, error) {
loadCommandsLogger := modifyCommandLogger.WithPrefix("LoadCommands")
loadCommandsLogger.Debug("Loading commands from arguments (cook files or direct patterns)")
loadCommandsLogger.Trace("Input arguments: %v", args)
commands := []ModifyCommand{}
for _, arg := range args {
loadCommandsLogger.Debug("Processing argument for commands: %q", arg)
newCommands, err := LoadCommandsFromCookFiles(arg)
if err != nil {
loadCommandsLogger.Error("Failed to load commands from argument %q: %v", arg, err)
return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
}
loadCommandsLogger.Debug("Successfully loaded %d commands from %q", len(newCommands), arg)
for _, cmd := range newCommands {
if cmd.Disabled {
loadCommandsLogger.Debug("Skipping disabled command: %q", cmd.Name)
continue
}
commands = append(commands, cmd)
loadCommandsLogger.Trace("Added command %q. Current total commands: %d", cmd.Name, len(commands))
}
}
loadCommandsLogger.Info("Finished loading commands. Total %d commands loaded", len(commands))
return commands, nil
}
func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
loadCookFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFiles").WithField("pattern", pattern)
loadCookFilesLogger.Debug("Loading commands from cook files based on pattern")
loadCookFilesLogger.Trace("Input pattern: %q", pattern)
static, pattern := SplitPattern(pattern)
commands := []ModifyCommand{}
cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
loadCookFilesLogger.Error("Failed to glob cook files for pattern %q: %v", pattern, err)
return nil, fmt.Errorf("failed to glob cook files: %w", err)
}
loadCookFilesLogger.Debug("Found %d cook files for pattern %q", len(cookFiles), pattern)
loadCookFilesLogger.Trace("Cook files found: %v", cookFiles)
for _, cookFile := range cookFiles {
cookFile = filepath.Join(static, cookFile)
cookFile = filepath.Clean(cookFile)
cookFile = strings.ReplaceAll(cookFile, "\\", "/")
loadCookFilesLogger.Debug("Loading commands from individual cook file: %q", cookFile)
cookFileData, err := os.ReadFile(cookFile)
if err != nil {
loadCookFilesLogger.Error("Failed to read cook file %q: %v", cookFile, err)
return nil, fmt.Errorf("failed to read cook file: %w", err)
}
loadCookFilesLogger.Trace("Read %d bytes from cook file %q", len(cookFileData), cookFile)
newCommands, err := LoadCommandsFromCookFile(cookFileData)
if err != nil {
loadCookFilesLogger.Error("Failed to load commands from cook file data for %q: %v", cookFile, err)
return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
}
commands = append(commands, newCommands...)
loadCookFilesLogger.Debug("Added %d commands from cook file %q. Total commands now: %d", len(newCommands), cookFile, len(commands))
}
loadCookFilesLogger.Debug("Finished loading commands from cook files. Total %d commands", len(commands))
return commands, nil
}
func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
loadCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFile")
loadCommandLogger.Debug("Unmarshaling commands from cook file data")
loadCommandLogger.Trace("Cook file data length: %d", len(cookFileData))
commands := []ModifyCommand{}
err := yaml.Unmarshal(cookFileData, &commands)
if err != nil {
loadCommandLogger.Error("Failed to unmarshal cook file data: %v", err)
return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
}
loadCommandLogger.Debug("Successfully unmarshaled %d commands", len(commands))
loadCommandLogger.Trace("Unmarshaled commands: %v", commands)
return commands, nil
}
// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
func CountGlobsBeforeDedup(commands []ModifyCommand) int {
countGlobsLogger := modifyCommandLogger.WithPrefix("CountGlobsBeforeDedup")
countGlobsLogger.Debug("Counting glob patterns before deduplication")
count := 0
for _, cmd := range commands {
countGlobsLogger.Trace("Processing command %q, adding %d globs", cmd.Name, len(cmd.Files))
count += len(cmd.Files)
}
countGlobsLogger.Debug("Total glob patterns before deduplication: %d", count)
return count
}
func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
filterCommandsLogger := modifyCommandLogger.WithPrefix("FilterCommands").WithField("filter", filter)
filterCommandsLogger.Debug("Filtering commands")
filterCommandsLogger.Trace("Input commands: %v", commands)
filteredCommands := []ModifyCommand{}
filters := strings.Split(filter, ",")
filterCommandsLogger.Trace("Split filters: %v", filters)
for _, cmd := range commands {
filterCommandsLogger.Debug("Checking command %q against filters", cmd.Name)
for _, f := range filters {
if strings.Contains(cmd.Name, f) {
filterCommandsLogger.Debug("Command %q matches filter %q, adding to filtered list", cmd.Name, f)
filteredCommands = append(filteredCommands, cmd)
break // Command matches, no need to check other filters
}
}
}
filterCommandsLogger.Debug("Finished filtering commands. Found %d filtered commands", len(filteredCommands))
filterCommandsLogger.Trace("Filtered commands: %v", filteredCommands)
return filteredCommands
}

1000
utils/modifycommand_test.go Normal file

File diff suppressed because it is too large Load Diff

79
utils/replacecommand.go Normal file
View File

@@ -0,0 +1,79 @@
package utils
import (
"fmt"
"sort"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// replaceCommandLogger is a scoped logger for the utils/replacecommand package.
var replaceCommandLogger = logger.Default.WithPrefix("utils/replacecommand")
type ReplaceCommand struct {
From int
To int
With string
}
func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
executeModificationsLogger := replaceCommandLogger.WithPrefix("ExecuteModifications")
executeModificationsLogger.Debug("Executing a batch of text modifications")
executeModificationsLogger.Trace("Number of modifications: %d, Original file data length: %d", len(modifications), len(fileData))
var err error
sort.Slice(modifications, func(i, j int) bool {
return modifications[i].From > modifications[j].From
})
executeModificationsLogger.Debug("Modifications sorted in reverse order for safe replacement")
executeModificationsLogger.Trace("Sorted modifications: %v", modifications)
executed := 0
for idx, modification := range modifications {
executeModificationsLogger.Debug("Applying modification %d/%d", idx+1, len(modifications))
executeModificationsLogger.Trace("Current modification details: From=%d, To=%d, With=%q", modification.From, modification.To, modification.With)
fileData, err = modification.Execute(fileData)
if err != nil {
executeModificationsLogger.Error("Failed to execute replacement for modification %+v: %v", modification, err)
continue
}
executed++
executeModificationsLogger.Trace("File data length after modification: %d", len(fileData))
}
executeModificationsLogger.Info("Successfully applied %d text replacements", executed)
return fileData, executed
}
func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
executeLogger := replaceCommandLogger.WithPrefix("Execute").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With))
executeLogger.Debug("Attempting to execute single replacement")
err := m.Validate(len(fileDataStr))
if err != nil {
executeLogger.Error("Failed to validate modification: %v", err)
return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
}
executeLogger.Trace("Applying replacement: fileDataStr[:%d] + %q + fileDataStr[%d:]", m.From, m.With, m.To)
result := fileDataStr[:m.From] + m.With + fileDataStr[m.To:]
executeLogger.Trace("Replacement executed. Result length: %d", len(result))
return result, nil
}
func (m *ReplaceCommand) Validate(maxsize int) error {
validateLogger := replaceCommandLogger.WithPrefix("Validate").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With)).WithField("maxSize", maxsize)
validateLogger.Debug("Validating replacement command against max size")
if m.To < m.From {
validateLogger.Error("Validation failed: 'To' (%d) is less than 'From' (%d)", m.To, m.From)
return fmt.Errorf("command to is less than from: %v", m)
}
if m.From > maxsize || m.To > maxsize {
validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is greater than max size (%d)", m.From, m.To, maxsize)
return fmt.Errorf("command from or to is greater than replacement length: %v", m)
}
if m.From < 0 || m.To < 0 {
validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is less than 0", m.From, m.To)
return fmt.Errorf("command from or to is less than 0: %v", m)
}
validateLogger.Debug("Modification command validated successfully")
return nil
}

View File

@@ -0,0 +1,504 @@
package utils
import (
"testing"
"github.com/stretchr/testify/assert"
)
func TestReplaceCommandExecute(t *testing.T) {
tests := []struct {
name string
input string
command ReplaceCommand
expected string
shouldError bool
}{
{
name: "Simple replacement",
input: "This is a test string",
command: ReplaceCommand{From: 5, To: 7, With: "was"},
expected: "This was a test string",
shouldError: false,
},
{
name: "Replace at beginning",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 5, With: "Hi"},
expected: "Hi world",
shouldError: false,
},
{
name: "Replace at end",
input: "Hello world",
command: ReplaceCommand{From: 6, To: 11, With: "everyone"},
expected: "Hello everyone",
shouldError: false,
},
{
name: "Replace entire string",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
expected: "Goodbye!",
shouldError: false,
},
{
name: "Error: From > To",
input: "Test string",
command: ReplaceCommand{From: 7, To: 5, With: "fail"},
expected: "Test string",
shouldError: true,
},
{
name: "Error: From > string length",
input: "Test",
command: ReplaceCommand{From: 10, To: 12, With: "fail"},
expected: "Test",
shouldError: true,
},
{
name: "Error: To > string length",
input: "Test",
command: ReplaceCommand{From: 2, To: 10, With: "fail"},
expected: "Test",
shouldError: true,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
result, err := tc.command.Execute(tc.input)
if tc.shouldError {
if err == nil {
t.Errorf("Expected an error for command %+v but got none", tc.command)
}
} else {
if err != nil {
t.Errorf("Unexpected error: %v", err)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
}
})
}
}
func TestExecuteModifications(t *testing.T) {
tests := []struct {
name string
input string
modifications []ReplaceCommand
expected string
expectedCount int
}{
{
name: "Single modification",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
},
expected: "Hi world",
expectedCount: 1,
},
{
name: "Multiple modifications",
input: "This is a test string",
modifications: []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 8, To: 14, With: "sample"},
},
expected: "That is sample string",
expectedCount: 2,
},
{
name: "Overlapping modifications",
input: "ABCDEF",
modifications: []ReplaceCommand{
{From: 0, To: 3, With: "123"}, // ABC -> 123
{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
},
// The actual behavior with the current implementation
expected: "123yzF",
expectedCount: 2,
},
{
name: "Sequential modifications",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 5, To: 6, With: ""}, // Remove the space
{From: 6, To: 11, With: "everyone"},
},
expected: "Hieveryone",
expectedCount: 3,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
// Make a copy of the modifications to avoid modifying the test case
mods := make([]ReplaceCommand, len(tc.modifications))
copy(mods, tc.modifications)
result, count := ExecuteModifications(mods, tc.input)
if count != tc.expectedCount {
t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
})
}
}
func TestReverseOrderExecution(t *testing.T) {
// This test verifies the current behavior of modification application
input := "Original text with multiple sections"
// Modifications in specific positions
modifications := []ReplaceCommand{
{From: 0, To: 8, With: "Modified"}, // Original -> Modified
{From: 9, To: 13, With: "document"}, // text -> document
{From: 14, To: 22, With: "without"}, // with -> without
{From: 23, To: 31, With: "any"}, // multiple -> any
}
// The actual current behavior of our implementation
expected := "Modified document withouttanytions"
result, count := ExecuteModifications(modifications, input)
if count != 4 {
t.Errorf("Expected 4 modifications, got %d", count)
}
if result != expected {
t.Errorf("Expected %q, got %q", expected, result)
}
}
// Replace text in the middle of a string with new content
func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello replaced, how are you?", result)
}
// Replace with empty string (deletion)
func TestReplaceCommandExecute_DeletesText(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello , how are you?", result)
}
// Replace with longer string than original segment
func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "longerreplacement",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello longerreplacement, how are you?", result)
}
// From and To values are the same (zero-length replacement)
func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 5,
With: "inserted",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Helloinserted world", result)
}
// From value is greater than To value
func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 10,
To: 5,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// From or To values exceed string length
func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 50, // Exceeds the length of the fileContent
With: "replaced",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world", result)
}
// From or To values are negative
func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: -1,
To: 10,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// Modifications are applied in reverse order (from highest to lowest 'From' value)
func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 10, To: 14, With: "sample"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a sample string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// One or more modifications fail but others succeed
func TestExecuteModificationsWithPartialFailures(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
// Create a custom ReplaceCommand implementation that will fail
failingCommand := ReplaceCommand{
From: 15,
To: 10, // Invalid range (To < From) to cause failure
With: "will fail",
}
// Valid commands
validCommand1 := ReplaceCommand{
From: 0,
To: 4,
With: "That",
}
validCommand2 := ReplaceCommand{
From: 26,
To: 38,
With: "modifications",
}
modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a test string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
// Only 2 out of 3 modifications should succeed
if executed != 2 {
t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
}
}
// All valid modifications are executed and the modified string is returned
func TestExecuteModificationsAllValid(t *testing.T) {
// Setup test data
fileData := "Hello world, this is a test"
modifications := []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 18, To: 20, With: "was"},
{From: 21, To: 27, With: "an example"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "Hi world, this was an example"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// The count of successfully executed modifications is returned
func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
// Setup test data
fileData := "Initial text for testing"
modifications := []ReplaceCommand{
{From: 0, To: 7, With: "Final"},
{From: 12, To: 16, With: "example"},
{From: 17, To: 24, With: "process"},
}
// Execute the function
_, executed := ExecuteModifications(modifications, fileData)
// Verify the count of executed modifications
expectedExecuted := 3
if executed != expectedExecuted {
t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
}
}
// Empty modifications list returns the original string with zero executed count
func TestExecuteModificationsWithEmptyList(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
if result != fileData {
t.Errorf("Expected result to be %q, but got %q", fileData, result)
}
if executed != 0 {
t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
}
}
// Modifications with identical 'From' values
func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 10, To: 14, With: "sample"},
{From: 10, To: 14, With: "example"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
// Yes, it's mangled, yes, it's intentional
// Every subsequent command works with the modified contents of the previous command
// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
// So we prepend "example" and end up with "examplele"
// Whether sample or example goes first here is irrelevant to us
// But it just so happens that sample goes first, so we end up with "examplele"
expectedResult := "This is a examplele string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// Modifications that would affect each other if not sorted properly
func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
// Setup test data
fileData := "The quick brown fox jumps over the lazy dog"
modifications := []ReplaceCommand{
{From: 4, To: 9, With: "slow"},
{From: 10, To: 15, With: "red"},
{From: 16, To: 19, With: "cat"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "The slow red cat jumps over the lazy dog"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}