Improve error handling across the board

Add path data to the selected nodes for reconstruction via set
Implement Set and SetAll (and Get)
2025-03-25 17:23:56 +01:00 · 2025-03-25 17:10:15 +01:00 · 2025-03-25 15:44:27 +01:00 · 2025-03-25 15:18:04 +01:00 · 2025-03-25 11:57:46 +01:00 · 2025-03-25 10:38:12 +01:00
35 changed files with 5677 additions and 7528 deletions
--- a/.gitignore
+++ b/.gitignore
@@ -1,3 +1 @@
 *.exe
 .qodo
 *.sqlite
--- a/.vscode/launch.json
+++ b/.vscode/launch.json
@@ -5,99 +5,12 @@
 	"version": "0.2.0",
 	"configurations": [
 		{
-			"name": "Launch Package (Barotrauma)",
+			"name": "Launch Package",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
-			"program": "${workspaceFolder}",
+			"program": "${fileDirname}",
-			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
+			"args": []
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Payday 2)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
 			"args": [
 				"-loglevel",
 				"trace",
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Barotrauma cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"cookassistant.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Quasimorph cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
 			"args": [
 				"cook.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Rimworld cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
 			"args": [
 				"cookVehicles.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Workspace)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"args": [
 				"tester.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Avorion)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
 			"args": [
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Minecraft)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Minecraft",
 			"args": [
 				"cook_tacz.yml",
 			]
 		}
 	]
 }
--- a/README.md
+++ b/README.md
@@ -1,116 +0,0 @@
 # Big Chef
 A Go-based tool for modifying XML, JSON, and text documents using XPath/JSONPath/Regex expressions and Lua transformations.
 ## Features
 - **Multi-Format Processing**:
  - XML (XPath)
  - JSON (JSONPath) 
  - Text (Regex)
 - **Node Value Modification**: Update text values in XML elements, JSON properties or text matches
 - **Attribute Manipulation**: Modify XML attributes, JSON object keys or regex capture groups
 - **Conditional Logic**: Apply transformations based on document content
 - **Complex Operations**: 
  - Mathematical calculations
  - String manipulations
  - Date conversions
  - Structural changes
  - Whole ass Lua environment
 - **Error Handling**: Comprehensive error detection for:
  - Invalid XML/JSON
  - Malformed XPath/JSONPath
  - Lua syntax errors
 ## Usage Examples
 ### 1. Basic field modification
 ```xml
 <!-- Input -->
 <price>44.95</price>
 <!-- Command -->
 chef -xml "//price" "v=v*2" input.xml
 <!-- Output -->
 <price>89.9</price>
 ```
 ### 2. Supports glob patterns
 ```xml
 chef -xml "//price" "v=v*2" data/**.xml
 ```
 ### 3. Attribute Update
 ```xml
 <!-- Input -->
 <item price="10.50"/>
 <!-- Command -->
 chef -xml "//item/@price" "v=v*2" input.xml
 <!-- Output --> 
 <item price="21"/>
 ```
 ### 3. JSONPath Transformation
 ```json
 // Input
 {
  "products": [
    {"name": "Widget", "price": 19.99},
    {"name": "Gadget", "price": 29.99}
  ]
 }
 // Command
 chef -json "$.products[*].price" "v=v*0.75" input.json
 // Output
 {
  "products": [
    {"name": "Widget", "price": 14.99},
    {"name": "Gadget", "price": 22.49}
  ]
 }
 ```
 ### 4. Regex Text Replacement
 Regex works slightly differently, up to 12 match groups are provided as v1..v12 and s1..s12 for numbers and strings respectively.
 A special shorthand "!num" is also provided that simply expands to `(\d*\.?\d+)`.
 ```xml
 <!-- Input -->
 <description>Price: $15.00 Special Offer</description>
 <!-- Command -->
 chef "Price: $!num Special Offer" "v1 = v1 * 0.92" input.xml
 <!-- Output -->
 <description>Price: $13.80 Special Offer</description>
 ```
 ### 5. Conditional Transformation
 ```xml
 <!-- Input -->
 <item stock="5" price="10.00"/>
 <!-- Command -->
 chef -xml "//item" "if tonumber(v.stock) > 0 then v.price = v.price * 0.8 end" input.xml
 <!-- Output -->
 <item stock="5" price="8.00"/>
 ```
 ## Installation
 ```bash
 go build -o chef main.go
 ```
 ```bash
 # Process XML file
 ./chef -xml "//price" "v=v*1.2" input.xml
 # Process JSON file 
 ./chef -json "$.prices[*]" "v=v*0.9" input.json
 ```
--- a/TalentsMechanic.xml
+++ b/TalentsMechanic.xml
@@ -0,0 +1,651 @@
 <?xml version="1.0" encoding="utf-8"?>
 <Talents>
  <Talent identifier="powerarmor">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.powerarmor">
      <Replace tag="[bonusmovement]" value="25" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHasItem tags="deepdivinglarge" />
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
      </Abilities>
    </AbilityGroupInterval>
    <AddedRecipe itemidentifier="exosuit"/>
  </Talent>
  <Talent identifier="foolhardy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="foolhardy" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="berserker">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="berserker" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="mudraptorwrestler">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.mudraptorwrestler">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattypeself">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData weapontype="NoWeapon,Melee" />
        <AbilityConditionCharacter>
          <Conditional group="eq mudraptor" />
        </AbilityConditionCharacter>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="heavylifting">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.heavylifting">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHoldingItem tags="alienartifact,crate"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="iamthatguy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.iamthatguy">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.skillbonus">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
      <Abilities>
        <CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="heavywrench"/>
  </Talent>
  <Talent identifier="robotics">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.robotics"/>
    <Description tag="talentdescription.roboticsreminder">
      <Replace tag="[amount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="defensebotspawner"/>
    <AddedRecipe itemidentifier="defensebotammobox"/>
  </Talent>
  <Talent identifier="ironstorm">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ironstorm">
      <Replace tag="[chance]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="scrapcannon"/>
  </Talent>
  <Talent identifier="residualwaste">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.residualwaste">
      <Replace tag="[chance]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.2"/>
        <!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
        <AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="massproduction">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.massproduction">
      <Replace tag="[chance]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityRemoveRandomIngredient>
          <AbilityConditionItem category="Material"/>
        </CharacterAbilityRemoveRandomIngredient>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="toolmaintenance">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.toolmaintenance">
      <Replace tag="[amount]" value="1" color="gui.green"/>
    </Description>
    <!-- Give once when unlocking the talent -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupEffect>
    <!-- Give every 60 seconds for late comers -->
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="miner">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
    <Description tag="talentdescription.miner">
      <Replace tag="[probability]" value="320" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.gainoredetachspeed">
      <Replace tag="[amount]" value="1600" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomchance="12.8"/>
        <AbilityConditionItem tags="ore"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="retrofit">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.retrofit" />
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ironman">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="ironhelmet"/>
    <AddedRecipe itemidentifier="makeshiftarmor"/>
  </Talent>
  <Talent identifier="oiledmachinery">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.oiledmachinery">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="pumpndump">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.pumpndump">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <conditions>
        <AbilityConditionItem tags="pump"/>
      </conditions>
      <Abilities>
        <CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ballastdenizen">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ballastdenizen">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="engineengineer">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.engineengineer">
      <Replace tag="[amount]" value="2.5" color="gui.green"/>
      <Replace tag="[max]" value="5" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="1" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="2" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="3" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="5" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="6" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="7" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel minlevel="8" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="multifunctional">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.multifunctional">
      <Replace tag="[powerincrease]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="wrenchitem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="crowbaritem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="salvagecrew">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.bonusxponmission">
      <Replace tag="[xpbonus]" value="30" color="gui.green"/>
      <Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.salvagecrew">
      <Replace tag="[swimbonus]" value="50" color="gui.green"/>
      <Replace tag="[resistanceamount]" value="10" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
      <Conditions>
        <AbilityConditionMission missiontype="Salvage"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="1.3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionInSubmarine submarinetype="Wreck" />
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="This" disabledeltatime="true">
              <Affliction identifier="salvagecrew" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.machinemaniac">
      <Replace tag="[bonus]" value="80" color="gui.green"/>
      <Replace tag="[amount]" value="3" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.30">
      <Replace tag="[requirement]" value="12" color="gui.green"/>
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
      <Replace tag="[xpamount]" value="500" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.50">
      <Replace tag="[requirement]" value="20" color="gui.green"/>
      <Replace tag="[level]" value="1" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.100">
      <Replace tag="[requirement]" value="40" color="gui.green"/>
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <!-- Give the player stats that tracks if the rewards should be given -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveExperience amount="2000"/>
        <CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="tinkerer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.increasemaxrepairmechanical">
      <Replace tag="[percentage]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="modularrepairs">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.freeupgrade">
      <Replace tag="[level]" value="1" color="gui.green"/>
      <Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="repairpack"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="hullfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="25" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="fixfoamgrenade"/>
    <AddedRecipe itemidentifier="handheldstatusmonitor"/>
  </Talent>
  <Talent identifier="letitdrain">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.letitdrain"/>
    <Description tag="talentdescription.letitdrainreminder">
      <Replace tag="[itemcount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="portablepump"/>
  </Talent>
  <Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="scrapsavant">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
    <Description tag="talentdescription.doublescrapoutput" />
    <Description tag="talentdescription.findadditionalscrap">
      <Replace tag="[probability]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionItem tags="scrap"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
      <Conditions>
        <AbilityConditionItemInSubmarine submarinetype="Wreck"/>
        <AbilityConditionItem tags="container"/>
      </Conditions>
      <Abilities>
        <CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
          <StatusEffects>
            <StatusEffect type="OnAbility" target="UseTarget" >
              <SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilitySpawnItemsToContainer>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="safetyfirst">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="safetyharness"/>
  </Talent>
 </Talents>
--- a/cmd/log_format_test/main.go
+++ b/cmd/log_format_test/main.go
@@ -1,28 +0,0 @@
 package main
 import (
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 func main() {
 	// Initialize logger with DEBUG level
 	logger.Init(logger.LevelDebug)
 	// Test different log levels
 	logger.Info("This is an info message")
 	logger.Debug("This is a debug message")
 	logger.Warning("This is a warning message")
 	logger.Error("This is an error message")
 	logger.Trace("This is a trace message (not visible at DEBUG level)")
 	// Test with a goroutine
 	logger.SafeGo(func() {
 		time.Sleep(10 * time.Millisecond)
 		logger.Info("Message from goroutine")
 	})
 	// Wait for goroutine to complete
 	time.Sleep(20 * time.Millisecond)
 }
--- a/glob_test.go
+++ b/glob_test.go
@@ -1,7 +1,6 @@
 package main
 import (
 	"cook/utils"
 	"os"
 	"path/filepath"
 	"testing"
@@ -77,14 +76,9 @@ func TestGlobExpansion(t *testing.T) {
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
-			// Convert string patterns to map[string]struct{} for ExpandGLobs
+			files, err := expandFilePatterns(tc.patterns)
 			patternMap := make(map[string]struct{})
 			for _, pattern := range tc.patterns {
 				patternMap[pattern] = struct{}{}
 			}
 			files, err := utils.ExpandGLobs(patternMap)
 			if err != nil {
-				t.Fatalf("ExpandGLobs failed: %v", err)
+				t.Fatalf("expandFilePatterns failed: %v", err)
 			}
 			if len(files) != tc.expected {
--- a/go.mod
+++ b/go.mod
@@ -1,32 +1,20 @@
-module cook
+module modify
-go 1.23.2
+go 1.24.1
 require (
-	git.site.quack-lab.dev/dave/cylogger v1.3.0
+	github.com/antchfx/xmlquery v1.4.4
 	github.com/bmatcuk/doublestar/v4 v4.8.1
 	github.com/stretchr/testify v1.10.0
 	github.com/yuin/gopher-lua v1.1.1
 	gopkg.in/yaml.v3 v3.0.1
 	gorm.io/gorm v1.30.0
 )
 require (
-	github.com/davecgh/go-spew v1.1.1 // indirect
+	github.com/PaesslerAG/gval v1.0.0 // indirect
-	github.com/google/go-cmp v0.6.0 // indirect
+	github.com/PaesslerAG/jsonpath v0.1.1 // indirect
-	github.com/hexops/valast v1.5.0 // indirect
+	github.com/antchfx/xpath v1.3.3 // indirect
-	github.com/jinzhu/inflection v1.0.0 // indirect
+	github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da // indirect
-	github.com/jinzhu/now v1.1.5 // indirect
+	github.com/sergi/go-diff v1.3.1 // indirect
-	github.com/kr/pretty v0.3.1 // indirect
+	github.com/stretchr/testify v1.10.0 // indirect
-	github.com/mattn/go-sqlite3 v1.14.22 // indirect
+	golang.org/x/net v0.33.0 // indirect
-	github.com/pmezard/go-difflib v1.0.0 // indirect
+	golang.org/x/text v0.21.0 // indirect
 	github.com/rogpeppe/go-internal v1.14.1 // indirect
 	golang.org/x/mod v0.21.0 // indirect
 	golang.org/x/sync v0.11.0 // indirect
 	golang.org/x/text v0.22.0 // indirect
 	golang.org/x/tools v0.26.0 // indirect
 	gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
 	mvdan.cc/gofumpt v0.4.0 // indirect
 )
 require gorm.io/driver/sqlite v1.6.0
--- a/go.sum
+++ b/go.sum
@@ -1,59 +1,98 @@
-git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw=
+github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
-git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk=
+github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
 github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
 github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
 github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
 github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
 github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
 github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
 github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
 github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
 github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
-github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
+github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
 github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
 github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
-github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE=
+github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da h1:oI5xCqsCo564l8iNU+DwB5epxmsaqB+rhGL0m5jtYqE=
-github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps=
+github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
 github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
 github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
-github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM=
+github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
 github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
 github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
 github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
 github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
 github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
 github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
 github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
 github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
 github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
 github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
 github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
 github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
 github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
 github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
 github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
 github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
 github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
 github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
 github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
 github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
 github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
-github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs=
+github.com/sergi/go-diff v1.3.1 h1:xkr+Oxo4BOQKmkn/B9eMK0g5Kg/983T9DqqPHwYqD+8=
-github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
+github.com/sergi/go-diff v1.3.1/go.mod h1:aMJSSKb2lpPvRNec0+w3fl7LP9IOFzdc9Pa4NFbPK1I=
-github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
+github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
 github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
 github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
 github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
 github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
 github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
 github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
-golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0=
+golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
-golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY=
+golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
-golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w=
+golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
-golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
+golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
-golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
+golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
-golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
+golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
-golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ=
+golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
-golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0=
+golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
 golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
 golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
 golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
 golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
 golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
 golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
 golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
 golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
 golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
 golang.org/x/net v0.33.0 h1:74SYHlV8BIgHIFC/LrYkOGIwL19eTYXQ5wc6TBuO36I=
 golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
 golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
 golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
 golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
 golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
 golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
 golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
 golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
 golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
 golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
 golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
 golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
 golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
 golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo=
 golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
 golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
 golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
 golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
 golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
 golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
 golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
 golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
 gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
-gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
+gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
-gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
+gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
-gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
+gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
 gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
 gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
 gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
 gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
 gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
 mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
 mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=
--- a/main.go
+++ b/main.go
@@ -1,52 +1,66 @@
 package main
 import (
 	"errors"
 	"flag"
 	"fmt"
 	"log"
 	"os"
 	"sort"
 	"sync"
 	"sync/atomic"
 	"time"
-	"cook/processor"
+	"github.com/bmatcuk/doublestar/v4"
 	"cook/utils"
-	"gopkg.in/yaml.v3"
+	"modify/processor"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // mainLogger is a scoped logger for the main package.
 var mainLogger = logger.Default.WithPrefix("main")
 type GlobalStats struct {
-	TotalMatches            int64
+	TotalMatches       int
-	TotalModifications      int64
+	TotalModifications int
-	ProcessedFiles          int64
+	ProcessedFiles     int
-	FailedFiles             int64
+	FailedFiles        int
 	ModificationsPerCommand sync.Map
 }
-var (
+type FileMode string
-	stats GlobalStats = GlobalStats{
+
-		ModificationsPerCommand: sync.Map{},
+const (
-	}
+	ModeRegex FileMode = "regex"
 	ModeXML   FileMode = "xml"
 	ModeJSON  FileMode = "json"
 )
 var stats GlobalStats
 var logger *log.Logger
 var (
 	fileModeFlag = flag.String("mode", "regex", "Processing mode: regex, xml, json")
 	verboseFlag  = flag.Bool("verbose", false, "Enable verbose output")
 )
 func init() {
 	log.SetFlags(log.Lmicroseconds | log.Lshortfile)
 	logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
 	stats = GlobalStats{}
 }
 func main() {
 	flag.Usage = func() {
 		CreateExampleConfig()
 		fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nOptions:\n")
-		fmt.Fprintf(os.Stderr, "  -reset\n")
+		fmt.Fprintf(os.Stderr, "  -mode string\n")
-		fmt.Fprintf(os.Stderr, "        Reset files to their original state\n")
+		fmt.Fprintf(os.Stderr, "        Processing mode: regex, xml, json (default \"regex\")\n")
-		fmt.Fprintf(os.Stderr, "  -loglevel string\n")
+		fmt.Fprintf(os.Stderr, "  -xpath string\n")
-		fmt.Fprintf(os.Stderr, "        Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
+		fmt.Fprintf(os.Stderr, "        XPath expression (for XML mode)\n")
 		fmt.Fprintf(os.Stderr, "  -jsonpath string\n")
 		fmt.Fprintf(os.Stderr, "        JSONPath expression (for JSON mode)\n")
 		fmt.Fprintf(os.Stderr, "  -verbose\n")
 		fmt.Fprintf(os.Stderr, "        Enable verbose output\n")
 		fmt.Fprintf(os.Stderr, "\nExamples:\n")
 		fmt.Fprintf(os.Stderr, "  Regex mode (default):\n")
-		fmt.Fprintf(os.Stderr, "    %s \"<value>(\\\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
+		fmt.Fprintf(os.Stderr, "    %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "  XML mode:\n")
 		fmt.Fprintf(os.Stderr, "    %s -mode=xml -xpath=\"//value\" \"*1.5\" data.xml\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "  JSON mode:\n")
 		fmt.Fprintf(os.Stderr, "    %s -mode=json -jsonpath=\"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
 		fmt.Fprintf(os.Stderr, "      s1, s2, etc. are used to refer to capture groups as strings.\n")
 		fmt.Fprintf(os.Stderr, "      Helper functions: num(str) converts string to number, str(num) converts number to string\n")
@@ -55,557 +69,114 @@ func main() {
 		fmt.Fprintf(os.Stderr, "      You can use any valid Lua code, including if statements, loops, etc.\n")
 		fmt.Fprintf(os.Stderr, "      Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
 	}
-	// TODO: Fix bed shitting when doing *.yml in barotrauma directory
+
 	flag.Parse()
 	args := flag.Args()
-	logger.InitFlag()
+	if len(args) < 3 {
-	mainLogger.Info("Initializing with log level: %s", logger.GetLevel().String())
+		fmt.Fprintf(os.Stderr, "%s mode requires %d arguments minimum\n", *fileModeFlag, 3)
 	mainLogger.Trace("Full argv: %v", os.Args)
 	if flag.NArg() == 0 {
 		flag.Usage()
 		return
 	}
-	mainLogger.Debug("Getting database connection")
+	// Get the appropriate pattern and expression based on mode
-	db, err := utils.GetDB()
+	var pattern, luaExpr string
 	var filePatterns []string
 	if *fileModeFlag == "regex" {
 		pattern = args[0]
 		luaExpr = args[1]
 		filePatterns = args[2:]
 	} else {
 		// For XML/JSON modes, pattern comes from flags
 		luaExpr = args[0]
 		filePatterns = args[1:]
 	}
 	// Prepare the Lua expression
 	originalLuaExpr := luaExpr
 	luaExpr = processor.BuildLuaScript(luaExpr)
 	if originalLuaExpr != luaExpr {
 		logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
 	}
 	// Expand file patterns with glob support
 	files, err := expandFilePatterns(filePatterns)
 	if err != nil {
-		mainLogger.Error("Failed to get database: %v", err)
+		fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
 		return
 	}
 	mainLogger.Debug("Database connection established")
 	workdone, err := HandleSpecialArgs(args, err, db)
 	if err != nil {
 		mainLogger.Error("Failed to handle special args: %v", err)
 		return
 	}
 	if workdone {
 		mainLogger.Info("Special arguments handled, exiting.")
 		return
 	}
-	// The plan is:
+	if len(files) == 0 {
-	// Load all commands
+		fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
 	mainLogger.Debug("Loading commands from arguments")
 	mainLogger.Trace("Arguments: %v", args)
 	commands, err := utils.LoadCommands(args)
 	if err != nil || len(commands) == 0 {
 		mainLogger.Error("Failed to load commands: %v", err)
 		flag.Usage()
 		return
 	}
 	// Collect global modifiers from special entries and filter them out
 	vars := map[string]interface{}{}
 	filtered := make([]utils.ModifyCommand, 0, len(commands))
 	for _, c := range commands {
 		if len(c.Modifiers) > 0 && c.Name == "" && c.Regex == "" && len(c.Regexes) == 0 && c.Lua == "" && len(c.Files) == 0 {
 			for k, v := range c.Modifiers {
 				vars[k] = v
 			}
 			continue
 		}
 		filtered = append(filtered, c)
 	}
 	if len(vars) > 0 {
 		mainLogger.Info("Loaded %d global modifiers", len(vars))
 		processor.SetVariables(vars)
 	}
 	commands = filtered
 	mainLogger.Info("Loaded %d commands", len(commands))
-	if *utils.Filter != "" {
+	// Create the processor based on mode
-		mainLogger.Info("Filtering commands by name: %s", *utils.Filter)
+	var proc processor.Processor
-		commands = utils.FilterCommands(commands, *utils.Filter)
+	switch *fileModeFlag {
-		mainLogger.Info("Filtered %d commands", len(commands))
+	case "regex":
 		proc = &processor.RegexProcessor{}
 		logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
 			pattern, luaExpr, len(files))
 		// case "xml":
 		// 	proc = &processor.XMLProcessor{}
 		// 	pattern = *xpathFlag
 		// 	logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
 		// 		pattern, luaExpr, len(files))
 		// case "json":
 		// 	proc = &processor.JSONProcessor{}
 		// 	pattern = *jsonpathFlag
 		// 	logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
 		// 		pattern, luaExpr, len(files))
 	}
-	// Then aggregate all the globs and deduplicate them
+	var wg sync.WaitGroup
-	mainLogger.Debug("Aggregating globs and deduplicating")
+	// Process each file
-	globs := utils.AggregateGlobs(commands)
+	for _, file := range files {
 	mainLogger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
 	for _, command := range commands {
 		mainLogger.Trace("Command: %s", command.Name)
 		if len(command.Regexes) > 0 {
 			mainLogger.Trace("Regexes: %v", command.Regexes)
 		} else {
 			mainLogger.Trace("Regex: %s", command.Regex)
 		}
 		mainLogger.Trace("Files: %v", command.Files)
 		mainLogger.Trace("Lua: %s", command.Lua)
 		mainLogger.Trace("Reset: %t", command.Reset)
 		mainLogger.Trace("Isolate: %t", command.Isolate)
 		mainLogger.Trace("LogLevel: %s", command.LogLevel)
 	}
 	// Resolve all the files for all the globs
 	mainLogger.Info("Found %d unique file patterns", len(globs))
 	mainLogger.Debug("Expanding glob patterns to files")
 	files, err := utils.ExpandGLobs(globs)
 	if err != nil {
 		mainLogger.Error("Failed to expand file patterns: %v", err)
 		return
 	}
 	mainLogger.Info("Found %d files to process", len(files))
 	mainLogger.Trace("Files to process: %v", files)
 	// Somehow connect files to commands via globs..
 	// For each file check every glob of every command
 	// Maybe memoize this part
 	// That way we know what commands affect what files
 	mainLogger.Debug("Associating files with commands")
 	associations, err := utils.AssociateFilesWithCommands(files, commands)
 	if err != nil {
 		mainLogger.Error("Failed to associate files with commands: %v", err)
 		return
 	}
 	mainLogger.Debug("Files associated with commands")
 	mainLogger.Trace("File-command associations: %v", associations)
 	// Per-file association summary for better visibility when debugging
 	for file, assoc := range associations {
 		cmdNames := make([]string, 0, len(assoc.Commands))
 		for _, c := range assoc.Commands {
 			cmdNames = append(cmdNames, c.Name)
 		}
 		isoNames := make([]string, 0, len(assoc.IsolateCommands))
 		for _, c := range assoc.IsolateCommands {
 			isoNames = append(isoNames, c.Name)
 		}
 		mainLogger.Debug("File %q has %d regular and %d isolate commands", file, len(assoc.Commands), len(assoc.IsolateCommands))
 		mainLogger.Trace("\tRegular: %v", cmdNames)
 		mainLogger.Trace("\tIsolate: %v", isoNames)
 	}
 	mainLogger.Debug("Resetting files where necessary")
 	err = utils.ResetWhereNecessary(associations, db)
 	if err != nil {
 		mainLogger.Error("Failed to reset files where necessary: %v", err)
 		return
 	}
 	mainLogger.Debug("Files reset where necessary")
 	// Then for each file run all commands associated with the file
 	workers := make(chan struct{}, *utils.ParallelFiles)
 	wg := sync.WaitGroup{}
 	mainLogger.Debug("Starting file processing with %d parallel workers", *utils.ParallelFiles)
 	// Add performance tracking
 	startTime := time.Now()
 	// Create a map to store loggers for each command
 	commandLoggers := make(map[string]*logger.Logger)
 	for _, command := range commands {
 		// Create a named logger for each command
 		cmdName := command.Name
 		if cmdName == "" {
 			// If no name is provided, use a short version of the regex pattern
 			if len(command.Regex) > 20 {
 				cmdName = command.Regex[:17] + "..."
 			} else {
 				cmdName = command.Regex
 			}
 		}
 		// Parse the log level for this specific command
 		cmdLogLevel := logger.ParseLevel(command.LogLevel)
 		// Create a logger with the command name as a field
 		commandLoggers[command.Name] = logger.Default.WithField("command", cmdName)
 		commandLoggers[command.Name].SetLevel(cmdLogLevel)
 		mainLogger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
 	}
 	for file, association := range associations {
 		workers <- struct{}{}
 		wg.Add(1)
-		logger.SafeGoWithArgs(func(args ...interface{}) {
+		go func(file string) {
 			defer func() { <-workers }()
 			defer wg.Done()
-			// Track per-file processing time
+			logger.Printf("Processing file: %s", file)
 			fileStartTime := time.Now()
-			mainLogger.Debug("Reading file %q", file)
+			modCount, matchCount, err := proc.Process(file, pattern, luaExpr)
 			fileData, err := os.ReadFile(file)
 			if err != nil {
-				mainLogger.Error("Failed to read file %q: %v", file, err)
+				fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
-				atomic.AddInt64(&stats.FailedFiles, 1)
+				stats.FailedFiles++
-				return
+			} else {
 				logger.Printf("Successfully processed file: %s", file)
 				stats.ProcessedFiles++
 				stats.TotalMatches += matchCount
 				stats.TotalModifications += modCount
 			}
-			fileDataStr := string(fileData)
+		}(file)
 			mainLogger.Trace("File %q content: %s", file, utils.LimitString(fileDataStr, 500))
 			isChanged := false
 			mainLogger.Debug("Running isolate commands for file %q", file)
 			fileDataStr, err = RunIsolateCommands(association, file, fileDataStr)
 			if err != nil && err != NothingToDo {
 				mainLogger.Error("Failed to run isolate commands for file %q: %v", file, err)
 				atomic.AddInt64(&stats.FailedFiles, 1)
 				return
 			}
 			if err != NothingToDo {
 				isChanged = true
 			}
 			mainLogger.Debug("Running other commands for file %q", file)
 			fileDataStr, err = RunOtherCommands(file, fileDataStr, association, commandLoggers)
 			if err != nil && err != NothingToDo {
 				mainLogger.Error("Failed to run other commands for file %q: %v", file, err)
 				atomic.AddInt64(&stats.FailedFiles, 1)
 				return
 			}
 			if err != NothingToDo {
 				isChanged = true
 			}
 			if isChanged {
 				mainLogger.Debug("Saving file %q to database", file)
 				err = db.SaveFile(file, fileData)
 				if err != nil {
 					mainLogger.Error("Failed to save file %q to database: %v", file, err)
 					atomic.AddInt64(&stats.FailedFiles, 1)
 					return
 				}
 				mainLogger.Debug("File %q saved to database", file)
 			}
 			mainLogger.Debug("Writing file %q", file)
 			err = os.WriteFile(file, []byte(fileDataStr), 0644)
 			if err != nil {
 				mainLogger.Error("Failed to write file %q: %v", file, err)
 				atomic.AddInt64(&stats.FailedFiles, 1)
 				return
 			}
 			mainLogger.Debug("File %q written", file)
 			// Only increment ProcessedFiles once per file, after all processing is complete
 			atomic.AddInt64(&stats.ProcessedFiles, 1)
 			mainLogger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
 		}, file, commands)
 	}
 	wg.Wait()
 	processingTime := time.Since(startTime)
 	mainLogger.Info("Processing completed in %v", processingTime)
 	processedFiles := atomic.LoadInt64(&stats.ProcessedFiles)
 	if processedFiles > 0 {
 		mainLogger.Info("Average time per file: %v", processingTime/time.Duration(processedFiles))
 	}
 	// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
 	// Do that with logger.WithField("loglevel", level.String())
 	// Since each command also has its own log level
 	// TODO: Maybe even figure out how to run individual commands...?
 	// TODO: What to do with git? Figure it out ....
 	// if *gitFlag {
 	// 	mainLogger.Info("Git integration enabled, setting up git repository")
 	// 	err := setupGit()
 	// 	if err != nil {
 	// 		mainLogger.Error("Failed to setup git: %v", err)
 	// 		fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
 	// 		return
 	// 	}
 	// }
 	// mainLogger.Debug("Expanding file patterns")
 	// files, err := expandFilePatterns(filePatterns)
 	// if err != nil {
 	// 	mainLogger.Error("Failed to expand file patterns: %v", err)
 	// 	fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
 	// 	return
 	// }
 	// if *gitFlag {
 	// 	mainLogger.Info("Cleaning up git files before processing")
 	// 	err := cleanupGitFiles(files)
 	// 	if err != nil {
 	// 		mainLogger.Error("Failed to cleanup git files: %v", err)
 	// 		fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
 	// 		return
 	// 	}
 	// }
 	// if *resetFlag {
 	// 	mainLogger.Info("Files reset to their original state, nothing more to do")
 	// 	log.Printf("Files reset to their original state, nothing more to do")
 	// 	return
 	// }
 	// Print summary
-	totalModifications := atomic.LoadInt64(&stats.TotalModifications)
+	if stats.TotalModifications == 0 {
-	if totalModifications == 0 {
+		fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
 		mainLogger.Warning("No modifications were made in any files")
 	} else {
-		failedFiles := atomic.LoadInt64(&stats.FailedFiles)
+		fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
-		mainLogger.Info("Operation complete! Modified %d values in %d/%d files",
+			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
 			totalModifications, processedFiles, processedFiles+failedFiles)
 		sortedCommands := []string{}
 		stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
 			sortedCommands = append(sortedCommands, key.(string))
 			return true
 		})
 		sort.Strings(sortedCommands)
 		for _, command := range sortedCommands {
 			count, _ := stats.ModificationsPerCommand.Load(command)
 			if count.(int) > 0 {
 				mainLogger.Info("\tCommand %q made %d modifications", command, count)
 			} else {
 				mainLogger.Warning("\tCommand %q made no modifications", command)
 			}
 		}
 	}
 }
-func HandleSpecialArgs(args []string, err error, db utils.DB) (bool, error) {
+func expandFilePatterns(patterns []string) ([]string, error) {
-	handleSpecialArgsLogger := logger.Default.WithPrefix("HandleSpecialArgs")
+	var files []string
-	handleSpecialArgsLogger.Debug("Handling special arguments: %v", args)
+	filesMap := make(map[string]bool)
-	switch args[0] {
+
-	case "reset":
+	for _, pattern := range patterns {
-		handleSpecialArgsLogger.Info("Resetting all files")
+		matches, _ := doublestar.Glob(os.DirFS("."), pattern)
-		err = utils.ResetAllFiles(db)
+		for _, m := range matches {
-		if err != nil {
+			if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
-			handleSpecialArgsLogger.Error("Failed to reset all files: %v", err)
+				filesMap[m], files = true, append(files, m)
-			return true, err
+			}
 		}
 		handleSpecialArgsLogger.Info("All files reset")
 		return true, nil
 	case "dump":
 		handleSpecialArgsLogger.Info("Dumping all files from database")
 		err = db.RemoveAllFiles()
 		if err != nil {
 			handleSpecialArgsLogger.Error("Failed to remove all files from database: %v", err)
 			return true, err
 		}
 		handleSpecialArgsLogger.Info("All files removed from database")
 		return true, nil
 	}
-	handleSpecialArgsLogger.Debug("No special arguments handled, returning false")
+
-	return false, nil
+	if len(files) > 0 {
-}
+		logger.Printf("Found %d files to process", len(files))
-
+	}
-func CreateExampleConfig() {
+	return files, nil
 	createExampleConfigLogger := logger.Default.WithPrefix("CreateExampleConfig")
 	createExampleConfigLogger.Debug("Creating example configuration file")
 	commands := []utils.ModifyCommand{
 		// Global modifiers only entry (no name/regex/lua/files)
 		{
 			Modifiers: map[string]interface{}{
 				"foobar":   4,
 				"multiply": 1.5,
 				"prefix":   "NEW_",
 				"enabled":  true,
 			},
 		},
 		// Multi-regex example using $variable in Lua
 		{
 			Name:    "RFToolsMultiply",
 			Regexes: []string{"generatePerTick = !num", "ticksPer\\w+ = !num", "generatorRFPerTick = !num"},
 			Lua:     "* $foobar",
 			Files:   []string{"polymc/instances/**/rftools*.toml", `polymc\\instances\\**\\rftools*.toml`},
 			Reset:   true,
 			// LogLevel defaults to INFO
 		},
 		// Named capture groups with arithmetic and string ops
 		{
 			Name:  "UpdateAmountsAndItems",
 			Regex: `(?P<amount>!num)\s+units\s+of\s+(?P<item>[A-Za-z_\-]+)`,
 			Lua:   `amount = amount * $multiply; item = upper(item); return true`,
 			Files: []string{"data/**/*.txt"},
 			// INFO log level
 		},
 		// Full replacement via Lua 'replacement' variable
 		{
 			Name:  "BumpMinorVersion",
 			Regex: `version\s*=\s*"(?P<major>!num)\.(?P<minor>!num)\.(?P<patch>!num)"`,
 			Lua:   `replacement = format("version=\"%s.%s.%s\"", major, num(minor)+1, 0); return true`,
 			Files: []string{"config/*.ini", "config/*.cfg"},
 		},
 		// Multiline regex example (DOTALL is auto-enabled). Captures numeric in nested XML.
 		{
 			Name: "XMLNestedValueMultiply",
 			Regex: `<item>\s*\s*<name>!any<\/name>\s*\s*<value>(!num)<\/value>\s*\s*<\/item>`,
 			Lua:   `* $multiply`,
 			Files: []string{"data/**/*.xml"},
 			// Demonstrates multiline regex in YAML
 		},
 		// Multiline regexES array, with different patterns handled by same Lua
 		{
 			Name: "MultiLinePatterns",
 			Regexes: []string{
 				`<entry>\s*\n\s*<id>(?P<id>!num)</id>\s*\n\s*<score>(?P<score>!num)</score>\s*\n\s*</entry>`,
 				`\[block\]\nkey=(?P<key>[A-Za-z_]+)\nvalue=(?P<val>!num)`,
 			},
 			Lua:   `if is_number(score) then score = score * 2 end; if is_number(val) then val = val * 3 end; return true`,
 			Files: []string{"examples/**/*.*"},
 			LogLevel: "DEBUG",
 		},
 		// Use equals operator shorthand and boolean variable
 		{
 			Name:  "EnableFlags",
 			Regex: `enabled\s*=\s*(true|false)`,
 			Lua:   `= $enabled`,
 			Files: []string{"**/*.toml"},
 		},
 		// Demonstrate NoDedup to allow overlapping replacements
 		{
 			Name:   "OverlappingGroups",
 			Regex:  `(?P<a>!num)(?P<b>!num)`,
 			Lua:    `a = num(a) + 1; b = num(b) + 1; return true`,
 			Files:  []string{"overlap/**/*.txt"},
 			NoDedup: true,
 		},
 		// Isolate command example operating on entire matched block
 		{
 			Name:    "IsolateUppercaseBlock",
 			Regex:   `BEGIN\n(?P<block>!any)\nEND`,
 			Lua:     `block = upper(block); return true`,
 			Files:   []string{"logs/**/*.log"},
 			Isolate: true,
 			LogLevel: "TRACE",
 		},
 		// Using !rep placeholder and arrays of files
 		{
 			Name:  "RepeatPlaceholderExample",
 			Regex: `name: (.*) !rep(, .* , 2)`,
 			Lua:   `-- no-op, just demonstrate placeholder; return false`,
 			Files: []string{"lists/**/*.yml", "lists/**/*.yaml"},
 		},
 		// Using string variable in Lua expression
 		{
 			Name:  "PrefixKeys",
 			Regex: `(?P<key>[A-Za-z0-9_]+)\s*=`,
 			Lua:   `key = $prefix .. key; return true`,
 			Files: []string{"**/*.properties"},
 		},
 	}
 	data, err := yaml.Marshal(commands)
 	if err != nil {
 		createExampleConfigLogger.Error("Failed to marshal example config: %v", err)
 		return
 	}
 	createExampleConfigLogger.Debug("Writing example_cook.yml")
 	err = os.WriteFile("example_cook.yml", data, 0644)
 	if err != nil {
 		createExampleConfigLogger.Error("Failed to write example_cook.yml: %v", err)
 		return
 	}
 	createExampleConfigLogger.Info("Wrote example_cook.yml")
 }
 var NothingToDo = errors.New("nothing to do")
 func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, commandLoggers map[string]*logger.Logger) (string, error) {
 	runOtherCommandsLogger := mainLogger.WithPrefix("RunOtherCommands").WithField("file", file)
 	runOtherCommandsLogger.Debug("Running other commands for file")
 	runOtherCommandsLogger.Trace("File data before modifications: %s", utils.LimitString(fileDataStr, 200))
 	// Aggregate all the modifications and execute them
 	modifications := []utils.ReplaceCommand{}
 	numCommandsConsidered := 0
 	for _, command := range association.Commands {
 		// Use command-specific logger if available, otherwise fall back to default logger
 		cmdLogger := logger.Default
 		if cmdLog, ok := commandLoggers[command.Name]; ok {
 			cmdLogger = cmdLog
 		}
 		patterns := command.Regexes
 		if len(patterns) == 0 {
 			patterns = []string{command.Regex}
 		}
 		for idx, pattern := range patterns {
 			tmpCmd := command
 			tmpCmd.Regex = pattern
 			cmdLogger.Debug("Begin processing file with command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
 			numCommandsConsidered++
 			newModifications, err := processor.ProcessRegex(fileDataStr, tmpCmd, file)
 			if err != nil {
 				runOtherCommandsLogger.Error("Failed to process file with command %q: %v", command.Name, err)
 				continue
 			}
 			modifications = append(modifications, newModifications...)
 			count, ok := stats.ModificationsPerCommand.Load(command.Name)
 			if !ok {
 				count = 0
 			}
 			stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
 			cmdLogger.Debug("Command %q generated %d modifications (pattern %d/%d)", command.Name, len(newModifications), idx+1, len(patterns))
 			cmdLogger.Trace("Modifications generated by command %q: %v", command.Name, newModifications)
 			if len(newModifications) == 0 {
 				cmdLogger.Debug("No modifications yielded by command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
 			}
 		}
 	}
 	runOtherCommandsLogger.Debug("Aggregated %d modifications from %d command-pattern runs", len(modifications), numCommandsConsidered)
 	runOtherCommandsLogger.Trace("All aggregated modifications: %v", modifications)
 	if len(modifications) == 0 {
 		runOtherCommandsLogger.Warning("No modifications found for file")
 		return fileDataStr, NothingToDo
 	}
 	runOtherCommandsLogger.Debug("Executing %d modifications for file", len(modifications))
 	// Sort commands in reverse order for safe replacements
 	var count int
 	fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
 	runOtherCommandsLogger.Trace("File data after modifications: %s", utils.LimitString(fileDataStr, 200))
 	atomic.AddInt64(&stats.TotalModifications, int64(count))
 	runOtherCommandsLogger.Info("Executed %d modifications for file", count)
 	return fileDataStr, nil
 }
 func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string) (string, error) {
 	runIsolateCommandsLogger := mainLogger.WithPrefix("RunIsolateCommands").WithField("file", file)
 	runIsolateCommandsLogger.Debug("Running isolate commands for file")
 	runIsolateCommandsLogger.Trace("File data before isolate modifications: %s", utils.LimitString(fileDataStr, 200))
 	anythingDone := false
 	for _, isolateCommand := range association.IsolateCommands {
 		runIsolateCommandsLogger.Debug("Begin processing file with isolate command %q", isolateCommand.Regex)
 		patterns := isolateCommand.Regexes
 		if len(patterns) == 0 {
 			patterns = []string{isolateCommand.Regex}
 		}
 		for idx, pattern := range patterns {
 			tmpCmd := isolateCommand
 			tmpCmd.Regex = pattern
 			modifications, err := processor.ProcessRegex(fileDataStr, tmpCmd, file)
 			if err != nil {
 				runIsolateCommandsLogger.Error("Failed to process file with isolate command %q (pattern %d/%d): %v", isolateCommand.Name, idx+1, len(patterns), err)
 				continue
 			}
 			if len(modifications) == 0 {
 				runIsolateCommandsLogger.Debug("Isolate command %q produced no modifications (pattern %d/%d)", isolateCommand.Name, idx+1, len(patterns))
 				continue
 			}
 			anythingDone = true
 			runIsolateCommandsLogger.Debug("Executing %d isolate modifications for file", len(modifications))
 			runIsolateCommandsLogger.Trace("Isolate modifications: %v", modifications)
 			var count int
 			fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
 			runIsolateCommandsLogger.Trace("File data after isolate modifications: %s", utils.LimitString(fileDataStr, 200))
 			atomic.AddInt64(&stats.TotalModifications, int64(count))
 			runIsolateCommandsLogger.Info("Executed %d isolate modifications for file", count)
 		}
 	}
 	if !anythingDone {
 		runIsolateCommandsLogger.Debug("No isolate modifications were made for file")
 		return fileDataStr, NothingToDo
 	}
 	return fileDataStr, nil
 }
--- a/processor/json.go
+++ b/processor/json.go
@@ -0,0 +1,174 @@
 package processor
 import (
 	"encoding/json"
 	"fmt"
 	"modify/processor/jsonpath"
 	"os"
 	"path/filepath"
 	"strings"
 	lua "github.com/yuin/gopher-lua"
 )
 // JSONProcessor implements the Processor interface for JSON documents
 type JSONProcessor struct{}
 // Process implements the Processor interface for JSONProcessor
 func (p *JSONProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
 	// Read file content
 	cwd, err := os.Getwd()
 	if err != nil {
 		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
 	}
 	fullPath := filepath.Join(cwd, filename)
 	content, err := os.ReadFile(fullPath)
 	if err != nil {
 		return 0, 0, fmt.Errorf("error reading file: %v", err)
 	}
 	fileContent := string(content)
 	// Process the content
 	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
 	if err != nil {
 		return 0, 0, err
 	}
 	// If we made modifications, save the file
 	if modCount > 0 {
 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
 		if err != nil {
 			return 0, 0, fmt.Errorf("error writing file: %v", err)
 		}
 	}
 	return modCount, matchCount, nil
 }
 // ProcessContent implements the Processor interface for JSONProcessor
 func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
 	// Parse JSON document
 	var jsonData interface{}
 	err := json.Unmarshal([]byte(content), &jsonData)
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
 	}
 	// Find nodes matching the JSONPath pattern
 	nodes, err := jsonpath.Get(jsonData, pattern)
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
 	}
 	matchCount := len(nodes)
 	if matchCount == 0 {
 		return content, 0, 0, nil
 	}
 	// Initialize Lua
 	L, err := NewLuaState()
 	if err != nil {
 		return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
 	}
 	defer L.Close()
 	err = p.ToLua(L, nodes)
 	if err != nil {
 		return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
 	}
 	// Execute Lua script
 	if err := L.DoString(luaExpr); err != nil {
 		return content, len(nodes), 0, fmt.Errorf("error executing Lua %s: %v", luaExpr, err)
 	}
 	// Get modified value
 	result, err := p.FromLua(L)
 	if err != nil {
 		return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
 	}
 	// Apply the modification to the JSON data
 	err = p.updateJSONValue(jsonData, pattern, result)
 	if err != nil {
 		return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
 	}
 	// Convert the modified JSON back to a string with same formatting
 	var jsonBytes []byte
 	if indent, err := detectJsonIndentation(content); err == nil && indent != "" {
 		// Use detected indentation for output formatting
 		jsonBytes, err = json.MarshalIndent(jsonData, "", indent)
 	} else {
 		// Fall back to standard 2-space indent
 		jsonBytes, err = json.MarshalIndent(jsonData, "", "  ")
 	}
 	// We changed all the nodes trust me bro
 	return string(jsonBytes), len(nodes), len(nodes), nil
 }
 // detectJsonIndentation tries to determine the indentation used in the original JSON
 func detectJsonIndentation(content string) (string, error) {
 	lines := strings.Split(content, "\n")
 	if len(lines) < 2 {
 		return "", fmt.Errorf("not enough lines to detect indentation")
 	}
 	// Look for the first indented line
 	for i := 1; i < len(lines); i++ {
 		line := lines[i]
 		trimmed := strings.TrimSpace(line)
 		if trimmed == "" {
 			continue
 		}
 		// Calculate leading whitespace
 		indent := line[:len(line)-len(trimmed)]
 		if len(indent) > 0 {
 			return indent, nil
 		}
 	}
 	return "", fmt.Errorf("no indentation detected")
 }
 // / 	Selects from the root node
 // // 	Selects nodes in the document from the current node that match the selection no matter where they are
 // . 	Selects the current node
 // @ 	Selects attributes
 // /bookstore/* 	Selects all the child element nodes of the bookstore element
 // //* 	Selects all elements in the document
 // /bookstore/book[1] 	Selects the first book element that is the child of the bookstore element.
 // /bookstore/book[last()] 	Selects the last book element that is the child of the bookstore element
 // /bookstore/book[last()-1] 	Selects the last but one book element that is the child of the bookstore element
 // /bookstore/book[position()<3] 	Selects the first two book elements that are children of the bookstore element
 // //title[@lang] 	Selects all the title elements that have an attribute named lang
 // //title[@lang='en'] 	Selects all the title elements that have a "lang" attribute with a value of "en"
 // /bookstore/book[price>35.00] 	Selects all the book elements of the bookstore element that have a price element with a value greater than 35.00
 // /bookstore/book[price>35.00]/title 	Selects all the title elements of the book elements of the bookstore element that have a price element with a value greater than 35.00
 // updateJSONValue updates a value in the JSON structure based on its JSONPath
 func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
 	return nil
 }
 // ToLua converts JSON values to Lua variables
 func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
 	table, err := ToLuaTable(L, data)
 	if err != nil {
 		return err
 	}
 	L.SetGlobal("v", table)
 	return nil
 }
 // FromLua retrieves values from Lua
 func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	luaValue := L.GetGlobal("v")
 	return FromLuaTable(L, luaValue.(*lua.LTable))
 }
--- a/processor/json_test.go
+++ b/processor/json_test.go
--- a/processor/jsonpath/jsonpath.go
+++ b/processor/jsonpath/jsonpath.go
@@ -0,0 +1,495 @@
 package jsonpath
 import (
 	"fmt"
 	"strconv"
 )
 // JSONStep represents a single step in a JSONPath query
 type JSONStep struct {
 	Type  StepType
 	Key   string // For Child/RecursiveDescent
 	Index int    // For Index (use -1 for wildcard "*")
 }
 // JSONNode represents a value in the JSON data with its path
 type JSONNode struct {
 	Value interface{} // The value found at the path
 	Path  string      // The exact JSONPath where the value was found
 }
 // StepType defines the types of steps in a JSONPath
 type StepType int
 const (
 	RootStep             StepType = iota // $ - The root element
 	ChildStep                            // .key - Direct child access
 	RecursiveDescentStep                 // ..key - Recursive search for key
 	WildcardStep                         // .* - All children of an object
 	IndexStep                            // [n] - Array index access (or [*] for all elements)
 )
 // TraversalMode determines how the traversal behaves
 type TraversalMode int
 const (
 	CollectMode     TraversalMode = iota // Just collect matched nodes
 	ModifyFirstMode                      // Modify first matching node
 	ModifyAllMode                        // Modify all matching nodes
 )
 // ParseJSONPath parses a JSONPath string into a sequence of steps
 func ParseJSONPath(path string) ([]JSONStep, error) {
 	if len(path) == 0 || path[0] != '$' {
 		return nil, fmt.Errorf("path must start with $; received: %q", path)
 	}
 	steps := []JSONStep{}
 	i := 0
 	for i < len(path) {
 		switch path[i] {
 		case '$':
 			steps = append(steps, JSONStep{Type: RootStep})
 			i++
 		case '.':
 			i++
 			if i < len(path) && path[i] == '.' {
 				// Recursive descent
 				i++
 				key, nextPos := readKey(path, i)
 				steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
 				i = nextPos
 			} else {
 				// Child step or wildcard
 				key, nextPos := readKey(path, i)
 				if key == "*" {
 					steps = append(steps, JSONStep{Type: WildcardStep})
 				} else {
 					steps = append(steps, JSONStep{Type: ChildStep, Key: key})
 				}
 				i = nextPos
 			}
 		case '[':
 			// Index step
 			i++
 			indexStr, nextPos := readIndex(path, i)
 			if indexStr == "*" {
 				steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
 			} else {
 				index, err := strconv.Atoi(indexStr)
 				if err != nil {
 					return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
 				}
 				steps = append(steps, JSONStep{Type: IndexStep, Index: index})
 			}
 			i = nextPos + 1 // Skip closing ]
 		default:
 			return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
 		}
 	}
 	return steps, nil
 }
 // readKey extracts a key name from the path
 func readKey(path string, start int) (string, int) {
 	i := start
 	for ; i < len(path); i++ {
 		if path[i] == '.' || path[i] == '[' {
 			break
 		}
 	}
 	return path[start:i], i
 }
 // readIndex extracts an array index or wildcard from the path
 func readIndex(path string, start int) (string, int) {
 	i := start
 	for ; i < len(path); i++ {
 		if path[i] == ']' {
 			break
 		}
 	}
 	return path[start:i], i
 }
 // Get retrieves values with their paths from data at the specified JSONPath
 // Each returned JSONNode contains both the value and its exact path in the data structure
 func Get(data interface{}, path string) ([]JSONNode, error) {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	results := []JSONNode{}
 	err = traverseWithPaths(data, steps, &results, "$")
 	if err != nil {
 		return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
 	}
 	return results, nil
 }
 // Set updates the value at the specified JSONPath in the original data structure.
 // It only modifies the first matching node.
 func Set(data interface{}, path string, value interface{}) error {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	if len(steps) <= 1 {
 		return fmt.Errorf("cannot set root node; the provided path %q is invalid", path)
 	}
 	success := false
 	err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
 	if err != nil {
 		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
 	}
 	return nil
 }
 // SetAll updates all matching values at the specified JSONPath.
 func SetAll(data interface{}, path string, value interface{}) error {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	if len(steps) <= 1 {
 		return fmt.Errorf("cannot set root node; the provided path %q is invalid", path)
 	}
 	success := false
 	err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
 	if err != nil {
 		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
 	}
 	return nil
 }
 // setWithPath modifies values while tracking paths
 func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
 	if node == nil || *success && mode == ModifyFirstMode {
 		return nil
 	}
 	// Skip root step
 	actualSteps := steps
 	if len(steps) > 0 && steps[0].Type == RootStep {
 		if len(steps) == 1 {
 			return fmt.Errorf("cannot set root node; the provided path %q is invalid", currentPath)
 		}
 		actualSteps = steps[1:]
 	}
 	// Process the first step
 	if len(actualSteps) == 0 {
 		return fmt.Errorf("cannot set root node; no steps provided for path %q", currentPath)
 	}
 	step := actualSteps[0]
 	remainingSteps := actualSteps[1:]
 	isLastStep := len(remainingSteps) == 0
 	switch step.Type {
 	case ChildStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
 		}
 		childPath := currentPath + "." + step.Key
 		if isLastStep {
 			// We've reached the target, set the value
 			m[step.Key] = value
 			*success = true
 			return nil
 		}
 		// Create intermediate nodes if necessary
 		child, exists := m[step.Key]
 		if !exists {
 			// Create missing intermediate node
 			if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
 				child = []interface{}{}
 			} else {
 				child = map[string]interface{}{}
 			}
 			m[step.Key] = child
 		}
 		err := setWithPath(child, remainingSteps, success, value, childPath, mode)
 		if err != nil {
 			return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 		}
 	case IndexStep:
 		arr, ok := node.([]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
 		}
 		// Handle wildcard index
 		if step.Index == -1 {
 			for i, item := range arr {
 				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				if isLastStep {
 					arr[i] = value
 					*success = true
 					if mode == ModifyFirstMode {
 						return nil
 					}
 				} else {
 					err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
 					if err != nil {
 						return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
 					}
 					if *success && mode == ModifyFirstMode {
 						return nil
 					}
 				}
 			}
 			return nil
 		}
 		// Handle specific index
 		if step.Index >= 0 && step.Index < len(arr) {
 			item := arr[step.Index]
 			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
 			if isLastStep {
 				arr[step.Index] = value
 				*success = true
 			} else {
 				err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
 				}
 			}
 		}
 	case RecursiveDescentStep:
 		// For recursive descent, first check direct match at this level
 		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
 			if val, exists := m[step.Key]; exists {
 				directPath := currentPath + "." + step.Key
 				if isLastStep {
 					m[step.Key] = value
 					*success = true
 					if mode == ModifyFirstMode {
 						return nil
 					}
 				} else {
 					err := setWithPath(val, remainingSteps, success, value, directPath, mode)
 					if err != nil {
 						return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
 					}
 					if *success && mode == ModifyFirstMode {
 						return nil
 					}
 				}
 			}
 		}
 		// Then continue recursion to all children
 		switch n := node.(type) {
 		case map[string]interface{}:
 			for k, v := range n {
 				childPath := currentPath + "." + k
 				// Skip keys we've already processed directly
 				if step.Key != "*" && k == step.Key {
 					continue
 				}
 				err := setWithPath(v, steps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		case []interface{}:
 			for i, v := range n {
 				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				err := setWithPath(v, steps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		}
 	case WildcardStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
 		}
 		for k, v := range m {
 			childPath := currentPath + "." + k
 			if isLastStep {
 				m[k] = value
 				*success = true
 				if mode == ModifyFirstMode {
 					return nil
 				}
 			} else {
 				err := setWithPath(v, remainingSteps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		}
 	}
 	return nil
 }
 // traverseWithPaths tracks both nodes and their paths during traversal
 func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
 	if len(steps) == 0 || node == nil {
 		return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
 	}
 	// Skip root step
 	actualSteps := steps
 	if steps[0].Type == RootStep {
 		if len(steps) == 1 {
 			*results = append(*results, JSONNode{Value: node, Path: currentPath})
 			return nil
 		}
 		actualSteps = steps[1:]
 	}
 	// Process the first step
 	step := actualSteps[0]
 	remainingSteps := actualSteps[1:]
 	isLastStep := len(remainingSteps) == 0
 	switch step.Type {
 	case ChildStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node is not a map; actual type: %T", node)
 		}
 		child, exists := m[step.Key]
 		if !exists {
 			return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
 		}
 		childPath := currentPath + "." + step.Key
 		if isLastStep {
 			*results = append(*results, JSONNode{Value: child, Path: childPath})
 		} else {
 			err := traverseWithPaths(child, remainingSteps, results, childPath)
 			if err != nil {
 				return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 			}
 		}
 	case IndexStep:
 		arr, ok := node.([]interface{})
 		if !ok {
 			return fmt.Errorf("node is not an array; actual type: %T", node)
 		}
 		// Handle wildcard index
 		if step.Index == -1 {
 			for i, item := range arr {
 				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				if isLastStep {
 					*results = append(*results, JSONNode{Value: item, Path: itemPath})
 				} else {
 					err := traverseWithPaths(item, remainingSteps, results, itemPath)
 					if err != nil {
 						return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
 					}
 				}
 			}
 			return nil
 		}
 		// Handle specific index
 		if step.Index >= 0 && step.Index < len(arr) {
 			item := arr[step.Index]
 			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
 			if isLastStep {
 				*results = append(*results, JSONNode{Value: item, Path: itemPath})
 			} else {
 				err := traverseWithPaths(item, remainingSteps, results, itemPath)
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
 				}
 			}
 		} else {
 			return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
 		}
 	case RecursiveDescentStep:
 		// For recursive descent, first check direct match at this level
 		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
 			if val, exists := m[step.Key]; exists {
 				directPath := currentPath + "." + step.Key
 				if isLastStep {
 					*results = append(*results, JSONNode{Value: val, Path: directPath})
 				} else {
 					err := traverseWithPaths(val, remainingSteps, results, directPath)
 					if err != nil {
 						return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
 					}
 				}
 			}
 		}
 		// For wildcard, collect this node
 		if step.Key == "*" && isLastStep {
 			*results = append(*results, JSONNode{Value: node, Path: currentPath})
 		}
 		// Then continue recursion to all children
 		switch n := node.(type) {
 		case map[string]interface{}:
 			for k, v := range n {
 				childPath := currentPath + "." + k
 				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		case []interface{}:
 			for i, v := range n {
 				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		}
 	case WildcardStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node is not a map; actual type: %T", node)
 		}
 		for k, v := range m {
 			childPath := currentPath + "." + k
 			if isLastStep {
 				*results = append(*results, JSONNode{Value: v, Path: childPath})
 			} else {
 				err := traverseWithPaths(v, remainingSteps, results, childPath)
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		}
 	}
 	return nil
 }
--- a/processor/jsonpath/jsonpath_get_set_test.go
+++ b/processor/jsonpath/jsonpath_get_set_test.go
@@ -0,0 +1,577 @@
 package jsonpath
 import (
 	"reflect"
 	"testing"
 )
 func TestGetWithPathsBasic(t *testing.T) {
 	tests := []struct {
 		name     string
 		data     map[string]interface{}
 		path     string
 		expected []JSONNode
 		error    bool
 	}{
 		{
 			name: "simple property",
 			data: map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 			path: "$.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.name"},
 			},
 		},
 		{
 			name: "nested property",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"age":  30,
 				},
 			},
 			path: "$.user.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.user.name"},
 			},
 		},
 		{
 			name: "array access",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[1].name",
 			expected: []JSONNode{
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "wildcard",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[*].name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.users[0].name"},
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "recursive descent",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"profile": map[string]interface{}{
 						"email": "john@example.com",
 					},
 				},
 				"admin": map[string]interface{}{
 					"email": "admin@example.com",
 				},
 			},
 			path: "$..email",
 			expected: []JSONNode{
 				{Value: "john@example.com", Path: "$.user.profile.email"},
 				{Value: "admin@example.com", Path: "$.admin.email"},
 			},
 		},
 		{
 			name: "nonexistent path",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 				},
 			},
 			path:     "$.user.email",
 			expected: []JSONNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(tt.data, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("GetWithPaths() returned error: %v", err)
 				}
 				return
 			}
 			// For nonexistent path, we expect empty slice
 			if tt.name == "nonexistent path" {
 				if len(result) > 0 {
 					t.Errorf("GetWithPaths() returned %v, expected empty result", result)
 				}
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For wildcard results, we need to check containment rather than exact order
 			if tt.name == "wildcard" || tt.name == "recursive descent" {
 				// For each expected item, check if it exists in the results by both value and path
 				for _, expected := range tt.expected {
 					found := false
 					for _, r := range result {
 						if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
 							found = true
 							break
 						}
 					}
 					if !found {
 						t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
 					}
 				}
 			} else {
 				// Otherwise check exact equality of both values and paths
 				for i, expected := range tt.expected {
 					if !reflect.DeepEqual(result[i].Value, expected.Value) {
 						t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
 					}
 					if result[i].Path != expected.Path {
 						t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestSet(t *testing.T) {
 	t.Run("simple property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 			"age":  30,
 		}
 		 err := Set(data, "$.name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		if data["name"] != "Jane" {
 			t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
 		}
 	})
 	t.Run("nested property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 		}
 		err := Set(data, "$.user.name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		user, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if user["name"] != "Jane" {
 			t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
 		}
 	})
 	t.Run("array element", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"name": "John", "age": 30},
 				map[string]interface{}{"name": "Jane", "age": 25},
 			},
 		}
 		err := Set(data, "$.users[0].name", "Bob")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		user0, ok := users[0].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if user0["name"] != "Bob" {
 			t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
 		}
 	})
 	t.Run("complex value", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 				"profile": map[string]interface{}{
 					"email": "john@example.com",
 				},
 			},
 		}
 		newProfile := map[string]interface{}{
 			"email": "john.doe@example.com",
 			"phone": "123-456-7890",
 		}
 		err := Set(data, "$.user.profile", newProfile)
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		profile, ok := userMap["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Profile is not a map")
 		}
 		if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
 			t.Errorf("Set() failed: expected profile to be updated with new values")
 		}
 	})
 	t.Run("create new property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		err := Set(data, "$.user.email", "john@example.com")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if email, exists := userMap["email"]; !exists || email != "john@example.com" {
 			t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
 		}
 	})
 	t.Run("create nested properties", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		err := Set(data, "$.user.contact.email", "john@example.com")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		contact, ok := userMap["contact"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Contact is not a map")
 		}
 		if email, exists := contact["email"]; !exists || email != "john@example.com" {
 			t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
 		}
 	})
 	t.Run("create array and element", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		// This should create an empty addresses array, but won't be able to set index 0
 		// since the array is empty
 		err := Set(data, "$.user.addresses[0].street", "123 Main St")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 	})
 	t.Run("multiple targets (should only update first)", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"active": true},
 				map[string]interface{}{"active": true},
 			},
 		}
 		err := Set(data, "$.users[*].active", false)
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		user0, ok := users[0].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User0 is not a map")
 		}
 		user1, ok := users[1].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User1 is not a map")
 		}
 		// Only the first one should be changed
 		if active, exists := user0["active"]; !exists || active != false {
 			t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
 		}
 		// The second one should remain unchanged
 		if active, exists := user1["active"]; !exists || active != true {
 			t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
 		}
 	})
 	t.Run("setting on root should fail", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 		}
 		err := Set(data, "$", "Jane")
 		if err == nil {
 			t.Errorf("Set() returned no error, expected error for setting on root")
 			return
 		}
 		// Data should be unchanged
 		if data["name"] != "John" {
 			t.Errorf("Data was modified when setting on root")
 		}
 	})
 }
 func TestSetAll(t *testing.T) {
 	t.Run("simple property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 			"age":  30,
 		}
 		err := SetAll(data, "$.name", "Jane")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		if data["name"] != "Jane" {
 			t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
 		}
 	})
 	t.Run("all array elements", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"active": true},
 				map[string]interface{}{"active": true},
 			},
 		}
 		err := SetAll(data, "$.users[*].active", false)
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		// Both elements should be updated
 		for i, user := range users {
 			userMap, ok := user.(map[string]interface{})
 			if !ok {
 				t.Fatalf("User%d is not a map", i)
 			}
 			if active, exists := userMap["active"]; !exists || active != false {
 				t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
 			}
 		}
 	})
 	t.Run("recursive descent", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"profile": map[string]interface{}{
 					"active": true,
 				},
 			},
 			"admin": map[string]interface{}{
 				"profile": map[string]interface{}{
 					"active": true,
 				},
 			},
 		}
 		err := SetAll(data, "$..active", false)
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Check user profile
 		userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Failed to access user.profile")
 		}
 		if active, exists := userProfile["active"]; !exists || active != false {
 			t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
 		}
 		// Check admin profile
 		adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Failed to access admin.profile")
 		}
 		if active, exists := adminProfile["active"]; !exists || active != false {
 			t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
 		}
 	})
 }
 func TestGetWithPathsExtended(t *testing.T) {
 	tests := []struct {
 		name     string
 		data     map[string]interface{}
 		path     string
 		expected []JSONNode
 	}{
 		{
 			name: "simple property",
 			data: map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 			path: "$.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.name"},
 			},
 		},
 		{
 			name: "nested property",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"age":  30,
 				},
 			},
 			path: "$.user.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.user.name"},
 			},
 		},
 		{
 			name: "array access",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[1].name",
 			expected: []JSONNode{
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "wildcard",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[*].name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.users[0].name"},
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "recursive descent",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"profile": map[string]interface{}{
 						"email": "john@example.com",
 					},
 				},
 				"admin": map[string]interface{}{
 					"email": "admin@example.com",
 				},
 			},
 			path: "$..email",
 			expected: []JSONNode{
 				{Value: "john@example.com", Path: "$.user.profile.email"},
 				{Value: "admin@example.com", Path: "$.admin.email"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(tt.data, tt.path)
 			if err != nil {
 				t.Errorf("GetWithPaths() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// Check if value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Check if path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
--- a/processor/jsonpath/jsonpath_test.go
+++ b/processor/jsonpath/jsonpath_test.go
@@ -0,0 +1,318 @@
 package jsonpath
 import (
 	"reflect"
 	"testing"
 )
 var testData = map[string]interface{}{
 	"store": map[string]interface{}{
 		"book": []interface{}{
 			map[string]interface{}{
 				"title": "The Fellowship of the Ring",
 				"price": 22.99,
 			},
 			map[string]interface{}{
 				"title": "The Two Towers",
 				"price": 23.45,
 			},
 		},
 		"bicycle": map[string]interface{}{
 			"color": "red",
 			"price": 199.95,
 		},
 	},
 }
 func TestParser(t *testing.T) {
 	tests := []struct {
 		path    string
 		steps   []JSONStep
 		wantErr bool
 	}{
 		{
 			path: "$.store.bicycle.color",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "bicycle"},
 				{Type: ChildStep, Key: "color"},
 			},
 		},
 		{
 			path: "$..price",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: RecursiveDescentStep, Key: "price"},
 			},
 		},
 		{
 			path: "$.store.book[*].title",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "book"},
 				{Type: IndexStep, Index: -1}, // Wildcard
 				{Type: ChildStep, Key: "title"},
 			},
 		},
 		{
 			path: "$.store.book[0]",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "book"},
 				{Type: IndexStep, Index: 0},
 			},
 		},
 		{
 			path:    "invalid.path",
 			wantErr: true,
 		},
 		{
 			path:    "$.store.book[abc]",
 			wantErr: true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.path, func(t *testing.T) {
 			steps, err := ParseJSONPath(tt.path)
 			if (err != nil) != tt.wantErr {
 				t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
 			}
 			if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
 				t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
 			}
 		})
 	}
 }
 func TestEvaluator(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []JSONNode
 		error    bool
 	}{
 		{
 			name: "simple_property_access",
 			path: "$.store.bicycle.color",
 			expected: []JSONNode{
 				{Value: "red", Path: "$.store.bicycle.color"},
 			},
 		},
 		{
 			name: "array_index_access",
 			path: "$.store.book[0].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 			},
 		},
 		{
 			name: "wildcard_array_access",
 			path: "$.store.book[*].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 				{Value: "The Two Towers", Path: "$.store.book[1].title"},
 			},
 		},
 		{
 			name: "recursive_price_search",
 			path: "$..price",
 			expected: []JSONNode{
 				{Value: 22.99, Path: "$.store.book[0].price"},
 				{Value: 23.45, Path: "$.store.book[1].price"},
 				{Value: 199.95, Path: "$.store.bicycle.price"},
 			},
 		},
 		{
 			name: "wildcard_recursive",
 			path: "$..*",
 			expected: []JSONNode{
 				// These will be compared by value only, paths will be validated separately
 				{Value: testData["store"].(map[string]interface{})["book"]},
 				{Value: testData["store"].(map[string]interface{})["bicycle"]},
 				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
 				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
 				{Value: "The Fellowship of the Ring"},
 				{Value: 22.99},
 				{Value: "The Two Towers"},
 				{Value: 23.45},
 				{Value: "red"},
 				{Value: 199.95},
 			},
 		},
 		{
 			name:     "invalid_index",
 			path:     "$.store.book[5]",
 			expected: []JSONNode{},
 			error:    true,
 		},
 		{
 			name:     "nonexistent_property",
 			path:     "$.store.nonexistent",
 			expected: []JSONNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			// Use GetWithPaths directly
 			result, err := Get(testData, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("Get() returned error: %v", err)
 				}
 				return
 			}
 			// Special handling for wildcard recursive test
 			if tt.name == "wildcard_recursive" {
 				// Skip length check for wildcard recursive since it might vary
 				// Just verify that each expected item is in the results
 				// Validate values match and paths are filled in
 				for _, e := range tt.expected {
 					found := false
 					for _, r := range result {
 						if reflect.DeepEqual(r.Value, e.Value) {
 							found = true
 							break
 						}
 					}
 					if !found {
 						t.Errorf("Expected value %v not found in results", e.Value)
 					}
 				}
 				return
 			}
 			if len(result) != len(tt.expected) {
 				t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
 			}
 			// Validate both values and paths
 			for i, e := range tt.expected {
 				if i < len(result) {
 					if !reflect.DeepEqual(result[i].Value, e.Value) {
 						t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
 					}
 					if result[i].Path != e.Path {
 						t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestEdgeCases(t *testing.T) {
 	t.Run("empty_data", func(t *testing.T) {
 		result, err := Get(nil, "$.a.b")
 		if err == nil {
 			t.Errorf("Expected error for empty data")
 			return
 		}
 		if len(result) > 0 {
 			t.Errorf("Expected empty result, got %v", result)
 		}
 	})
 	t.Run("empty_path", func(t *testing.T) {
 		_, err := ParseJSONPath("")
 		if err == nil {
 			t.Error("Expected error for empty path")
 		}
 	})
 	t.Run("numeric_keys", func(t *testing.T) {
 		data := map[string]interface{}{
 			"42": "answer",
 		}
 		result, err := Get(data, "$.42")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) == 0 || result[0].Value != "answer" {
 			t.Errorf("Expected 'answer', got %v", result)
 		}
 	})
 }
 func TestGetWithPaths(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []JSONNode
 	}{
 		{
 			name: "simple_property_access",
 			path: "$.store.bicycle.color",
 			expected: []JSONNode{
 				{Value: "red", Path: "$.store.bicycle.color"},
 			},
 		},
 		{
 			name: "array_index_access",
 			path: "$.store.book[0].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 			},
 		},
 		{
 			name: "wildcard_array_access",
 			path: "$.store.book[*].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 				{Value: "The Two Towers", Path: "$.store.book[1].title"},
 			},
 		},
 		{
 			name: "recursive_price_search",
 			path: "$..price",
 			expected: []JSONNode{
 				{Value: 22.99, Path: "$.store.book[0].price"},
 				{Value: 23.45, Path: "$.store.book[1].price"},
 				{Value: 199.95, Path: "$.store.bicycle.price"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(testData, tt.path)
 			if err != nil {
 				t.Errorf("Get() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// First verify the value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Then verify the path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
--- a/processor/processor.go
+++ b/processor/processor.go
@@ -2,210 +2,128 @@ package processor
 import (
 	"fmt"
-	"io"
+	"reflect"
 	"net/http"
 	"regexp"
 	"strings"
 	"cook/utils"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
 )
-// processorLogger is a scoped logger for the processor package.
+// Processor defines the interface for all file processors
-var processorLogger = logger.Default.WithPrefix("processor")
+type Processor interface {
 	// Process handles processing a file with the given pattern and Lua expression
 	Process(filename string, pattern string, luaExpr string) (int, int, error)
-// Maybe we make this an interface again for the shits and giggles
+	// ProcessContent handles processing a string content directly with the given pattern and Lua expression
-// We will see, it could easily be...
+	// Returns the modified content, modification count, match count, and any error
 	ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
-var globalVariables = map[string]interface{}{}
+	// ToLua converts processor-specific data to Lua variables
 	ToLua(L *lua.LState, data interface{}) error
-func SetVariables(vars map[string]interface{}) {
+	// FromLua retrieves modified data from Lua
-	for k, v := range vars {
+	FromLua(L *lua.LState) (interface{}, error)
-		globalVariables[k] = v
+}
-	}
+
 // ModificationRecord tracks a single value modification
 type ModificationRecord struct {
 	File      string
 	OldValue  string
 	NewValue  string
 	Operation string
 	Context   string
 }
 func NewLuaState() (*lua.LState, error) {
 	newLStateLogger := processorLogger.WithPrefix("NewLuaState")
 	newLStateLogger.Debug("Creating new Lua state")
 	L := lua.NewState()
 	// defer L.Close()
 	// Load math library
 	newLStateLogger.Debug("Loading Lua math library")
 	L.Push(L.GetGlobal("require"))
 	L.Push(lua.LString("math"))
 	if err := L.PCall(1, 1, nil); err != nil {
 		newLStateLogger.Error("Failed to load Lua math library: %v", err)
 		return nil, fmt.Errorf("error loading Lua math library: %v", err)
 	}
 	newLStateLogger.Debug("Lua math library loaded")
 	// Initialize helper functions
 	newLStateLogger.Debug("Initializing Lua helper functions")
 	if err := InitLuaHelpers(L); err != nil {
 		newLStateLogger.Error("Failed to initialize Lua helper functions: %v", err)
 		return nil, err
 	}
 	newLStateLogger.Debug("Lua helper functions initialized")
 	// Inject global variables
 	if len(globalVariables) > 0 {
 		newLStateLogger.Debug("Injecting %d global variables into Lua state", len(globalVariables))
 		for k, v := range globalVariables {
 			switch val := v.(type) {
 			case int:
 				L.SetGlobal(k, lua.LNumber(float64(val)))
 			case int64:
 				L.SetGlobal(k, lua.LNumber(float64(val)))
 			case float32:
 				L.SetGlobal(k, lua.LNumber(float64(val)))
 			case float64:
 				L.SetGlobal(k, lua.LNumber(val))
 			case string:
 				L.SetGlobal(k, lua.LString(val))
 			case bool:
 				if val {
 					L.SetGlobal(k, lua.LTrue)
 				} else {
 					L.SetGlobal(k, lua.LFalse)
 				}
 			default:
 				// Fallback to string representation
 				L.SetGlobal(k, lua.LString(fmt.Sprintf("%v", val)))
 			}
 		}
 	}
 	newLStateLogger.Debug("New Lua state created successfully")
 	return L, nil
 }
-// FromLua converts a Lua table to a struct or map recursively
+// ToLuaTable converts a struct or map to a Lua table recursively
-func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
+func ToLuaTable(L *lua.LState, data interface{}) (*lua.LTable, error) {
-	fromLuaLogger := processorLogger.WithPrefix("FromLua").WithField("luaType", luaValue.Type().String())
+	luaTable := L.NewTable()
-	fromLuaLogger.Debug("Converting Lua value to Go interface")
+
-	switch v := luaValue.(type) {
+	switch v := data.(type) {
-	case *lua.LTable:
+	case map[string]interface{}:
-		fromLuaLogger.Debug("Processing Lua table")
+		for key, value := range v {
-		isArray, err := IsLuaTableArray(L, v)
+			luaValue, err := ToLuaTable(L, value)
-		if err != nil {
+			if err != nil {
-			fromLuaLogger.Error("Failed to determine if Lua table is array: %v", err)
+				return nil, err
-			return nil, err
+			}
 			luaTable.RawSetString(key, luaValue)
 		}
-		fromLuaLogger.Debug("Lua table is array: %t", isArray)
+	case struct{}:
-		if isArray {
+		val := reflect.ValueOf(v)
-			fromLuaLogger.Debug("Converting Lua table to Go array")
+		for i := 0; i < val.NumField(); i++ {
-			result := make([]interface{}, 0)
+			field := val.Type().Field(i)
-			v.ForEach(func(key lua.LValue, value lua.LValue) {
+			luaValue, err := ToLuaTable(L, val.Field(i).Interface())
-				converted, _ := FromLua(L, value)
+			if err != nil {
-				result = append(result, converted)
+				return nil, err
-			})
+			}
-			fromLuaLogger.Trace("Converted Go array: %v", result)
+			luaTable.RawSetString(field.Name, luaValue)
 			return result, nil
 		} else {
 			fromLuaLogger.Debug("Converting Lua table to Go map")
 			result := make(map[string]interface{})
 			v.ForEach(func(key lua.LValue, value lua.LValue) {
 				converted, _ := FromLua(L, value)
 				result[key.String()] = converted
 			})
 			fromLuaLogger.Trace("Converted Go map: %v", result)
 			return result, nil
 		}
-	case lua.LString:
+	case string:
-		fromLuaLogger.Debug("Converting Lua string to Go string")
+		luaTable.RawSetString("v", lua.LString(v))
-		fromLuaLogger.Trace("Lua string: %q", string(v))
+	case bool:
-		return string(v), nil
+		luaTable.RawSetString("v", lua.LBool(v))
-	case lua.LBool:
+	case float64:
-		fromLuaLogger.Debug("Converting Lua boolean to Go boolean")
+		luaTable.RawSetString("v", lua.LNumber(v))
 		fromLuaLogger.Trace("Lua boolean: %t", bool(v))
 		return bool(v), nil
 	case lua.LNumber:
 		fromLuaLogger.Debug("Converting Lua number to Go float64")
 		fromLuaLogger.Trace("Lua number: %f", float64(v))
 		return float64(v), nil
 	default:
-		fromLuaLogger.Debug("Unsupported Lua type, returning nil")
+		return nil, fmt.Errorf("unsupported data type: %T", data)
 		return nil, nil
 	}
 	return luaTable, nil
 }
-func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
+// FromLuaTable converts a Lua table to a struct or map recursively
-	isLuaTableArrayLogger := processorLogger.WithPrefix("IsLuaTableArray")
+func FromLuaTable(L *lua.LState, luaTable *lua.LTable) (map[string]interface{}, error) {
-	isLuaTableArrayLogger.Debug("Checking if Lua table is an array")
+	result := make(map[string]interface{})
 	isLuaTableArrayLogger.Trace("Lua table input: %v", v)
 	L.SetGlobal("table_to_check", v)
-	// Use our predefined helper function from InitLuaHelpers
+	luaTable.ForEach(func(key lua.LValue, value lua.LValue) {
-	err := L.DoString(`is_array = isArray(table_to_check)`)
+		switch v := value.(type) {
-	if err != nil {
+		case *lua.LTable:
-		isLuaTableArrayLogger.Error("Error determining if table is an array: %v", err)
+			nestedMap, err := FromLuaTable(L, v)
-		return false, fmt.Errorf("error determining if table is array: %w", err)
+			if err != nil {
-	}
+				return
 			}
 			result[key.String()] = nestedMap
 		case lua.LString:
 			result[key.String()] = string(v)
 		case lua.LBool:
 			result[key.String()] = bool(v)
 		case lua.LNumber:
 			result[key.String()] = float64(v)
 		default:
 			result[key.String()] = nil
 		}
 	})
 	// Check the result of our Lua function
 	isArray := L.GetGlobal("is_array")
 	// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
 	result := !lua.LVIsFalse(isArray)
 	isLuaTableArrayLogger.Debug("Lua table is array: %t", result)
 	isLuaTableArrayLogger.Trace("isArray result Lua value: %v", isArray)
 	return result, nil
 }
 // InitLuaHelpers initializes common Lua helper functions
 func InitLuaHelpers(L *lua.LState) error {
 	initLuaHelpersLogger := processorLogger.WithPrefix("InitLuaHelpers")
 	initLuaHelpersLogger.Debug("Loading Lua helper functions")
 	helperScript := `
 -- Custom Lua helpers for math operations
 function min(a, b) return math.min(a, b) end
 function max(a, b) return math.max(a, b) end
-function round(x, n)
+function round(x) return math.floor(x + 0.5) end
 	if n == nil then n = 0 end
 	return math.floor(x * 10^n + 0.5) / 10^n
 end
 function floor(x) return math.floor(x) end
 function ceil(x) return math.ceil(x) end
 function upper(s) return string.upper(s) end
 function lower(s) return string.lower(s) end
 function format(s, ...) return string.format(s, ...) end
 function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
 -- String split helper
 function strsplit(inputstr, sep)
  if sep == nil then
    sep = "%s"
  end
  local t = {}
  for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
    table.insert(t, str)
  end
  return t
 end
 ---@param table table
 ---@param depth number?
 function DumpTable(table, depth)
 	if depth == nil then
 		depth = 0
 	end
 	if (depth > 200) then
 		print("Error: Depth > 200 in dumpTable()")
 		return
 	end
 	for k, v in pairs(table) do
 		if (type(v) == "table") then
 			print(string.rep("  ", depth) .. k .. ":")
 			DumpTable(v, depth + 1)
 		else
 			print(string.rep("  ", depth) .. k .. ": ", v)
 		end
 	end
 end
 -- String to number conversion helper
 function num(str)
@@ -221,39 +139,26 @@ end
 function is_number(str)
    return tonumber(str) ~= nil
 end
 function isArray(t)
    if type(t) ~= "table" then return false end
    local max = 0
    local count = 0
    for k, _ in pairs(t) do
        if type(k) ~= "number" or k < 1 or math.floor(k) ~= k then
            return false
        end
        max = math.max(max, k)
        count = count + 1
    end
    return max == count
 end
 modified = false
 `
 	if err := L.DoString(helperScript); err != nil {
 		initLuaHelpersLogger.Error("Failed to load Lua helper functions: %v", err)
 		return fmt.Errorf("error loading helper functions: %v", err)
 	}
 	initLuaHelpersLogger.Debug("Lua helper functions loaded")
 	initLuaHelpersLogger.Debug("Setting up Lua print function to Go")
 	L.SetGlobal("print", L.NewFunction(printToGo))
 	L.SetGlobal("fetch", L.NewFunction(fetch))
 	initLuaHelpersLogger.Debug("Lua print and fetch functions bound to Go")
 	return nil
 }
-func PrependLuaAssignment(luaExpr string) string {
+// Helper utility functions
-	prependLuaAssignmentLogger := processorLogger.WithPrefix("PrependLuaAssignment").WithField("originalLuaExpr", luaExpr)
+
-	prependLuaAssignmentLogger.Debug("Prepending Lua assignment if necessary")
+// LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	s = strings.ReplaceAll(s, "\n", "\\n")
 	if len(s) <= maxLen {
 		return s
 	}
 	return s[:maxLen-3] + "..."
 }
 // BuildLuaScript prepares a Lua expression from shorthand notation
 func BuildLuaScript(luaExpr string) string {
 	// Auto-prepend v1 for expressions starting with operators
 	if strings.HasPrefix(luaExpr, "*") ||
 		strings.HasPrefix(luaExpr, "/") ||
@@ -262,202 +167,31 @@ func PrependLuaAssignment(luaExpr string) string {
 		strings.HasPrefix(luaExpr, "^") ||
 		strings.HasPrefix(luaExpr, "%") {
 		luaExpr = "v1 = v1" + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1 = v1' due to operator prefix")
 	} else if strings.HasPrefix(luaExpr, "=") {
 		// Handle direct assignment with = operator
 		luaExpr = "v1 " + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1' due to direct assignment operator")
 	}
 	// Add assignment if needed
 	if !strings.Contains(luaExpr, "=") {
 		luaExpr = "v1 = " + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1 =' as no assignment was found")
 	}
-	prependLuaAssignmentLogger.Trace("Final Lua expression after prepending: %q", luaExpr)
+
 	return luaExpr
 }
-// BuildLuaScript prepares a Lua expression from shorthand notation
+// Max returns the maximum of two integers
-func BuildLuaScript(luaExpr string) string {
+func Max(a, b int) int {
-	buildLuaScriptLogger := processorLogger.WithPrefix("BuildLuaScript").WithField("inputLuaExpr", luaExpr)
+	if a > b {
-	buildLuaScriptLogger.Debug("Building full Lua script from expression")
+		return a
-
+	}
-	// Perform $var substitutions from globalVariables
+	return b
 	luaExpr = replaceVariables(luaExpr)
 	luaExpr = PrependLuaAssignment(luaExpr)
 	fullScript := fmt.Sprintf(`
 		function run()
 			%s
 		end
 		local res = run()
 		modified = res == nil or res
 	`, luaExpr)
 	buildLuaScriptLogger.Trace("Generated full Lua script: %q", utils.LimitString(fullScript, 200))
 	return fullScript
 }
-func replaceVariables(expr string) string {
+// Min returns the minimum of two integers
-	// $varName -> literal value
+func Min(a, b int) int {
-	varNameRe := regexp.MustCompile(`\$(\w+)`)
+	if a < b {
-	return varNameRe.ReplaceAllStringFunc(expr, func(m string) string {
+		return a
-		name := varNameRe.FindStringSubmatch(m)[1]
+	}
-		if v, ok := globalVariables[name]; ok {
+	return b
 			switch val := v.(type) {
 			case int, int64, float32, float64:
 				return fmt.Sprintf("%v", val)
 			case bool:
 				if val {
 					return "true"
 				} else {
 					return "false"
 				}
 			case string:
 				// Quote strings for Lua literal
 				return fmt.Sprintf("%q", val)
 			default:
 				return fmt.Sprintf("%q", fmt.Sprintf("%v", val))
 			}
 		}
 		return m
 	})
 }
 func printToGo(L *lua.LState) int {
 	printToGoLogger := processorLogger.WithPrefix("printToGo")
 	printToGoLogger.Debug("Lua print function called, redirecting to Go logger")
 	top := L.GetTop()
 	args := make([]interface{}, top)
 	for i := 1; i <= top; i++ {
 		args[i-1] = L.Get(i)
 	}
 	// Format the message with proper spacing between arguments
 	var parts []string
 	for _, arg := range args {
 		parts = append(parts, fmt.Sprintf("%v", arg))
 	}
 	message := strings.Join(parts, " ")
 	printToGoLogger.Trace("Lua print message: %q", message)
 	// Use the LUA log level with a script tag
 	logger.Lua("%s", message)
 	printToGoLogger.Debug("Message logged from Lua")
 	return 0
 }
 func fetch(L *lua.LState) int {
 	fetchLogger := processorLogger.WithPrefix("fetch")
 	fetchLogger.Debug("Lua fetch function called")
 	// Get URL from first argument
 	url := L.ToString(1)
 	if url == "" {
 		fetchLogger.Error("Fetch failed: URL is required")
 		L.Push(lua.LNil)
 		L.Push(lua.LString("URL is required"))
 		return 2
 	}
 	fetchLogger.Debug("Fetching URL: %q", url)
 	// Get options from second argument if provided
 	var method string = "GET"
 	var headers map[string]string = make(map[string]string)
 	var body string = ""
 	if L.GetTop() > 1 {
 		options := L.ToTable(2)
 		if options != nil {
 			fetchLogger.Debug("Processing fetch options")
 			// Get method
 			if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
 				method = methodVal.String()
 				fetchLogger.Trace("Method from options: %q", method)
 			}
 			// Get headers
 			if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
 				if headersTable, ok := headersVal.(*lua.LTable); ok {
 					fetchLogger.Trace("Processing headers table")
 					headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
 						headers[key.String()] = value.String()
 						fetchLogger.Trace("Header: %q = %q", key.String(), value.String())
 					})
 				}
 				fetchLogger.Trace("All headers: %v", headers)
 			}
 			// Get body
 			if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
 				body = bodyVal.String()
 				fetchLogger.Trace("Body from options: %q", utils.LimitString(body, 100))
 			}
 		}
 	}
 	fetchLogger.Debug("Fetch request details: Method=%q, URL=%q, BodyLength=%d, Headers=%v", method, url, len(body), headers)
 	// Create HTTP request
 	req, err := http.NewRequest(method, url, strings.NewReader(body))
 	if err != nil {
 		fetchLogger.Error("Error creating HTTP request: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
 		return 2
 	}
 	// Set headers
 	for key, value := range headers {
 		req.Header.Set(key, value)
 	}
 	fetchLogger.Debug("HTTP request created and headers set")
 	fetchLogger.Trace("HTTP Request: %+v", req)
 	// Make request
 	client := &http.Client{}
 	resp, err := client.Do(req)
 	if err != nil {
 		fetchLogger.Error("Error making HTTP request: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
 		return 2
 	}
 	defer func() {
 		fetchLogger.Debug("Closing HTTP response body")
 		resp.Body.Close()
 	}()
 	fetchLogger.Debug("HTTP request executed. Status Code: %d", resp.StatusCode)
 	// Read response body
 	bodyBytes, err := io.ReadAll(resp.Body)
 	if err != nil {
 		fetchLogger.Error("Error reading response body: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
 		return 2
 	}
 	fetchLogger.Trace("Response body length: %d", len(bodyBytes))
 	// Create response table
 	responseTable := L.NewTable()
 	responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
 	responseTable.RawSetString("statusText", lua.LString(resp.Status))
 	responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
 	responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
 	fetchLogger.Debug("Created Lua response table")
 	// Set headers in response
 	headersTable := L.NewTable()
 	for key, values := range resp.Header {
 		headersTable.RawSetString(key, lua.LString(values[0]))
 		fetchLogger.Trace("Response header: %q = %q", key, values[0])
 	}
 	responseTable.RawSetString("headers", headersTable)
 	fetchLogger.Trace("Full response table: %v", responseTable)
 	L.Push(responseTable)
 	fetchLogger.Debug("Pushed response table to Lua stack")
 	return 1
 }
--- a/processor/regex.go
+++ b/processor/regex.go
@@ -1,108 +1,134 @@
 package processor
 import (
 	"cook/utils"
 	"fmt"
 	"os"
 	"path/filepath"
 	"regexp"
 	"strconv"
 	"strings"
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
 )
-// regexLogger is a scoped logger for the processor/regex package.
+// RegexProcessor implements the Processor interface using regex patterns
-var regexLogger = logger.Default.WithPrefix("processor/regex")
+type RegexProcessor struct{}
-type CaptureGroup struct {
+// Process implements the Processor interface for RegexProcessor
-	Name    string
+func (p *RegexProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
-	Value   string
+	// Read file content
-	Updated string
+	fullPath := filepath.Join(".", filename)
-	Range   [2]int
+	content, err := os.ReadFile(fullPath)
 	if err != nil {
 		return 0, 0, fmt.Errorf("error reading file: %v", err)
 	}
 	fileContent := string(content)
 	// Process the content
 	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
 	if err != nil {
 		return 0, 0, err
 	}
 	// If we made modifications, save the file
 	if modCount > 0 {
 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
 		if err != nil {
 			return 0, 0, fmt.Errorf("error writing file: %v", err)
 		}
 	}
 	return modCount, matchCount, nil
 }
 // ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
 func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
 	captures, ok := data.([]string)
 	if !ok {
 		return fmt.Errorf("expected []string for captures, got %T", data)
 	}
 	// Set variables for each capture group, starting from v1/s1 for the first capture
 	for i := 0; i < len(captures); i++ {
 		// Set string version (always available as s1, s2, etc.)
 		L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
 		// Try to convert to number and set v1, v2, etc.
 		if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
 			L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
 		}
 	}
 	return nil
 }
 // FromLua implements the Processor interface for RegexProcessor
 func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	// Get the modified values after Lua execution
 	modifications := make(map[int]string)
 	// Check for modifications to v1-v12 and s1-s12
 	for i := 0; i < 12; i++ {
 		// Check both v and s variables to see if any were modified
 		vVarName := fmt.Sprintf("v%d", i+1)
 		sVarName := fmt.Sprintf("s%d", i+1)
 		vLuaVal := L.GetGlobal(vVarName)
 		sLuaVal := L.GetGlobal(sVarName)
 		// If our value is a number then it's very likely we want it to be a number
 		// And not a string
 		// If we do want it to be a string we will cast it into a string in lua
 		// wait that wouldn't work... Casting v to a string would not load it here
 		if vLuaVal.Type() == lua.LTNumber {
 			modifications[i] = vLuaVal.String()
 			continue
 		}
 		if sLuaVal.Type() == lua.LTString {
 			modifications[i] = sLuaVal.String()
 			continue
 		}
 	}
 	return modifications, nil
 }
 // ProcessContent applies regex replacement with Lua processing
-// The filename here exists ONLY so we can pass it to the lua environment
+func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
-// It's not used for anything else
+	// Handle special pattern modifications
-func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
+	if !strings.HasPrefix(pattern, "(?s)") {
-	processRegexLogger := regexLogger.WithPrefix("ProcessRegex").WithField("commandName", command.Name).WithField("file", filename)
+		pattern = "(?s)" + pattern
-	processRegexLogger.Debug("Starting regex processing for file")
+	}
 	processRegexLogger.Trace("Initial file content length: %d", len(content))
 	processRegexLogger.Trace("Command details: %+v", command)
 	var commands []utils.ReplaceCommand
 	// Start timing the regex processing
 	startTime := time.Now()
 	// We don't HAVE to do this multiple times for a pattern
 	// But it's quick enough for us to not care
 	pattern := resolveRegexPlaceholders(command.Regex)
 	processRegexLogger.Debug("Resolved regex placeholders. Pattern: %s", pattern)
 	// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
 	// But it's a compromise that allows us to use | in yaml
 	// Otherwise we would have to escape every god damn pair of quotation marks
 	// And a bunch of other shit
 	pattern = strings.TrimSpace(pattern)
 	processRegexLogger.Debug("Trimmed regex pattern: %s", pattern)
 	patternCompileStart := time.Now()
 	compiledPattern, err := regexp.Compile(pattern)
 	if err != nil {
-		processRegexLogger.Error("Error compiling pattern %q: %v", pattern, err)
+		return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
 		return commands, fmt.Errorf("error compiling pattern: %v", err)
 	}
 	processRegexLogger.Debug("Compiled pattern successfully in %v", time.Since(patternCompileStart))
-	// Same here, it's just string concatenation, it won't kill us
+	previous := luaExpr
-	// More important is that we don't fuck up the command
+	luaExpr = BuildLuaScript(luaExpr)
-	// But we shouldn't be able to since it's passed by value
+	fmt.Printf("Changing Lua expression from: %s to: %s\n", previous, luaExpr)
-	previousLuaExpr := command.Lua
+
-	luaExpr := BuildLuaScript(command.Lua)
+	L, err := NewLuaState()
-	processRegexLogger.Debug("Transformed Lua expression: %q → %q", previousLuaExpr, luaExpr)
+	if err != nil {
-	processRegexLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
+		return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
 	}
 	defer L.Close()
 	// Initialize Lua environment
 	modificationCount := 0
 	// Process all regex matches
-	matchFindStart := time.Now()
+	result := content
 	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
 	matchFindDuration := time.Since(matchFindStart)
 	processRegexLogger.Debug("Found %d matches in content of length %d (search took %v)",
 		len(indices), len(content), matchFindDuration)
 	processRegexLogger.Trace("Match indices: %v", indices)
 	// Log pattern complexity metrics
 	patternComplexity := estimatePatternComplexity(pattern)
 	processRegexLogger.Debug("Pattern complexity estimate: %d", patternComplexity)
 	if len(indices) == 0 {
 		processRegexLogger.Warning("No matches found for regex: %q", pattern)
 		processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
 		return commands, nil
 	}
 	// We walk backwards because we're replacing something with something else that might be longer
 	// And in the case it is longer than the original all indicces past that change will be fucked up
 	// By going backwards we fuck up all the indices to the end of the file that we don't care about
 	// Because there either aren't any (last match) or they're already modified (subsequent matches)
-	for i, matchIndices := range indices {
+	for i := len(indices) - 1; i >= 0; i-- {
-		matchLogger := processRegexLogger.WithField("matchNum", i+1)
+		matchIndices := indices[i]
 		matchLogger.Debug("Processing match %d of %d", i+1, len(indices))
 		matchLogger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
 		L, err := NewLuaState()
 		if err != nil {
 			matchLogger.Error("Error creating Lua state: %v", err)
 			return commands, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		L.SetGlobal("file", lua.LString(filename))
 		// Hmm... Maybe we don't want to defer this..
 		// Maybe we want to close them every iteration
 		// We'll leave it as is for now
 		defer L.Close()
 		matchLogger.Trace("Lua state created successfully for match %d", i+1)
 		// Why we're doing this whole song and dance of indices is to properly handle empty matches
 		// Plus it's a little cleaner to surgically replace our matches
 		// If we were to use string.replace and encountered an empty match there'd be nothing to replace
@@ -110,390 +136,61 @@ func ProcessRegex(content string, command utils.ModifyCommand, filename string)
 		// So when we're cutting open the array we say 0:7 + modified + 7:end
 		// As if concatenating in the middle of the array
 		// Plus it supports lookarounds
-		matchContent := content[matchIndices[0]:matchIndices[1]]
+		match := content[matchIndices[0]:matchIndices[1]]
 		matchPreview := utils.LimitString(matchContent, 50)
 		matchLogger.Trace("Matched content: %q (length: %d)", matchPreview, len(matchContent))
 		groups := matchIndices[2:]
 		if len(groups) <= 0 {
-			matchLogger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
+			fmt.Println("No capture groups for lua to chew on")
 			continue
 		}
 		if len(groups)%2 == 1 {
-			matchLogger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
+			fmt.Println("Odd number of indices of groups, what the fuck?")
 			continue
 		}
-		// Count how many valid groups we have
+		captures := make([]string, 0, len(groups)/2)
 		validGroups := 0
 		for j := 0; j < len(groups); j += 2 {
-			if groups[j] != -1 && groups[j+1] != -1 {
+			captures = append(captures, content[groups[j]:groups[j+1]])
 				validGroups++
 			}
 		}
 		matchLogger.Debug("Found %d valid capture groups in match", validGroups)
 		for _, index := range groups {
 			if index == -1 {
 				matchLogger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
 				continue
 			}
 		}
-		// We have to use array to preserve order
+		if err := p.ToLua(L, captures); err != nil {
-		// Very important for the reconstruction step
+			fmt.Println("Error setting Lua variables:", err)
 		// Because we must overwrite the values in reverse order
 		// See comments a few dozen lines above for more details
 		captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
 		groupNames := compiledPattern.SubexpNames()[1:]
 		for i, name := range groupNames {
 			start := groups[i*2]
 			end := groups[i*2+1]
 			if start == -1 || end == -1 {
 				matchLogger.Debug("Skipping empty or unmatched capture group #%d (name: %q)", i+1, name)
 				continue
 			}
 			value := content[start:end]
 			captureGroups = append(captureGroups, &CaptureGroup{
 				Name:  name,
 				Value: value,
 				Range: [2]int{start, end},
 			})
 			// Include name info in log if available
 			if name != "" {
 				matchLogger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
 			} else {
 				matchLogger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
 			}
 		}
 		// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
 		if !command.NoDedup {
 			matchLogger.Debug("Deduplicating capture groups as specified in command settings")
 			captureGroups = deduplicateGroups(captureGroups)
 			matchLogger.Trace("Capture groups after deduplication: %v", captureGroups)
 		} else {
 			matchLogger.Debug("Skipping deduplication of capture groups (NoDedup is true)")
 		}
 		if err := toLua(L, captureGroups); err != nil {
 			matchLogger.Error("Failed to set Lua variables for capture groups: %v", err)
 			continue
 		}
 		matchLogger.Debug("Set %d capture groups as Lua variables", len(captureGroups))
 		matchLogger.Trace("Lua globals set for capture groups")
 		if err := L.DoString(luaExpr); err != nil {
-			matchLogger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
+			fmt.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
 				err, utils.LimitString(luaExpr, 200), captureGroups)
 			continue
 		}
 		matchLogger.Debug("Lua script executed successfully")
 		// Get modifications from Lua
-		updatedCaptureGroups, err := fromLua(L, captureGroups)
+		modResult, err := p.FromLua(L)
 		if err != nil {
-			matchLogger.Error("Failed to retrieve modifications from Lua: %v", err)
+			fmt.Println("Error getting modifications:", err)
 			continue
 		}
 		matchLogger.Debug("Retrieved updated values from Lua")
 		matchLogger.Trace("Updated capture groups from Lua: %v", updatedCaptureGroups)
 		replacement := ""
 		replacementVar := L.GetGlobal("replacement")
 		if replacementVar.Type() != lua.LTNil {
 			replacement = replacementVar.String()
 			matchLogger.Debug("Using global replacement variable from Lua: %q", replacement)
 		}
 		// Check if modification flag is set
 		modifiedVal := L.GetGlobal("modified")
 		if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
 			matchLogger.Debug("Skipping match - no modifications indicated by Lua script")
 			continue
 		}
-		if replacement == "" {
+		// Apply modifications to the matched text
-			// Apply the modifications to the original match
+		modsMap, ok := modResult.(map[int]string)
-			replacement = matchContent
+		if !ok || len(modsMap) == 0 {
-
+			fmt.Println("No modifications to apply")
 			// Count groups that were actually modified
 			modifiedGroupsCount := 0
 			for _, capture := range updatedCaptureGroups {
 				if capture.Value != capture.Updated {
 					modifiedGroupsCount++
 				}
 			}
 			matchLogger.Info("%d of %d capture groups identified for modification", modifiedGroupsCount, len(updatedCaptureGroups))
 			for _, capture := range updatedCaptureGroups {
 				if capture.Value == capture.Updated {
 					matchLogger.Debug("Capture group unchanged: %s", utils.LimitString(capture.Value, 50))
 					continue
 				}
 				// Log what changed with context
 				matchLogger.Debug("Capture group %q scheduled for modification: %q → %q",
 					capture.Name, utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
 				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 				commands = append(commands, utils.ReplaceCommand{
 					From: capture.Range[0],
 					To:   capture.Range[1],
 					With: capture.Updated,
 				})
 				matchLogger.Trace("Added replacement command: %+v", commands[len(commands)-1])
 			}
 		} else {
 			matchLogger.Debug("Using full replacement string from Lua: %q", utils.LimitString(replacement, 50))
 			commands = append(commands, utils.ReplaceCommand{
 				From: matchIndices[0],
 				To:   matchIndices[1],
 				With: replacement,
 			})
 			matchLogger.Trace("Added full replacement command: %+v", commands[len(commands)-1])
 		}
 	}
 	processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
 	processRegexLogger.Debug("Generated %d total modifications", len(commands))
 	return commands, nil
 }
 func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
 	deduplicateGroupsLogger := regexLogger.WithPrefix("deduplicateGroups")
 	deduplicateGroupsLogger.Debug("Starting deduplication of capture groups")
 	deduplicateGroupsLogger.Trace("Input capture groups: %v", captureGroups)
 	// Preserve input order and drop any group that overlaps with an already accepted group
 	accepted := make([]*CaptureGroup, 0, len(captureGroups))
 	for _, group := range captureGroups {
 		groupLogger := deduplicateGroupsLogger.WithField("groupName", group.Name).WithField("groupRange", group.Range)
 		groupLogger.Debug("Processing capture group")
 		overlaps := false
 		for _, kept := range accepted {
 			// Overlap if start < keptEnd and end > keptStart (adjacent is allowed)
 			if group.Range[0] < kept.Range[1] && group.Range[1] > kept.Range[0] {
 				overlaps = true
 				break
 			}
 		}
 		if overlaps {
 			groupLogger.Warning("Overlapping capture group detected and skipped.")
 			continue
 		}
-		groupLogger.Debug("Capture group does not overlap with previously accepted groups. Adding.")
+		// Apply the modifications to the original match
-		accepted = append(accepted, group)
+		replacement := match
 		for i := len(modsMap) - 1; i >= 0; i-- {
 			newVal := modsMap[i]
 			// Indices of the group are relative to content
 			// To relate them to match we have to subtract the match start index
 			groupStart := groups[i*2] - matchIndices[0]
 			groupEnd := groups[i*2+1] - matchIndices[0]
 			replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 		}
 		modificationCount++
 		result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
 	}
-	deduplicateGroupsLogger.Debug("Finished deduplication. Original %d groups, %d deduplicated.", len(captureGroups), len(accepted))
+	return result, modificationCount, len(indices), nil
 	deduplicateGroupsLogger.Trace("Deduplicated groups: %v", accepted)
 	return accepted
 }
 // The order of these replaces is important
 // This one handles !num-s inside of named capture groups
 // If it were not here our !num in a named capture group would
 // Expand to another capture group in the capture group
 // We really only want one (our named) capture group
 func resolveRegexPlaceholders(pattern string) string {
 	resolveLogger := regexLogger.WithPrefix("resolveRegexPlaceholders").WithField("originalPattern", utils.LimitString(pattern, 100))
 	resolveLogger.Debug("Resolving regex placeholders in pattern")
 	// Handle special pattern modifications
 	if !strings.HasPrefix(pattern, "(?s)") {
 		pattern = "(?s)" + pattern
 		resolveLogger.Debug("Prepended '(?s)' to pattern for single-line mode")
 	}
 	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
 	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
 		funcLogger := resolveLogger.WithPrefix("namedGroupNumReplace").WithField("match", utils.LimitString(match, 50))
 		funcLogger.Debug("Processing named group !num placeholder")
 		parts := namedGroupNum.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			funcLogger.Warning("Unexpected number of submatches for namedGroupNum: %d. Returning original match.", len(parts))
 			return match
 		}
 		replacement := `-?\d*\.?\d+`
 		funcLogger.Trace("Replacing !num in named group with: %q", replacement)
 		return parts[1] + replacement
 	})
 	resolveLogger.Debug("Handled named group !num placeholders")
 	pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
 	resolveLogger.Debug("Replaced !num with numeric capture group")
 	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
 	resolveLogger.Debug("Replaced !any with non-greedy wildcard")
 	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
 	// !rep(pattern, count) repeats the pattern n times
 	// Inserting !any between each repetition
 	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
 		funcLogger := resolveLogger.WithPrefix("repPatternReplace").WithField("match", utils.LimitString(match, 50))
 		funcLogger.Debug("Processing !rep placeholder")
 		parts := repPattern.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			funcLogger.Warning("Unexpected number of submatches for repPattern: %d. Returning original match.", len(parts))
 			return match
 		}
 		repeatedPattern := parts[1]
 		countStr := parts[2]
 		repetitions, err := strconv.Atoi(countStr)
 		if err != nil {
 			funcLogger.Error("Failed to parse repetition count %q: %v. Returning original match.", countStr, err)
 			return match
 		}
 		var finalReplacement string
 		if repetitions > 0 {
 			finalReplacement = strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
 		} else {
 			finalReplacement = ""
 		}
 		funcLogger.Trace("Replaced !rep with %d repetitions of %q: %q", repetitions, utils.LimitString(repeatedPattern, 30), utils.LimitString(finalReplacement, 100))
 		return finalReplacement
 	})
 	resolveLogger.Debug("Handled !rep placeholders")
 	resolveLogger.Debug("Finished resolving regex placeholders")
 	resolveLogger.Trace("Final resolved pattern: %q", utils.LimitString(pattern, 100))
 	return pattern
 }
 // ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
 func toLua(L *lua.LState, data interface{}) error {
 	toLuaLogger := regexLogger.WithPrefix("toLua")
 	toLuaLogger.Debug("Setting capture groups as Lua variables")
 	captureGroups, ok := data.([]*CaptureGroup)
 	if !ok {
 		toLuaLogger.Error("Invalid data type for toLua. Expected []*CaptureGroup, got %T", data)
 		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
 	}
 	toLuaLogger.Trace("Input capture groups: %v", captureGroups)
 	groupindex := 0
 	for _, capture := range captureGroups {
 		groupLogger := toLuaLogger.WithField("captureGroup", capture.Name).WithField("value", utils.LimitString(capture.Value, 50))
 		groupLogger.Debug("Processing capture group for Lua")
 		if capture.Name == "" {
 			// We don't want to change the name of the capture group
 			// Even if it's empty
 			tempName := fmt.Sprintf("%d", groupindex+1)
 			groupindex++
 			groupLogger.Debug("Unnamed capture group, assigning temporary name: %q", tempName)
 			L.SetGlobal("s"+tempName, lua.LString(capture.Value))
 			groupLogger.Trace("Set Lua global s%s = %q", tempName, capture.Value)
 			val, err := strconv.ParseFloat(capture.Value, 64)
 			if err == nil {
 				L.SetGlobal("v"+tempName, lua.LNumber(val))
 				groupLogger.Trace("Set Lua global v%s = %f", tempName, val)
 			} else {
 				groupLogger.Trace("Value %q is not numeric, skipping v%s assignment", capture.Value, tempName)
 			}
 		} else {
 			val, err := strconv.ParseFloat(capture.Value, 64)
 			if err == nil {
 				L.SetGlobal(capture.Name, lua.LNumber(val))
 				groupLogger.Trace("Set Lua global %s = %f (numeric)", capture.Name, val)
 			} else {
 				L.SetGlobal(capture.Name, lua.LString(capture.Value))
 				groupLogger.Trace("Set Lua global %s = %q (string)", capture.Name, capture.Value)
 			}
 		}
 	}
 	toLuaLogger.Debug("Finished setting capture groups as Lua variables")
 	return nil
 }
 // FromLua implements the Processor interface for RegexProcessor
 func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
 	fromLuaLogger := regexLogger.WithPrefix("fromLua")
 	fromLuaLogger.Debug("Retrieving modifications from Lua for capture groups")
 	fromLuaLogger.Trace("Initial capture groups: %v", captureGroups)
 	captureIndex := 0
 	for _, capture := range captureGroups {
 		groupLogger := fromLuaLogger.WithField("originalCaptureName", capture.Name).WithField("originalValue", utils.LimitString(capture.Value, 50))
 		groupLogger.Debug("Processing capture group to retrieve updated value")
 		if capture.Name == "" {
 			// This case means it was an unnamed capture group originally.
 			// We need to reconstruct the original temporary name to fetch its updated value.
 			// The name will be set to an integer if it was empty, then incremented.
 			// So, we use the captureIndex to get the correct 'vX' and 'sX' variables.
 			tempName := fmt.Sprintf("%d", captureIndex+1)
 			groupLogger.Debug("Retrieving updated value for unnamed group (temp name: %q)", tempName)
 			vVarName := fmt.Sprintf("v%s", tempName)
 			sVarName := fmt.Sprintf("s%s", tempName)
 			captureIndex++
 			vLuaVal := L.GetGlobal(vVarName)
 			sLuaVal := L.GetGlobal(sVarName)
 			groupLogger.Trace("Lua values for unnamed group: v=%v, s=%v", vLuaVal, sLuaVal)
 			if sLuaVal.Type() == lua.LTString {
 				capture.Updated = sLuaVal.String()
 				groupLogger.Trace("Updated value from s%s (string): %q", tempName, capture.Updated)
 			}
 			// Numbers have priority
 			if vLuaVal.Type() == lua.LTNumber {
 				capture.Updated = vLuaVal.String()
 				groupLogger.Trace("Updated value from v%s (numeric): %q", tempName, capture.Updated)
 			}
 		} else {
 			// Easy shit, directly use the named capture group
 			updatedValue := L.GetGlobal(capture.Name)
 			if updatedValue.Type() != lua.LTNil {
 				capture.Updated = updatedValue.String()
 				groupLogger.Trace("Updated value for named group %q: %q", capture.Name, capture.Updated)
 			} else {
 				groupLogger.Debug("Named capture group %q not found in Lua globals or is nil. Keeping original value.", capture.Name)
 				capture.Updated = capture.Value // Keep original if not found or nil
 			}
 		}
 		groupLogger.Debug("Finished processing capture group. Original: %q, Updated: %q", utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
 	}
 	fromLuaLogger.Debug("Finished retrieving modifications from Lua")
 	fromLuaLogger.Trace("Final updated capture groups: %v", captureGroups)
 	return captureGroups, nil
 }
 // estimatePatternComplexity gives a rough estimate of regex pattern complexity
 // This can help identify potentially problematic patterns
 func estimatePatternComplexity(pattern string) int {
 	estimateComplexityLogger := regexLogger.WithPrefix("estimatePatternComplexity").WithField("pattern", utils.LimitString(pattern, 100))
 	estimateComplexityLogger.Debug("Estimating regex pattern complexity")
 	complexity := len(pattern)
 	// Add complexity for potentially expensive operations
 	complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
 	complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
 	complexity += strings.Count(pattern, "[^") * 3  // Negated character class
 	complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
 	complexity += strings.Count(pattern, "(") * 2   // Capture groups
 	complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
 	complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
 	complexity += strings.Count(pattern, "{") * 2   // Counted repetition
 	estimateComplexityLogger.Debug("Estimated pattern complexity: %d", complexity)
 	return complexity
 }
--- a/processor/regex_test.go
+++ b/processor/regex_test.go
--- a/processor/test_helper.go
+++ b/processor/test_helper.go
@@ -1,27 +0,0 @@
 package processor
 import (
 	"io"
 	"os"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 func init() {
 	// Only modify logger in test mode
 	// This checks if we're running under 'go test'
 	if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
 		// Initialize logger with ERROR level for tests
 		// to minimize noise in test output
 		logger.Init(logger.LevelError)
 		// Optionally redirect logger output to discard
 		// This prevents logger output from interfering with test output
 		disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
 		if disableTestLogs {
 			// Create a new logger that writes to nowhere
 			silentLogger := logger.New(io.Discard, "", 0)
 			logger.Default = silentLogger
 		}
 	}
 }
--- a/processor/xml.go
+++ b/processor/xml.go
@@ -0,0 +1,217 @@
 package processor
 import (
 	"fmt"
 	"os"
 	"path/filepath"
 	"strings"
 	"github.com/antchfx/xmlquery"
 	lua "github.com/yuin/gopher-lua"
 )
 // XMLProcessor implements the Processor interface for XML documents
 type XMLProcessor struct{}
 // Process implements the Processor interface for XMLProcessor
 func (p *XMLProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
 	// Read file content
 	fullPath := filepath.Join(".", filename)
 	content, err := os.ReadFile(fullPath)
 	if err != nil {
 		return 0, 0, fmt.Errorf("error reading file: %v", err)
 	}
 	fileContent := string(content)
 	// Process the content
 	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
 	if err != nil {
 		return 0, 0, err
 	}
 	// If we made modifications, save the file
 	if modCount > 0 {
 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
 		if err != nil {
 			return 0, 0, fmt.Errorf("error writing file: %v", err)
 		}
 	}
 	return modCount, matchCount, nil
 }
 // ProcessContent implements the Processor interface for XMLProcessor
 func (p *XMLProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
 	// Parse XML document
 	doc, err := xmlquery.Parse(strings.NewReader(content))
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
 	}
 	// Find nodes matching the XPath pattern
 	nodes, err := xmlquery.QueryAll(doc, pattern)
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
 	}
 	matchCount := len(nodes)
 	if matchCount == 0 {
 		return content, 0, 0, nil
 	}
 	// Initialize Lua
 	L := lua.NewState()
 	defer L.Close()
 	// Load math library
 	L.Push(L.GetGlobal("require"))
 	L.Push(lua.LString("math"))
 	if err := L.PCall(1, 1, nil); err != nil {
 		return content, 0, 0, fmt.Errorf("error loading Lua math library: %v", err)
 	}
 	// Load helper functions
 	if err := InitLuaHelpers(L); err != nil {
 		return content, 0, 0, err
 	}
 	// Apply modifications to each node
 	modCount := 0
 	for _, node := range nodes {
 		// Reset Lua state for each node
 		L.SetGlobal("v1", lua.LNil)
 		L.SetGlobal("s1", lua.LNil)
 		// Get the node value
 		var originalValue string
 		if node.Type == xmlquery.AttributeNode {
 			originalValue = node.InnerText()
 		} else if node.Type == xmlquery.TextNode {
 			originalValue = node.Data
 		} else {
 			originalValue = node.InnerText()
 		}
 		// Convert to Lua variables
 		err = p.ToLua(L, originalValue)
 		if err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
 		}
 		// Execute Lua script
 		if err := L.DoString(luaExpr); err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
 		}
 		// Get modified value
 		result, err := p.FromLua(L)
 		if err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
 		}
 		newValue, ok := result.(string)
 		if !ok {
 			return content, modCount, matchCount, fmt.Errorf("expected string result from Lua, got %T", result)
 		}
 		// Skip if no change
 		if newValue == originalValue {
 			continue
 		}
 		// Apply modification
 		if node.Type == xmlquery.AttributeNode {
 			// For attribute nodes, update the attribute value
 			node.Parent.Attr = append([]xmlquery.Attr{}, node.Parent.Attr...)
 			for i, attr := range node.Parent.Attr {
 				if attr.Name.Local == node.Data {
 					node.Parent.Attr[i].Value = newValue
 					break
 				}
 			}
 		} else if node.Type == xmlquery.TextNode {
 			// For text nodes, update the text content
 			node.Data = newValue
 		} else {
 			// For element nodes, replace inner text
 			// Simple approach: set the InnerText directly if there are no child elements
 			if node.FirstChild == nil || (node.FirstChild != nil && node.FirstChild.Type == xmlquery.TextNode && node.FirstChild.NextSibling == nil) {
 				if node.FirstChild != nil {
 					node.FirstChild.Data = newValue
 				} else {
 					// Create a new text node and add it as the first child
 					textNode := &xmlquery.Node{
 						Type: xmlquery.TextNode,
 						Data: newValue,
 					}
 					node.FirstChild = textNode
 				}
 			} else {
 				// Complex case: node has mixed content or child elements
 				// Replace just the text content while preserving child elements
 				// This is a simplified approach - more complex XML may need more robust handling
 				for child := node.FirstChild; child != nil; child = child.NextSibling {
 					if child.Type == xmlquery.TextNode {
 						child.Data = newValue
 						break // Update only the first text node
 					}
 				}
 			}
 		}
 		modCount++
 	}
 	// Serialize the modified XML document to string
 	if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
 		// If we have an XML declaration, start with it
 		declaration := doc.FirstChild.OutputXML(true)
 		// Remove the firstChild (declaration) before serializing the rest of the document
 		doc.FirstChild = doc.FirstChild.NextSibling
 		return declaration + doc.OutputXML(true), modCount, matchCount, nil
 	}
 	return doc.OutputXML(true), modCount, matchCount, nil
 }
 // ToLua converts XML node values to Lua variables
 func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
 	value, ok := data.(string)
 	if !ok {
 		return fmt.Errorf("expected string value, got %T", data)
 	}
 	// Set as string variable
 	L.SetGlobal("s1", lua.LString(value))
 	// Try to convert to number if possible
 	L.SetGlobal("v1", lua.LNumber(0)) // Default to 0
 	if err := L.DoString(fmt.Sprintf("v1 = tonumber(%q) or 0", value)); err != nil {
 		return fmt.Errorf("error converting value to number: %v", err)
 	}
 	return nil
 }
 // FromLua gets modified values from Lua
 func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	// Check if string variable was modified
 	s1 := L.GetGlobal("s1")
 	if s1 != lua.LNil {
 		if s1Str, ok := s1.(lua.LString); ok {
 			return string(s1Str), nil
 		}
 	}
 	// Check if numeric variable was modified
 	v1 := L.GetGlobal("v1")
 	if v1 != lua.LNil {
 		if v1Num, ok := v1.(lua.LNumber); ok {
 			return fmt.Sprintf("%v", v1Num), nil
 		}
 	}
 	// Default return empty string
 	return "", nil
 }
--- a/processor/xml_test.go
+++ b/processor/xml_test.go
--- a/regression/regression_test.go
+++ b/regression/regression_test.go
@@ -1,137 +0,0 @@
 package regression
 import (
 	"cook/processor"
 	"cook/utils"
 	"os"
 	"path/filepath"
 	"testing"
 )
 func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
 	command := utils.ModifyCommand{
 		Regex:    regex,
 		Lua:      lua,
 		LogLevel: "TRACE",
 	}
 	commands, err := processor.ProcessRegex(content, command, "test")
 	if err != nil {
 		return "", 0, 0, err
 	}
 	result, modifications := utils.ExecuteModifications(commands, content)
 	return result, modifications, len(commands), nil
 }
 func TestTalentsMechanicOutOfRange(t *testing.T) {
 	given := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>`
 	actual := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="30" color="gui.green"/>
      <Replace tag="[duration]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="20"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>`
 	result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	if matches != 4 {
 		t.Errorf("Expected 4 matches, got %d", matches)
 	}
 	if mods != 4 {
 		t.Errorf("Expected 4 modifications, got %d", mods)
 	}
 	if result != actual {
 		t.Errorf("expected %s, got %s", actual, result)
 	}
 }
 func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
 	cwd, err := os.Getwd()
 	if err != nil {
 		t.Fatalf("Error getting current working directory: %v", err)
 	}
 	given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	// We don't really care how many god damn matches there are as long as the result is correct
 	// if matches != 45 {
 	// 	t.Errorf("Expected 45 match, got %d", matches)
 	// }
 	//
 	// if mods != 45 {
 	// 	t.Errorf("Expected 45 modification, got %d", mods)
 	// }
 	if string(result) != string(expected) {
 		t.Errorf("expected %s, got %s", expected, result)
 	}
 }
--- a/release.sh
+++ b/release.sh
@@ -1,49 +0,0 @@
 #!/bin/bash
 echo "Figuring out the tag..."
 TAG=$(git describe --tags --exact-match 2>/dev/null || echo "")
 if [ -z "$TAG" ]; then
  # Get the latest tag
  LATEST_TAG=$(git describe --tags $(git rev-list --tags --max-count=1))
  # Increment the patch version
  IFS='.' read -r -a VERSION_PARTS <<< "$LATEST_TAG"
  VERSION_PARTS[2]=$((VERSION_PARTS[2]+1))
  TAG="${VERSION_PARTS[0]}.${VERSION_PARTS[1]}.${VERSION_PARTS[2]}"
  # Create a new tag
  git tag $TAG
  git push origin $TAG
 fi
 echo "Tag: $TAG"
 echo "Building the thing..."
 go build -o chef.exe .
 go install .
 echo "Creating a release..."
 TOKEN="$GITEA_API_KEY"
 GITEA="https://git.site.quack-lab.dev"
 REPO="dave/BigChef"
 # Create a release
 RELEASE_RESPONSE=$(curl -s -X POST \
  -H "Authorization: token $TOKEN" \
  -H "Accept: application/json" \
  -H "Content-Type: application/json" \
  -d '{
    "tag_name": "'"$TAG"'",
    "name": "'"$TAG"'",
    "draft": false,
    "prerelease": false
  }' \
  $GITEA/api/v1/repos/$REPO/releases)
 # Extract the release ID
 echo $RELEASE_RESPONSE
 RELEASE_ID=$(echo $RELEASE_RESPONSE | awk -F'"id":' '{print $2+0; exit}')
 echo "Release ID: $RELEASE_ID"
 echo "Uploading the things..."
 curl -X POST \
  -H "Authorization: token $TOKEN" \
  -F "attachment=@chef.exe" \
  "$GITEA/api/v1/repos/$REPO/releases/${RELEASE_ID}/assets?name=chef.exe"
 rm chef.exe
--- a/test.xml
+++ b/test.xml
@@ -0,0 +1 @@
 <config><item><value>100</value></item></config>
--- a/test_complex.xml
+++ b/test_complex.xml
@@ -0,0 +1,12 @@
 <config>
  <item>
    <value>75</value>
    <multiplier>2</multiplier>
    <divider>4</divider>
  </item>
  <item>
    <value>150</value>
    <multiplier>3</multiplier>
    <divider>2</divider>
  </item>
 </config>
--- a/test_data.xml
+++ b/test_data.xml
@@ -0,0 +1,37 @@
 <?xml version="1.0" encoding="UTF-8"?>
 <testdata>
    <!-- Numeric values -->
    <item>
        <id>1</id>
        <value>200</value>
        <price>24.99</price>
        <quantity>5</quantity>
    </item>
    <!-- Text values -->
    <item>
        <id>2</id>
        <name>Test Product</name>
        <description>This is a test product description</description>
        <category>Test</category>
    </item>
    <!-- Mixed content -->
    <item>
        <id>3</id>
        <name>Mixed Product</name>
        <price>19.99</price>
        <code>PRD-123</code>
        <tags>sale,discount,new</tags>
    </item>
    <!-- Empty and special values -->
    <item>
        <id>4</id>
        <value></value>
        <specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
        <multiline>Line 1
 Line 2
 Line 3</multiline>
    </item>
 </testdata> 
--- a/testfiles/OutpostItems.xml
+++ b/testfiles/OutpostItems.xml
--- a/testfiles/OutpostItemsExpected.xml
+++ b/testfiles/OutpostItemsExpected.xml
--- a/testfiles/foo/bar/test.xml
+++ b/testfiles/foo/bar/test.xml
@@ -0,0 +1 @@
 <config><item><value>100</value></item></config>
--- a/utils/db.go
+++ b/utils/db.go
@@ -1,155 +0,0 @@
 package utils
 import (
 	"path/filepath"
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	"gorm.io/driver/sqlite"
 	"gorm.io/gorm"
 )
 // dbLogger is a scoped logger for the utils/db package.
 var dbLogger = logger.Default.WithPrefix("utils/db")
 type DB interface {
 	DB() *gorm.DB
 	Raw(sql string, args ...any) *gorm.DB
 	SaveFile(filePath string, fileData []byte) error
 	GetFile(filePath string) ([]byte, error)
 	GetAllFiles() ([]FileSnapshot, error)
 	RemoveAllFiles() error
 }
 type FileSnapshot struct {
 	Date     time.Time `gorm:"primaryKey"`
 	FilePath string    `gorm:"primaryKey"`
 	FileData []byte    `gorm:"type:blob"`
 }
 type DBWrapper struct {
 	db *gorm.DB
 }
 var globalDB *DBWrapper
 func GetDB() (DB, error) {
 	getDBLogger := dbLogger.WithPrefix("GetDB")
 	getDBLogger.Debug("Attempting to get database connection")
 	var err error
 	dbFile := filepath.Join("data.sqlite")
 	getDBLogger.Debug("Opening database file: %q", dbFile)
 	db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
 		// SkipDefaultTransaction: true,
 		PrepareStmt: true,
 		// Logger:      gormlogger.Default.LogMode(gormlogger.Silent),
 	})
 	if err != nil {
 		getDBLogger.Error("Failed to open database: %v", err)
 		return nil, err
 	}
 	getDBLogger.Debug("Database opened successfully, running auto migration")
 	if err := db.AutoMigrate(&FileSnapshot{}); err != nil {
 		getDBLogger.Error("Auto migration failed: %v", err)
 		return nil, err
 	}
 	getDBLogger.Debug("Auto migration completed")
 	globalDB = &DBWrapper{db: db}
 	getDBLogger.Debug("Database wrapper initialized")
 	return globalDB, nil
 }
 // Just a wrapper
 func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
 	rawLogger := dbLogger.WithPrefix("Raw").WithField("sql", sql)
 	rawLogger.Debug("Executing raw SQL query with args: %v", args)
 	return db.db.Raw(sql, args...)
 }
 func (db *DBWrapper) DB() *gorm.DB {
 	dbLogger.WithPrefix("DB").Debug("Returning GORM DB instance")
 	return db.db
 }
 func (db *DBWrapper) FileExists(filePath string) (bool, error) {
 	fileExistsLogger := dbLogger.WithPrefix("FileExists").WithField("filePath", filePath)
 	fileExistsLogger.Debug("Checking if file exists in database")
 	var count int64
 	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
 	if err != nil {
 		fileExistsLogger.Error("Error checking if file exists: %v", err)
 		return false, err
 	}
 	fileExistsLogger.Debug("File exists: %t", count > 0)
 	return count > 0, err
 }
 func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
 	saveFileLogger := dbLogger.WithPrefix("SaveFile").WithField("filePath", filePath)
 	saveFileLogger.Debug("Attempting to save file to database")
 	saveFileLogger.Trace("File data length: %d", len(fileData))
 	exists, err := db.FileExists(filePath)
 	if err != nil {
 		saveFileLogger.Error("Error checking if file exists: %v", err)
 		return err
 	}
 	if exists {
 		saveFileLogger.Debug("File already exists, skipping save")
 		return nil
 	}
 	saveFileLogger.Debug("Creating new file snapshot in database")
 	err = db.db.Create(&FileSnapshot{
 		Date:     time.Now(),
 		FilePath: filePath,
 		FileData: fileData,
 	}).Error
 	if err != nil {
 		saveFileLogger.Error("Failed to create file snapshot: %v", err)
 	} else {
 		saveFileLogger.Debug("File saved successfully to database")
 	}
 	return err
 }
 func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
 	getFileLogger := dbLogger.WithPrefix("GetFile").WithField("filePath", filePath)
 	getFileLogger.Debug("Getting file from database")
 	var fileSnapshot FileSnapshot
 	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
 	if err != nil {
 		getFileLogger.Error("Failed to get file from database: %v", err)
 		return nil, err
 	}
 	getFileLogger.Debug("File found in database")
 	getFileLogger.Trace("Retrieved file data length: %d", len(fileSnapshot.FileData))
 	return fileSnapshot.FileData, nil
 }
 func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
 	getAllFilesLogger := dbLogger.WithPrefix("GetAllFiles")
 	getAllFilesLogger.Debug("Getting all files from database")
 	var fileSnapshots []FileSnapshot
 	err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
 	if err != nil {
 		getAllFilesLogger.Error("Failed to get all files from database: %v", err)
 		return nil, err
 	}
 	getAllFilesLogger.Debug("Found %d files in database", len(fileSnapshots))
 	getAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
 	return fileSnapshots, nil
 }
 func (db *DBWrapper) RemoveAllFiles() error {
 	removeAllFilesLogger := dbLogger.WithPrefix("RemoveAllFiles")
 	removeAllFilesLogger.Debug("Removing all files from database")
 	err := db.db.Exec("DELETE FROM file_snapshots").Error
 	if err != nil {
 		removeAllFilesLogger.Error("Failed to remove all files from database: %v", err)
 	} else {
 		removeAllFilesLogger.Debug("All files removed from database")
 	}
 	return err
 }
--- a/utils/file.go
+++ b/utils/file.go
@@ -1,142 +0,0 @@
 package utils
 import (
 	"os"
 	"path/filepath"
 	"strconv"
 	"strings"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // fileLogger is a scoped logger for the utils/file package.
 var fileLogger = logger.Default.WithPrefix("utils/file")
 func CleanPath(path string) string {
 	cleanPathLogger := fileLogger.WithPrefix("CleanPath")
 	cleanPathLogger.Debug("Cleaning path: %q", path)
 	cleanPathLogger.Trace("Original path: %q", path)
 	path = filepath.Clean(path)
 	path = strings.ReplaceAll(path, "\\", "/")
 	cleanPathLogger.Trace("Cleaned path result: %q", path)
 	return path
 }
 func ToAbs(path string) string {
 	toAbsLogger := fileLogger.WithPrefix("ToAbs")
 	toAbsLogger.Debug("Converting path to absolute: %q", path)
 	toAbsLogger.Trace("Input path: %q", path)
 	if filepath.IsAbs(path) {
 		toAbsLogger.Debug("Path is already absolute, cleaning it.")
 		cleanedPath := CleanPath(path)
 		toAbsLogger.Trace("Already absolute path after cleaning: %q", cleanedPath)
 		return cleanedPath
 	}
 	cwd, err := os.Getwd()
 	if err != nil {
 		toAbsLogger.Error("Error getting current working directory: %v", err)
 		return CleanPath(path)
 	}
 	toAbsLogger.Trace("Current working directory: %q", cwd)
 	cleanedPath := CleanPath(filepath.Join(cwd, path))
 	toAbsLogger.Trace("Converted absolute path result: %q", cleanedPath)
 	return cleanedPath
 }
 // LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	limitStringLogger := fileLogger.WithPrefix("LimitString").WithField("originalLength", len(s)).WithField("maxLength", maxLen)
 	limitStringLogger.Debug("Limiting string length")
 	s = strings.ReplaceAll(s, "\n", "\\n")
 	if len(s) <= maxLen {
 		limitStringLogger.Trace("String length (%d) is within max length (%d), no truncation", len(s), maxLen)
 		return s
 	}
 	limited := s[:maxLen-3] + "..."
 	limitStringLogger.Trace("String truncated from %d to %d characters: %q", len(s), len(limited), limited)
 	return limited
 }
 // StrToFloat converts a string to a float64, returning 0 on error.
 func StrToFloat(s string) float64 {
 	strToFloatLogger := fileLogger.WithPrefix("StrToFloat").WithField("inputString", s)
 	strToFloatLogger.Debug("Attempting to convert string to float")
 	f, err := strconv.ParseFloat(s, 64)
 	if err != nil {
 		strToFloatLogger.Warning("Failed to convert string %q to float, returning 0: %v", s, err)
 		return 0
 	}
 	strToFloatLogger.Trace("Successfully converted %q to float: %f", s, f)
 	return f
 }
 func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
 	resetWhereNecessaryLogger := fileLogger.WithPrefix("ResetWhereNecessary")
 	resetWhereNecessaryLogger.Debug("Starting reset where necessary operation")
 	resetWhereNecessaryLogger.Trace("File-command associations input: %v", associations)
 	dirtyFiles := make(map[string]struct{})
 	for _, association := range associations {
 		resetWhereNecessaryLogger.Debug("Processing association for file: %q", association.File)
 		for _, command := range association.Commands {
 			resetWhereNecessaryLogger.Debug("Checking command %q for reset requirement", command.Name)
 			resetWhereNecessaryLogger.Trace("Command details: %v", command)
 			if command.Reset {
 				resetWhereNecessaryLogger.Debug("Command %q requires reset for file %q, marking as dirty", command.Name, association.File)
 				dirtyFiles[association.File] = struct{}{}
 			}
 		}
 		for _, command := range association.IsolateCommands {
 			resetWhereNecessaryLogger.Debug("Checking isolate command %q for reset requirement", command.Name)
 			resetWhereNecessaryLogger.Trace("Isolate command details: %v", command)
 			if command.Reset {
 				resetWhereNecessaryLogger.Debug("Isolate command %q requires reset for file %q, marking as dirty", command.Name, association.File)
 				dirtyFiles[association.File] = struct{}{}
 			}
 		}
 	}
 	resetWhereNecessaryLogger.Debug("Identified %d files that need to be reset", len(dirtyFiles))
 	resetWhereNecessaryLogger.Trace("Dirty files identified: %v", dirtyFiles)
 	for file := range dirtyFiles {
 		resetWhereNecessaryLogger.Debug("Resetting file %q", file)
 		fileData, err := db.GetFile(file)
 		if err != nil {
 			resetWhereNecessaryLogger.Warning("Failed to get original content for file %q from database: %v", file, err)
 			continue
 		}
 		resetWhereNecessaryLogger.Trace("Retrieved original file data length for %q: %d", file, len(fileData))
 		resetWhereNecessaryLogger.Debug("Writing original content back to file %q", file)
 		err = os.WriteFile(file, fileData, 0644)
 		if err != nil {
 			resetWhereNecessaryLogger.Warning("Failed to write original content back to file %q: %v", file, err)
 			continue
 		}
 		resetWhereNecessaryLogger.Debug("Successfully reset file %q", file)
 	}
 	resetWhereNecessaryLogger.Debug("Finished reset where necessary operation")
 	return nil
 }
 func ResetAllFiles(db DB) error {
 	resetAllFilesLogger := fileLogger.WithPrefix("ResetAllFiles")
 	resetAllFilesLogger.Debug("Starting reset all files operation")
 	fileSnapshots, err := db.GetAllFiles()
 	if err != nil {
 		resetAllFilesLogger.Error("Failed to get all file snapshots from database: %v", err)
 		return err
 	}
 	resetAllFilesLogger.Debug("Found %d files in database to reset", len(fileSnapshots))
 	resetAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
 	for _, fileSnapshot := range fileSnapshots {
 		resetAllFilesLogger.Debug("Resetting file %q", fileSnapshot.FilePath)
 		err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
 		if err != nil {
 			resetAllFilesLogger.Warning("Failed to write file %q to disk: %v", fileSnapshot.FilePath, err)
 			continue
 		}
 		resetAllFilesLogger.Debug("File %q written to disk successfully", fileSnapshot.FilePath)
 	}
 	resetAllFilesLogger.Debug("Finished reset all files operation")
 	return nil
 }
--- a/utils/flags.go
+++ b/utils/flags.go
@@ -1,20 +0,0 @@
 package utils
 import (
 	"flag"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // flagsLogger is a scoped logger for the utils/flags package.
 var flagsLogger = logger.Default.WithPrefix("utils/flags")
 var (
 	ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
 	Filter        = flag.String("f", "", "Filter commands before running them")
 )
 func init() {
 	flagsLogger.Debug("Initializing flags")
 	flagsLogger.Trace("ParallelFiles initial value: %d, Filter initial value: %q", *ParallelFiles, *Filter)
 }
--- a/utils/modifycommand.go
+++ b/utils/modifycommand.go
@@ -1,369 +0,0 @@
 package utils
 import (
 	"fmt"
 	"os"
 	"path/filepath"
 	"strings"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	"github.com/bmatcuk/doublestar/v4"
 	"gopkg.in/yaml.v3"
 )
 // modifyCommandLogger is a scoped logger for the utils/modifycommand package.
 var modifyCommandLogger = logger.Default.WithPrefix("utils/modifycommand")
 type ModifyCommand struct {
 	Name      string                 `yaml:"name,omitempty"`
 	Regex     string                 `yaml:"regex,omitempty"`
 	Regexes   []string               `yaml:"regexes,omitempty"`
 	Lua       string                 `yaml:"lua,omitempty"`
 	Files     []string               `yaml:"files,omitempty"`
 	Reset     bool                   `yaml:"reset,omitempty"`
 	LogLevel  string                 `yaml:"loglevel,omitempty"`
 	Isolate   bool                   `yaml:"isolate,omitempty"`
 	NoDedup   bool                   `yaml:"nodedup,omitempty"`
 	Disabled  bool                   `yaml:"disable,omitempty"`
 	Modifiers map[string]interface{} `yaml:"modifiers,omitempty"`
 }
 type CookFile []ModifyCommand
 func (c *ModifyCommand) Validate() error {
 	validateLogger := modifyCommandLogger.WithPrefix("Validate").WithField("commandName", c.Name)
 	validateLogger.Debug("Validating command")
 	if c.Regex == "" && len(c.Regexes) == 0 {
 		validateLogger.Error("Validation failed: Regex pattern is required")
 		return fmt.Errorf("pattern is required")
 	}
 	if c.Lua == "" {
 		validateLogger.Error("Validation failed: Lua expression is required")
 		return fmt.Errorf("lua expression is required")
 	}
 	if len(c.Files) == 0 {
 		validateLogger.Error("Validation failed: At least one file is required")
 		return fmt.Errorf("at least one file is required")
 	}
 	if c.LogLevel == "" {
 		validateLogger.Debug("LogLevel not specified, defaulting to INFO")
 		c.LogLevel = "INFO"
 	}
 	validateLogger.Debug("Command validated successfully")
 	return nil
 }
 // Ehh.. Not much better... Guess this wasn't the big deal
 var matchesMemoTable map[string]bool = make(map[string]bool)
 func Matches(path string, glob string) (bool, error) {
 	matchesLogger := modifyCommandLogger.WithPrefix("Matches").WithField("path", path).WithField("glob", glob)
 	matchesLogger.Debug("Checking if path matches glob")
 	key := fmt.Sprintf("%s:%s", path, glob)
 	if matches, ok := matchesMemoTable[key]; ok {
 		matchesLogger.Debug("Found match in memo table: %t", matches)
 		return matches, nil
 	}
 	matches, err := doublestar.Match(glob, path)
 	if err != nil {
 		matchesLogger.Error("Failed to match glob: %v", err)
 		return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
 	}
 	matchesMemoTable[key] = matches
 	matchesLogger.Debug("Match result: %t, storing in memo table", matches)
 	return matches, nil
 }
 func SplitPattern(pattern string) (string, string) {
 	splitPatternLogger := modifyCommandLogger.WithPrefix("SplitPattern").WithField("pattern", pattern)
 	splitPatternLogger.Debug("Splitting pattern")
 	splitPatternLogger.Trace("Original pattern: %q", pattern)
 	static, pattern := doublestar.SplitPattern(pattern)
 	cwd, err := os.Getwd()
 	if err != nil {
 		splitPatternLogger.Error("Error getting current working directory: %v", err)
 		return "", ""
 	}
 	splitPatternLogger.Trace("Current working directory: %q", cwd)
 	if static == "" {
 		splitPatternLogger.Debug("Static part is empty, defaulting to current working directory")
 		static = cwd
 	}
 	if !filepath.IsAbs(static) {
 		splitPatternLogger.Debug("Static part is not absolute, joining with current working directory")
 		static = filepath.Join(cwd, static)
 		static = filepath.Clean(static)
 		splitPatternLogger.Trace("Static path after joining and cleaning: %q", static)
 	}
 	static = strings.ReplaceAll(static, "\\", "/")
 	splitPatternLogger.Trace("Final static path: %q, Remaining pattern: %q", static, pattern)
 	return static, pattern
 }
 type FileCommandAssociation struct {
 	File            string
 	IsolateCommands []ModifyCommand
 	Commands        []ModifyCommand
 }
 func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
 	associateFilesLogger := modifyCommandLogger.WithPrefix("AssociateFilesWithCommands")
 	associateFilesLogger.Debug("Associating files with commands")
 	associateFilesLogger.Trace("Input files: %v", files)
 	associateFilesLogger.Trace("Input commands: %v", commands)
 	associationCount := 0
 	fileCommands := make(map[string]FileCommandAssociation)
 	for _, file := range files {
 		file = strings.ReplaceAll(file, "\\", "/")
 		associateFilesLogger.Debug("Processing file: %q", file)
 		fileCommands[file] = FileCommandAssociation{
 			File:            file,
 			IsolateCommands: []ModifyCommand{},
 			Commands:        []ModifyCommand{},
 		}
 		for _, command := range commands {
 			associateFilesLogger.Debug("Checking command %q for file %q", command.Name, file)
 			for _, glob := range command.Files {
 				glob = strings.ReplaceAll(glob, "\\", "/")
 				static, pattern := SplitPattern(glob)
 				associateFilesLogger.Trace("Glob parts for %q → static=%q pattern=%q", glob, static, pattern)
 				// Build absolute path for the current file to compare with static
 				cwd, err := os.Getwd()
 				if err != nil {
 					associateFilesLogger.Warning("Failed to get CWD when matching %q for file %q: %v", glob, file, err)
 					continue
 				}
 				var absFile string
 				if filepath.IsAbs(file) {
 					absFile = filepath.Clean(file)
 				} else {
 					absFile = filepath.Clean(filepath.Join(cwd, file))
 				}
 				absFile = strings.ReplaceAll(absFile, "\\", "/")
 				associateFilesLogger.Trace("Absolute file path resolved for matching: %q", absFile)
 				// Only match if the file is under the static root
 				if !(strings.HasPrefix(absFile, static+"/") || absFile == static) {
 					associateFilesLogger.Trace("Skipping glob %q for file %q because file is outside static root %q", glob, file, static)
 					continue
 				}
 				patternFile := strings.TrimPrefix(absFile, static+`/`)
 				associateFilesLogger.Trace("Pattern-relative path used for match: %q", patternFile)
 				matches, err := Matches(patternFile, pattern)
 				if err != nil {
 					associateFilesLogger.Warning("Failed to match glob %q with file %q: %v", glob, file, err)
 					continue
 				}
 				if matches {
 					associateFilesLogger.Debug("File %q matches glob %q. Associating with command %q", file, glob, command.Name)
 					association := fileCommands[file]
 					if command.Isolate {
 						associateFilesLogger.Debug("Command %q is an isolate command, adding to isolate list", command.Name)
 						association.IsolateCommands = append(association.IsolateCommands, command)
 					} else {
 						associateFilesLogger.Debug("Command %q is a regular command, adding to regular list", command.Name)
 						association.Commands = append(association.Commands, command)
 					}
 					fileCommands[file] = association
 					associationCount++
 				} else {
 					associateFilesLogger.Trace("File %q did not match glob %q (pattern=%q, rel=%q)", file, glob, pattern, patternFile)
 				}
 			}
 		}
 		currentFileCommands := fileCommands[file]
 		associateFilesLogger.Debug("Finished processing file %q. Found %d regular commands and %d isolate commands", file, len(currentFileCommands.Commands), len(currentFileCommands.IsolateCommands))
 		associateFilesLogger.Trace("Commands for file %q: %v", file, currentFileCommands.Commands)
 		associateFilesLogger.Trace("Isolate commands for file %q: %v", file, currentFileCommands.IsolateCommands)
 	}
 	associateFilesLogger.Info("Completed association. Found %d total associations for %d files and %d commands", associationCount, len(files), len(commands))
 	return fileCommands, nil
 }
 func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
 	aggregateGlobsLogger := modifyCommandLogger.WithPrefix("AggregateGlobs")
 	aggregateGlobsLogger.Debug("Aggregating glob patterns from commands")
 	aggregateGlobsLogger.Trace("Input commands for aggregation: %v", commands)
 	globs := make(map[string]struct{})
 	for _, command := range commands {
 		aggregateGlobsLogger.Debug("Processing command %q for glob patterns", command.Name)
 		for _, glob := range command.Files {
 			resolvedGlob := strings.Replace(glob, "~", os.Getenv("HOME"), 1)
 			resolvedGlob = strings.ReplaceAll(resolvedGlob, "\\", "/")
 			aggregateGlobsLogger.Trace("Adding glob: %q (resolved to %q)", glob, resolvedGlob)
 			globs[resolvedGlob] = struct{}{}
 		}
 	}
 	aggregateGlobsLogger.Debug("Finished aggregating globs. Found %d unique glob patterns", len(globs))
 	aggregateGlobsLogger.Trace("Aggregated unique globs: %v", globs)
 	return globs
 }
 func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
 	expandGlobsLogger := modifyCommandLogger.WithPrefix("ExpandGLobs")
 	expandGlobsLogger.Debug("Expanding glob patterns to actual files")
 	expandGlobsLogger.Trace("Input patterns for expansion: %v", patterns)
 	var files []string
 	filesMap := make(map[string]bool)
 	cwd, err := os.Getwd()
 	if err != nil {
 		expandGlobsLogger.Error("Failed to get current working directory: %v", err)
 		return nil, fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	expandGlobsLogger.Debug("Current working directory: %q", cwd)
 	for pattern := range patterns {
 		expandGlobsLogger.Debug("Processing glob pattern: %q", pattern)
 		static, pattern := SplitPattern(pattern)
 		matches, err := doublestar.Glob(os.DirFS(static), pattern)
 		if err != nil {
 			expandGlobsLogger.Warning("Error expanding glob %q in %q: %v", pattern, static, err)
 			continue
 		}
 		expandGlobsLogger.Debug("Found %d matches for pattern %q", len(matches), pattern)
 		expandGlobsLogger.Trace("Raw matches for pattern %q: %v", pattern, matches)
 		for _, m := range matches {
 			m = filepath.Join(static, m)
 			info, err := os.Stat(m)
 			if err != nil {
 				expandGlobsLogger.Warning("Error getting file info for %q: %v", m, err)
 				continue
 			}
 			if !info.IsDir() && !filesMap[m] {
 				expandGlobsLogger.Trace("Adding unique file to list: %q", m)
 				filesMap[m], files = true, append(files, m)
 			}
 		}
 	}
 	if len(files) > 0 {
 		expandGlobsLogger.Debug("Finished expanding globs. Found %d unique files to process", len(files))
 		expandGlobsLogger.Trace("Unique files to process: %v", files)
 	} else {
 		expandGlobsLogger.Warning("No files found after expanding glob patterns.")
 	}
 	return files, nil
 }
 func LoadCommands(args []string) ([]ModifyCommand, error) {
 	loadCommandsLogger := modifyCommandLogger.WithPrefix("LoadCommands")
 	loadCommandsLogger.Debug("Loading commands from arguments (cook files or direct patterns)")
 	loadCommandsLogger.Trace("Input arguments: %v", args)
 	commands := []ModifyCommand{}
 	for _, arg := range args {
 		loadCommandsLogger.Debug("Processing argument for commands: %q", arg)
 		newCommands, err := LoadCommandsFromCookFiles(arg)
 		if err != nil {
 			loadCommandsLogger.Error("Failed to load commands from argument %q: %v", arg, err)
 			return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
 		}
 		loadCommandsLogger.Debug("Successfully loaded %d commands from %q", len(newCommands), arg)
 		for _, cmd := range newCommands {
 			if cmd.Disabled {
 				loadCommandsLogger.Debug("Skipping disabled command: %q", cmd.Name)
 				continue
 			}
 			commands = append(commands, cmd)
 			loadCommandsLogger.Trace("Added command %q. Current total commands: %d", cmd.Name, len(commands))
 		}
 	}
 	loadCommandsLogger.Info("Finished loading commands. Total %d commands loaded", len(commands))
 	return commands, nil
 }
 func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
 	loadCookFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFiles").WithField("pattern", pattern)
 	loadCookFilesLogger.Debug("Loading commands from cook files based on pattern")
 	loadCookFilesLogger.Trace("Input pattern: %q", pattern)
 	static, pattern := SplitPattern(pattern)
 	commands := []ModifyCommand{}
 	cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
 	if err != nil {
 		loadCookFilesLogger.Error("Failed to glob cook files for pattern %q: %v", pattern, err)
 		return nil, fmt.Errorf("failed to glob cook files: %w", err)
 	}
 	loadCookFilesLogger.Debug("Found %d cook files for pattern %q", len(cookFiles), pattern)
 	loadCookFilesLogger.Trace("Cook files found: %v", cookFiles)
 	for _, cookFile := range cookFiles {
 		cookFile = filepath.Join(static, cookFile)
 		cookFile = filepath.Clean(cookFile)
 		cookFile = strings.ReplaceAll(cookFile, "\\", "/")
 		loadCookFilesLogger.Debug("Loading commands from individual cook file: %q", cookFile)
 		cookFileData, err := os.ReadFile(cookFile)
 		if err != nil {
 			loadCookFilesLogger.Error("Failed to read cook file %q: %v", cookFile, err)
 			return nil, fmt.Errorf("failed to read cook file: %w", err)
 		}
 		loadCookFilesLogger.Trace("Read %d bytes from cook file %q", len(cookFileData), cookFile)
 		newCommands, err := LoadCommandsFromCookFile(cookFileData)
 		if err != nil {
 			loadCookFilesLogger.Error("Failed to load commands from cook file data for %q: %v", cookFile, err)
 			return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
 		}
 		commands = append(commands, newCommands...)
 		loadCookFilesLogger.Debug("Added %d commands from cook file %q. Total commands now: %d", len(newCommands), cookFile, len(commands))
 	}
 	loadCookFilesLogger.Debug("Finished loading commands from cook files. Total %d commands", len(commands))
 	return commands, nil
 }
 func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
 	loadCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFile")
 	loadCommandLogger.Debug("Unmarshaling commands from cook file data")
 	loadCommandLogger.Trace("Cook file data length: %d", len(cookFileData))
 	commands := []ModifyCommand{}
 	err := yaml.Unmarshal(cookFileData, &commands)
 	if err != nil {
 		loadCommandLogger.Error("Failed to unmarshal cook file data: %v", err)
 		return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
 	}
 	loadCommandLogger.Debug("Successfully unmarshaled %d commands", len(commands))
 	loadCommandLogger.Trace("Unmarshaled commands: %v", commands)
 	return commands, nil
 }
 // CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
 func CountGlobsBeforeDedup(commands []ModifyCommand) int {
 	countGlobsLogger := modifyCommandLogger.WithPrefix("CountGlobsBeforeDedup")
 	countGlobsLogger.Debug("Counting glob patterns before deduplication")
 	count := 0
 	for _, cmd := range commands {
 		countGlobsLogger.Trace("Processing command %q, adding %d globs", cmd.Name, len(cmd.Files))
 		count += len(cmd.Files)
 	}
 	countGlobsLogger.Debug("Total glob patterns before deduplication: %d", count)
 	return count
 }
 func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
 	filterCommandsLogger := modifyCommandLogger.WithPrefix("FilterCommands").WithField("filter", filter)
 	filterCommandsLogger.Debug("Filtering commands")
 	filterCommandsLogger.Trace("Input commands: %v", commands)
 	filteredCommands := []ModifyCommand{}
 	filters := strings.Split(filter, ",")
 	filterCommandsLogger.Trace("Split filters: %v", filters)
 	for _, cmd := range commands {
 		filterCommandsLogger.Debug("Checking command %q against filters", cmd.Name)
 		for _, f := range filters {
 			if strings.Contains(cmd.Name, f) {
 				filterCommandsLogger.Debug("Command %q matches filter %q, adding to filtered list", cmd.Name, f)
 				filteredCommands = append(filteredCommands, cmd)
 				break // Command matches, no need to check other filters
 			}
 		}
 	}
 	filterCommandsLogger.Debug("Finished filtering commands. Found %d filtered commands", len(filteredCommands))
 	filterCommandsLogger.Trace("Filtered commands: %v", filteredCommands)
 	return filteredCommands
 }
--- a/utils/modifycommand_test.go
+++ b/utils/modifycommand_test.go
--- a/utils/replacecommand.go
+++ b/utils/replacecommand.go
@@ -1,79 +0,0 @@
 package utils
 import (
 	"fmt"
 	"sort"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // replaceCommandLogger is a scoped logger for the utils/replacecommand package.
 var replaceCommandLogger = logger.Default.WithPrefix("utils/replacecommand")
 type ReplaceCommand struct {
 	From int
 	To   int
 	With string
 }
 func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
 	executeModificationsLogger := replaceCommandLogger.WithPrefix("ExecuteModifications")
 	executeModificationsLogger.Debug("Executing a batch of text modifications")
 	executeModificationsLogger.Trace("Number of modifications: %d, Original file data length: %d", len(modifications), len(fileData))
 	var err error
 	sort.Slice(modifications, func(i, j int) bool {
 		return modifications[i].From > modifications[j].From
 	})
 	executeModificationsLogger.Debug("Modifications sorted in reverse order for safe replacement")
 	executeModificationsLogger.Trace("Sorted modifications: %v", modifications)
 	executed := 0
 	for idx, modification := range modifications {
 		executeModificationsLogger.Debug("Applying modification %d/%d", idx+1, len(modifications))
 		executeModificationsLogger.Trace("Current modification details: From=%d, To=%d, With=%q", modification.From, modification.To, modification.With)
 		fileData, err = modification.Execute(fileData)
 		if err != nil {
 			executeModificationsLogger.Error("Failed to execute replacement for modification %+v: %v", modification, err)
 			continue
 		}
 		executed++
 		executeModificationsLogger.Trace("File data length after modification: %d", len(fileData))
 	}
 	executeModificationsLogger.Info("Successfully applied %d text replacements", executed)
 	return fileData, executed
 }
 func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
 	executeLogger := replaceCommandLogger.WithPrefix("Execute").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With))
 	executeLogger.Debug("Attempting to execute single replacement")
 	err := m.Validate(len(fileDataStr))
 	if err != nil {
 		executeLogger.Error("Failed to validate modification: %v", err)
 		return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
 	}
 	executeLogger.Trace("Applying replacement: fileDataStr[:%d] + %q + fileDataStr[%d:]", m.From, m.With, m.To)
 	result := fileDataStr[:m.From] + m.With + fileDataStr[m.To:]
 	executeLogger.Trace("Replacement executed. Result length: %d", len(result))
 	return result, nil
 }
 func (m *ReplaceCommand) Validate(maxsize int) error {
 	validateLogger := replaceCommandLogger.WithPrefix("Validate").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With)).WithField("maxSize", maxsize)
 	validateLogger.Debug("Validating replacement command against max size")
 	if m.To < m.From {
 		validateLogger.Error("Validation failed: 'To' (%d) is less than 'From' (%d)", m.To, m.From)
 		return fmt.Errorf("command to is less than from: %v", m)
 	}
 	if m.From > maxsize || m.To > maxsize {
 		validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is greater than max size (%d)", m.From, m.To, maxsize)
 		return fmt.Errorf("command from or to is greater than replacement length: %v", m)
 	}
 	if m.From < 0 || m.To < 0 {
 		validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is less than 0", m.From, m.To)
 		return fmt.Errorf("command from or to is less than 0: %v", m)
 	}
 	validateLogger.Debug("Modification command validated successfully")
 	return nil
 }
--- a/utils/replacecommand_test.go
+++ b/utils/replacecommand_test.go
@@ -1,504 +0,0 @@
 package utils
 import (
 	"testing"
 	"github.com/stretchr/testify/assert"
 )
 func TestReplaceCommandExecute(t *testing.T) {
 	tests := []struct {
 		name        string
 		input       string
 		command     ReplaceCommand
 		expected    string
 		shouldError bool
 	}{
 		{
 			name:        "Simple replacement",
 			input:       "This is a test string",
 			command:     ReplaceCommand{From: 5, To: 7, With: "was"},
 			expected:    "This was a test string",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at beginning",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 5, With: "Hi"},
 			expected:    "Hi world",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at end",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 6, To: 11, With: "everyone"},
 			expected:    "Hello everyone",
 			shouldError: false,
 		},
 		{
 			name:        "Replace entire string",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
 			expected:    "Goodbye!",
 			shouldError: false,
 		},
 		{
 			name:        "Error: From > To",
 			input:       "Test string",
 			command:     ReplaceCommand{From: 7, To: 5, With: "fail"},
 			expected:    "Test string",
 			shouldError: true,
 		},
 		{
 			name:        "Error: From > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 10, To: 12, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 		{
 			name:        "Error: To > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 2, To: 10, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			result, err := tc.command.Execute(tc.input)
 			if tc.shouldError {
 				if err == nil {
 					t.Errorf("Expected an error for command %+v but got none", tc.command)
 				}
 			} else {
 				if err != nil {
 					t.Errorf("Unexpected error: %v", err)
 				}
 				if result != tc.expected {
 					t.Errorf("Expected %q, got %q", tc.expected, result)
 				}
 			}
 		})
 	}
 }
 func TestExecuteModifications(t *testing.T) {
 	tests := []struct {
 		name          string
 		input         string
 		modifications []ReplaceCommand
 		expected      string
 		expectedCount int
 	}{
 		{
 			name:  "Single modification",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 			},
 			expected:      "Hi world",
 			expectedCount: 1,
 		},
 		{
 			name:  "Multiple modifications",
 			input: "This is a test string",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 4, With: "That"},
 				{From: 8, To: 14, With: "sample"},
 			},
 			expected:      "That is sample string",
 			expectedCount: 2,
 		},
 		{
 			name:  "Overlapping modifications",
 			input: "ABCDEF",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 3, With: "123"}, // ABC -> 123
 				{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
 			},
 			// The actual behavior with the current implementation
 			expected:      "123yzF",
 			expectedCount: 2,
 		},
 		{
 			name:  "Sequential modifications",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 				{From: 5, To: 6, With: ""}, // Remove the space
 				{From: 6, To: 11, With: "everyone"},
 			},
 			expected:      "Hieveryone",
 			expectedCount: 3,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			// Make a copy of the modifications to avoid modifying the test case
 			mods := make([]ReplaceCommand, len(tc.modifications))
 			copy(mods, tc.modifications)
 			result, count := ExecuteModifications(mods, tc.input)
 			if count != tc.expectedCount {
 				t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
 			}
 			if result != tc.expected {
 				t.Errorf("Expected %q, got %q", tc.expected, result)
 			}
 		})
 	}
 }
 func TestReverseOrderExecution(t *testing.T) {
 	// This test verifies the current behavior of modification application
 	input := "Original text with multiple sections"
 	// Modifications in specific positions
 	modifications := []ReplaceCommand{
 		{From: 0, To: 8, With: "Modified"},  // Original -> Modified
 		{From: 9, To: 13, With: "document"}, // text -> document
 		{From: 14, To: 22, With: "without"}, // with -> without
 		{From: 23, To: 31, With: "any"},     // multiple -> any
 	}
 	// The actual current behavior of our implementation
 	expected := "Modified document withouttanytions"
 	result, count := ExecuteModifications(modifications, input)
 	if count != 4 {
 		t.Errorf("Expected 4 modifications, got %d", count)
 	}
 	if result != expected {
 		t.Errorf("Expected %q, got %q", expected, result)
 	}
 }
 // Replace text in the middle of a string with new content
 func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello replaced, how are you?", result)
 }
 // Replace with empty string (deletion)
 func TestReplaceCommandExecute_DeletesText(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello , how are you?", result)
 }
 // Replace with longer string than original segment
 func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "longerreplacement",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello longerreplacement, how are you?", result)
 }
 // From and To values are the same (zero-length replacement)
 func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   5,
 		With: "inserted",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Helloinserted world", result)
 }
 // From value is greater than To value
 func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 10,
 		To:   5,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // From or To values exceed string length
 func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   50, // Exceeds the length of the fileContent
 		With: "replaced",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world", result)
 }
 // From or To values are negative
 func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: -1,
 		To:   10,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // Modifications are applied in reverse order (from highest to lowest 'From' value)
 func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 4, With: "That"},
 		{From: 10, To: 14, With: "sample"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a sample string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // One or more modifications fail but others succeed
 func TestExecuteModificationsWithPartialFailures(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	// Create a custom ReplaceCommand implementation that will fail
 	failingCommand := ReplaceCommand{
 		From: 15,
 		To:   10, // Invalid range (To < From) to cause failure
 		With: "will fail",
 	}
 	// Valid commands
 	validCommand1 := ReplaceCommand{
 		From: 0,
 		To:   4,
 		With: "That",
 	}
 	validCommand2 := ReplaceCommand{
 		From: 26,
 		To:   38,
 		With: "modifications",
 	}
 	modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a test string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	// Only 2 out of 3 modifications should succeed
 	if executed != 2 {
 		t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
 	}
 }
 // All valid modifications are executed and the modified string is returned
 func TestExecuteModificationsAllValid(t *testing.T) {
 	// Setup test data
 	fileData := "Hello world, this is a test"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 5, With: "Hi"},
 		{From: 18, To: 20, With: "was"},
 		{From: 21, To: 27, With: "an example"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "Hi world, this was an example"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // The count of successfully executed modifications is returned
 func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
 	// Setup test data
 	fileData := "Initial text for testing"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 7, With: "Final"},
 		{From: 12, To: 16, With: "example"},
 		{From: 17, To: 24, With: "process"},
 	}
 	// Execute the function
 	_, executed := ExecuteModifications(modifications, fileData)
 	// Verify the count of executed modifications
 	expectedExecuted := 3
 	if executed != expectedExecuted {
 		t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
 	}
 }
 // Empty modifications list returns the original string with zero executed count
 func TestExecuteModificationsWithEmptyList(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	if result != fileData {
 		t.Errorf("Expected result to be %q, but got %q", fileData, result)
 	}
 	if executed != 0 {
 		t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications with identical 'From' values
 func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 10, To: 14, With: "sample"},
 		{From: 10, To: 14, With: "example"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	// Yes, it's mangled, yes, it's intentional
 	// Every subsequent command works with the modified contents of the previous command
 	// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
 	// So we prepend "example" and end up with "examplele"
 	// Whether sample or example goes first here is irrelevant to us
 	// But it just so happens that sample goes first, so we end up with "examplele"
 	expectedResult := "This is a examplele string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications that would affect each other if not sorted properly
 func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
 	// Setup test data
 	fileData := "The quick brown fox jumps over the lazy dog"
 	modifications := []ReplaceCommand{
 		{From: 4, To: 9, With: "slow"},
 		{From: 10, To: 15, With: "red"},
 		{From: 16, To: 19, With: "cat"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "The slow red cat jumps over the lazy dog"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
Author	SHA1	Message	Date
PhatPhuckDave	f64a71185e	Improve error handling across the board	2025-03-25 17:23:56 +01:00
PhatPhuckDave	1f66af6d5b	Add path data to the selected nodes for reconstruction via set	2025-03-25 17:10:15 +01:00
PhatPhuckDave	2b8d86ca87	Implement Set and SetAll (and Get)	2025-03-25 15:44:27 +01:00
PhatPhuckDave	08d5d707d0	Fix up the recursive descent Again I guess?	2025-03-25 15:18:04 +01:00
PhatPhuckDave	d904f8ec13	Fix up the recursive descent	2025-03-25 11:57:46 +01:00
PhatPhuckDave	074296c478	Fix up parser	2025-03-25 10:38:12 +01:00
PhatPhuckDave	438ad0391c	Begin to implement jsonpath	2025-03-25 00:41:44 +01:00
PhatPhuckDave	c168553022	Begin to rework the json parsing	2025-03-25 00:41:36 +01:00
PhatPhuckDave	0422e6c143	Implement a generic translator between lua and go tables (maps)	2025-03-24 22:28:18 +01:00
PhatPhuckDave	583b2169dc	Rework regex processor to be more betterer	2025-03-24 22:28:18 +01:00
PhatPhuckDave	56ac0c7101	Fix up lua variable writing and reading for regex	2025-03-24 20:49:39 +01:00
PhatPhuckDave	1ff139ef15	Fix reading lua variables	2025-03-24 19:59:56 +01:00
PhatPhuckDave	1d39b5287f	Clean up after claude	2025-03-24 18:48:43 +01:00
PhatPhuckDave	4f70eaa329	Refactor everything to processors and implement json and xml processors such as they are	2025-03-24 16:06:56 +01:00
PhatPhuckDave	a796e8cac5	Add xpath dependencies	2025-03-24 15:44:48 +01:00
		`@@ -0,0 +1 @@`
							`<config><item><value>100</value></item></config>`