Use diffs for tests

Fix broken test introduced in previous commit
Add broken test
2025-08-22 10:10:37 +02:00 · 2025-08-22 10:04:11 +02:00 · 2025-08-22 09:53:00 +02:00 · 2025-08-22 00:10:46 +02:00 · 2025-08-22 00:05:22 +02:00 · 2025-08-21 23:56:05 +02:00
34 changed files with 10057 additions and 2316 deletions
--- a/.gitignore
+++ b/.gitignore
@@ -1 +1,4 @@
 *.exe
 .qodo
 *.sqlite
 testfiles
--- a/.vscode/launch.json
+++ b/.vscode/launch.json
@@ -5,12 +5,112 @@
 	"version": "0.2.0",
 	"configurations": [
 		{
-			"name": "Launch Package",
+			"name": "Launch Package (Barotrauma)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
-			"program": "${fileDirname}",
+			"program": "${workspaceFolder}",
-			"args": []
+			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Payday 2)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
 			"args": [
 				"-loglevel",
 				"trace",
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Barotrauma cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"cookassistant.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Quasimorph cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
 			"args": [
 				"cook.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Rimworld cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
 			"args": [
 				"cookVehicles.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Workspace)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"args": [
 				"tester.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Avorion)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
 			"args": [
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Minecraft)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Minecraft",
 			"args": [
 				"cook_tacz.yml",
 			]
 		},
 		{
 			"name": "Launch Package (ICARUS)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-ICARUS/Icarus/Saved/IME3/Mods",
 			"args": [
 				"-loglevel",
 				"trace",
 				"cook_processorrecipes.yml",
 			]
 		}
 	]
 }
--- a/README.md
+++ b/README.md
@@ -0,0 +1,116 @@
 # Big Chef
 A Go-based tool for modifying XML, JSON, and text documents using XPath/JSONPath/Regex expressions and Lua transformations.
 ## Features
 - **Multi-Format Processing**:
  - XML (XPath)
  - JSON (JSONPath) 
  - Text (Regex)
 - **Node Value Modification**: Update text values in XML elements, JSON properties or text matches
 - **Attribute Manipulation**: Modify XML attributes, JSON object keys or regex capture groups
 - **Conditional Logic**: Apply transformations based on document content
 - **Complex Operations**: 
  - Mathematical calculations
  - String manipulations
  - Date conversions
  - Structural changes
  - Whole ass Lua environment
 - **Error Handling**: Comprehensive error detection for:
  - Invalid XML/JSON
  - Malformed XPath/JSONPath
  - Lua syntax errors
 ## Usage Examples
 ### 1. Basic field modification
 ```xml
 <!-- Input -->
 <price>44.95</price>
 <!-- Command -->
 chef -xml "//price" "v=v*2" input.xml
 <!-- Output -->
 <price>89.9</price>
 ```
 ### 2. Supports glob patterns
 ```xml
 chef -xml "//price" "v=v*2" data/**.xml
 ```
 ### 3. Attribute Update
 ```xml
 <!-- Input -->
 <item price="10.50"/>
 <!-- Command -->
 chef -xml "//item/@price" "v=v*2" input.xml
 <!-- Output --> 
 <item price="21"/>
 ```
 ### 3. JSONPath Transformation
 ```json
 // Input
 {
  "products": [
    {"name": "Widget", "price": 19.99},
    {"name": "Gadget", "price": 29.99}
  ]
 }
 // Command
 chef -json "$.products[*].price" "v=v*0.75" input.json
 // Output
 {
  "products": [
    {"name": "Widget", "price": 14.99},
    {"name": "Gadget", "price": 22.49}
  ]
 }
 ```
 ### 4. Regex Text Replacement
 Regex works slightly differently, up to 12 match groups are provided as v1..v12 and s1..s12 for numbers and strings respectively.
 A special shorthand "!num" is also provided that simply expands to `(\d*\.?\d+)`.
 ```xml
 <!-- Input -->
 <description>Price: $15.00 Special Offer</description>
 <!-- Command -->
 chef "Price: $!num Special Offer" "v1 = v1 * 0.92" input.xml
 <!-- Output -->
 <description>Price: $13.80 Special Offer</description>
 ```
 ### 5. Conditional Transformation
 ```xml
 <!-- Input -->
 <item stock="5" price="10.00"/>
 <!-- Command -->
 chef -xml "//item" "if tonumber(v.stock) > 0 then v.price = v.price * 0.8 end" input.xml
 <!-- Output -->
 <item stock="5" price="8.00"/>
 ```
 ## Installation
 ```bash
 go build -o chef main.go
 ```
 ```bash
 # Process XML file
 ./chef -xml "//price" "v=v*1.2" input.xml
 # Process JSON file 
 ./chef -json "$.prices[*]" "v=v*0.9" input.json
 ```
--- a/TalentsMechanic.xml
+++ b/TalentsMechanic.xml
@@ -1,651 +0,0 @@
 <?xml version="1.0" encoding="utf-8"?>
 <Talents>
  <Talent identifier="powerarmor">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.powerarmor">
      <Replace tag="[bonusmovement]" value="25" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHasItem tags="deepdivinglarge" />
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
      </Abilities>
    </AbilityGroupInterval>
    <AddedRecipe itemidentifier="exosuit"/>
  </Talent>
  <Talent identifier="foolhardy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="foolhardy" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="berserker">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="berserker" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="mudraptorwrestler">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.mudraptorwrestler">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattypeself">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData weapontype="NoWeapon,Melee" />
        <AbilityConditionCharacter>
          <Conditional group="eq mudraptor" />
        </AbilityConditionCharacter>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="heavylifting">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.heavylifting">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHoldingItem tags="alienartifact,crate"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="iamthatguy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.iamthatguy">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.skillbonus">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
      <Abilities>
        <CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="heavywrench"/>
  </Talent>
  <Talent identifier="robotics">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.robotics"/>
    <Description tag="talentdescription.roboticsreminder">
      <Replace tag="[amount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="defensebotspawner"/>
    <AddedRecipe itemidentifier="defensebotammobox"/>
  </Talent>
  <Talent identifier="ironstorm">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ironstorm">
      <Replace tag="[chance]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="scrapcannon"/>
  </Talent>
  <Talent identifier="residualwaste">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.residualwaste">
      <Replace tag="[chance]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.2"/>
        <!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
        <AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="massproduction">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.massproduction">
      <Replace tag="[chance]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityRemoveRandomIngredient>
          <AbilityConditionItem category="Material"/>
        </CharacterAbilityRemoveRandomIngredient>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="toolmaintenance">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.toolmaintenance">
      <Replace tag="[amount]" value="1" color="gui.green"/>
    </Description>
    <!-- Give once when unlocking the talent -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupEffect>
    <!-- Give every 60 seconds for late comers -->
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="miner">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
    <Description tag="talentdescription.miner">
      <Replace tag="[probability]" value="320" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.gainoredetachspeed">
      <Replace tag="[amount]" value="1600" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomchance="12.8"/>
        <AbilityConditionItem tags="ore"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="retrofit">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.retrofit" />
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ironman">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="ironhelmet"/>
    <AddedRecipe itemidentifier="makeshiftarmor"/>
  </Talent>
  <Talent identifier="oiledmachinery">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.oiledmachinery">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="pumpndump">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.pumpndump">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <conditions>
        <AbilityConditionItem tags="pump"/>
      </conditions>
      <Abilities>
        <CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ballastdenizen">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ballastdenizen">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="engineengineer">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.engineengineer">
      <Replace tag="[amount]" value="2.5" color="gui.green"/>
      <Replace tag="[max]" value="5" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="1" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="2" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="3" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="5" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="6" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="7" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel minlevel="8" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="multifunctional">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.multifunctional">
      <Replace tag="[powerincrease]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="wrenchitem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="crowbaritem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="salvagecrew">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.bonusxponmission">
      <Replace tag="[xpbonus]" value="30" color="gui.green"/>
      <Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.salvagecrew">
      <Replace tag="[swimbonus]" value="50" color="gui.green"/>
      <Replace tag="[resistanceamount]" value="10" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
      <Conditions>
        <AbilityConditionMission missiontype="Salvage"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="1.3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionInSubmarine submarinetype="Wreck" />
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="This" disabledeltatime="true">
              <Affliction identifier="salvagecrew" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.machinemaniac">
      <Replace tag="[bonus]" value="80" color="gui.green"/>
      <Replace tag="[amount]" value="3" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.30">
      <Replace tag="[requirement]" value="12" color="gui.green"/>
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
      <Replace tag="[xpamount]" value="500" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.50">
      <Replace tag="[requirement]" value="20" color="gui.green"/>
      <Replace tag="[level]" value="1" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.100">
      <Replace tag="[requirement]" value="40" color="gui.green"/>
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <!-- Give the player stats that tracks if the rewards should be given -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveExperience amount="2000"/>
        <CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="tinkerer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.increasemaxrepairmechanical">
      <Replace tag="[percentage]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="modularrepairs">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.freeupgrade">
      <Replace tag="[level]" value="1" color="gui.green"/>
      <Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="repairpack"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="hullfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="25" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="fixfoamgrenade"/>
    <AddedRecipe itemidentifier="handheldstatusmonitor"/>
  </Talent>
  <Talent identifier="letitdrain">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.letitdrain"/>
    <Description tag="talentdescription.letitdrainreminder">
      <Replace tag="[itemcount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="portablepump"/>
  </Talent>
  <Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="scrapsavant">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
    <Description tag="talentdescription.doublescrapoutput" />
    <Description tag="talentdescription.findadditionalscrap">
      <Replace tag="[probability]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionItem tags="scrap"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
      <Conditions>
        <AbilityConditionItemInSubmarine submarinetype="Wreck"/>
        <AbilityConditionItem tags="container"/>
      </Conditions>
      <Abilities>
        <CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
          <StatusEffects>
            <StatusEffect type="OnAbility" target="UseTarget" >
              <SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilitySpawnItemsToContainer>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="safetyfirst">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="safetyharness"/>
  </Talent>
 </Talents>
--- a/cmd/log_format_test/main.go
+++ b/cmd/log_format_test/main.go
@@ -0,0 +1,28 @@
 package main
 import (
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 func main() {
 	// Initialize logger with DEBUG level
 	logger.Init(logger.LevelDebug)
 	// Test different log levels
 	logger.Info("This is an info message")
 	logger.Debug("This is a debug message")
 	logger.Warning("This is a warning message")
 	logger.Error("This is an error message")
 	logger.Trace("This is a trace message (not visible at DEBUG level)")
 	// Test with a goroutine
 	logger.SafeGo(func() {
 		time.Sleep(10 * time.Millisecond)
 		logger.Info("Message from goroutine")
 	})
 	// Wait for goroutine to complete
 	time.Sleep(20 * time.Millisecond)
 }
--- a/glob_test.go
+++ b/glob_test.go
@@ -1,6 +1,7 @@
 package main
 import (
 	"cook/utils"
 	"os"
 	"path/filepath"
 	"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
-			files, err := expandFilePatterns(tc.patterns)
+			// Convert string patterns to map[string]struct{} for ExpandGLobs
 			patternMap := make(map[string]struct{})
 			for _, pattern := range tc.patterns {
 				patternMap[pattern] = struct{}{}
 			}
 			files, err := utils.ExpandGLobs(patternMap)
 			if err != nil {
-				t.Fatalf("expandFilePatterns failed: %v", err)
+				t.Fatalf("ExpandGLobs failed: %v", err)
 			}
 			if len(files) != tc.expected {
--- a/go.mod
+++ b/go.mod
@@ -1,10 +1,37 @@
-module modify
+module cook
-go 1.24.1
+go 1.23.2
 require github.com/Knetic/govaluate v3.0.0+incompatible
 require (
-	github.com/bmatcuk/doublestar/v4 v4.8.1 // indirect
+	git.site.quack-lab.dev/dave/cylogger v1.3.0
-	github.com/yuin/gopher-lua v1.1.1 // indirect
+	github.com/bmatcuk/doublestar/v4 v4.8.1
 	github.com/stretchr/testify v1.10.0
 	github.com/yuin/gopher-lua v1.1.1
 	gopkg.in/yaml.v3 v3.0.1
 	gorm.io/gorm v1.30.0
 )
 require (
 	github.com/davecgh/go-spew v1.1.1 // indirect
 	github.com/hexops/valast v1.5.0 // indirect
 	github.com/jinzhu/inflection v1.0.0 // indirect
 	github.com/jinzhu/now v1.1.5 // indirect
 	github.com/kr/pretty v0.3.1 // indirect
 	github.com/mattn/go-sqlite3 v1.14.22 // indirect
 	github.com/pmezard/go-difflib v1.0.0 // indirect
 	github.com/rogpeppe/go-internal v1.14.1 // indirect
 	github.com/tidwall/match v1.1.1 // indirect
 	github.com/tidwall/pretty v1.2.0 // indirect
 	golang.org/x/mod v0.21.0 // indirect
 	golang.org/x/sync v0.11.0 // indirect
 	golang.org/x/text v0.22.0 // indirect
 	golang.org/x/tools v0.26.0 // indirect
 	gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
 	mvdan.cc/gofumpt v0.4.0 // indirect
 )
 require (
 	github.com/google/go-cmp v0.6.0
 	github.com/tidwall/gjson v1.18.0
 	gorm.io/driver/sqlite v1.6.0
 )
--- a/go.sum
+++ b/go.sum
@@ -1,6 +1,65 @@
-github.com/Knetic/govaluate v3.0.0+incompatible h1:7o6+MAPhYTCF0+fdvoz1xDedhRb4f6s9Tn1Tt7/WTEg=
+git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw=
-github.com/Knetic/govaluate v3.0.0+incompatible/go.mod h1:r7JcOSlj0wfOMncg0iLm8Leh48TZaKVeNIfJntJ2wa0=
+git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk=
 github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
 github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
 github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
 github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
 github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
 github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE=
 github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps=
 github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
 github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
 github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM=
 github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
 github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
 github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
 github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
 github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
 github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
 github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
 github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
 github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
 github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
 github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
 github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
 github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
 github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
 github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
 github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
 github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
 github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
 github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
 github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
 github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
 github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs=
 github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
 github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
 github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
 github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
 github.com/tidwall/gjson v1.18.0 h1:FIDeeyB800efLX89e5a8Y0BNH+LOngJyGrIWxG2FKQY=
 github.com/tidwall/gjson v1.18.0/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk=
 github.com/tidwall/match v1.1.1 h1:+Ho715JplO36QYgwN9PGYNhgZvoUSc9X2c80KVTi+GA=
 github.com/tidwall/match v1.1.1/go.mod h1:eRSPERbgtNPcGhD8UCthc6PmLEQXEWd3PRB5JTxsfmM=
 github.com/tidwall/pretty v1.2.0 h1:RWIZEg2iJ8/g6fDDYzMpobmaoGh5OLl4AXtGUGPcqCs=
 github.com/tidwall/pretty v1.2.0/go.mod h1:ITEVvHYasfjBbM0u2Pg8T2nJnzm8xPwvNhhsoaGGjNU=
 github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
 github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
 golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0=
 golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY=
 golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w=
 golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
 golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
 golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ=
 golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0=
 gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
 gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
 gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
 gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
 gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
 gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
 gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
 gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
 gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
 mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
 mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=
--- a/main.go
+++ b/main.go
--- a/main_test.go
+++ b/main_test.go
--- a/processor/json.go
+++ b/processor/json.go
@@ -0,0 +1,656 @@
 package processor
 import (
 	"cook/utils"
 	"encoding/json"
 	"fmt"
 	"sort"
 	"strconv"
 	"strings"
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	"github.com/tidwall/gjson"
 	lua "github.com/yuin/gopher-lua"
 )
 // jsonLogger is a scoped logger for the processor/json package.
 var jsonLogger = logger.Default.WithPrefix("processor/json")
 // ProcessJSON applies Lua processing to JSON content
 func ProcessJSON(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
 	processJsonLogger := jsonLogger.WithPrefix("ProcessJSON").WithField("commandName", command.Name).WithField("file", filename)
 	processJsonLogger.Debug("Starting JSON processing for file")
 	processJsonLogger.Trace("Initial file content length: %d", len(content))
 	var commands []utils.ReplaceCommand
 	startTime := time.Now()
 	// Parse JSON content
 	var jsonData interface{}
 	err := json.Unmarshal([]byte(content), &jsonData)
 	if err != nil {
 		processJsonLogger.Error("Failed to parse JSON content: %v", err)
 		return commands, fmt.Errorf("failed to parse JSON: %v", err)
 	}
 	processJsonLogger.Debug("Successfully parsed JSON content")
 	// Create Lua state
 	L, err := NewLuaState()
 	if err != nil {
 		processJsonLogger.Error("Error creating Lua state: %v", err)
 		return commands, fmt.Errorf("error creating Lua state: %v", err)
 	}
 	defer L.Close()
 	// Set filename global
 	L.SetGlobal("file", lua.LString(filename))
 	// Convert JSON data to Lua table
 	luaTable, err := ToLuaTable(L, jsonData)
 	if err != nil {
 		processJsonLogger.Error("Failed to convert JSON to Lua table: %v", err)
 		return commands, fmt.Errorf("failed to convert JSON to Lua table: %v", err)
 	}
 	// Set the JSON data as a global variable
 	L.SetGlobal("data", luaTable)
 	processJsonLogger.Debug("Set JSON data as Lua global 'data'")
 	// Build and execute Lua script for JSON mode
 	luaExpr := BuildJSONLuaScript(command.Lua)
 	processJsonLogger.Debug("Built Lua script from expression: %q", command.Lua)
 	processJsonLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
 	if err := L.DoString(luaExpr); err != nil {
 		processJsonLogger.Error("Lua script execution failed: %v\nScript: %s", err, utils.LimitString(luaExpr, 200))
 		return commands, fmt.Errorf("lua script execution failed: %v", err)
 	}
 	processJsonLogger.Debug("Lua script executed successfully")
 	// Check if modification flag is set
 	modifiedVal := L.GetGlobal("modified")
 	if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
 		processJsonLogger.Debug("Skipping - no modifications indicated by Lua script")
 		return commands, nil
 	}
 	// Get the modified data from Lua
 	modifiedData := L.GetGlobal("data")
 	if modifiedData.Type() != lua.LTTable {
 		processJsonLogger.Error("Expected 'data' to be a table after Lua processing, got %s", modifiedData.Type().String())
 		return commands, fmt.Errorf("expected 'data' to be a table after Lua processing")
 	}
 	// Convert back to Go interface
 	goData, err := FromLua(L, modifiedData)
 	if err != nil {
 		processJsonLogger.Error("Failed to convert Lua table back to Go: %v", err)
 		return commands, fmt.Errorf("failed to convert Lua table back to Go: %v", err)
 	}
 	processJsonLogger.Debug("About to call applyChanges with original data and modified data")
 	commands, err = applyChanges(content, jsonData, goData)
 	if err != nil {
 		processJsonLogger.Error("Failed to apply surgical JSON changes: %v", err)
 		return commands, fmt.Errorf("failed to apply surgical JSON changes: %v", err)
 	}
 	processJsonLogger.Debug("Total JSON processing time: %v", time.Since(startTime))
 	processJsonLogger.Debug("Generated %d total modifications", len(commands))
 	return commands, nil
 }
 // applyJSONChanges compares original and modified data and applies changes surgically
 func applyJSONChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
 	var commands []utils.ReplaceCommand
 	appliedCommands, err := applyChanges(content, originalData, modifiedData)
 	if err == nil && len(appliedCommands) > 0 {
 		return appliedCommands, nil
 	}
 	return commands, fmt.Errorf("failed to make any changes to the json")
 }
 // applyChanges attempts to make surgical changes while preserving exact formatting
 func applyChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
 	var commands []utils.ReplaceCommand
 	// Find all changes between original and modified data
 	changes := findDeepChanges("", originalData, modifiedData)
 	jsonLogger.Debug("applyChanges: Found %d changes: %v", len(changes), changes)
 	if len(changes) == 0 {
 		return commands, nil
 	}
 	// Sort removal operations by index in descending order to avoid index shifting
 	var removals []string
 	var additions []string
 	var valueChanges []string
 	for path := range changes {
 		if strings.HasSuffix(path, "@remove") {
 			removals = append(removals, path)
 		} else if strings.HasSuffix(path, "@add") {
 			additions = append(additions, path)
 		} else {
 			valueChanges = append(valueChanges, path)
 		}
 	}
 	jsonLogger.Debug("applyChanges: %d removals, %d additions, %d value changes", len(removals), len(additions), len(valueChanges))
 	// Apply removals first (from end to beginning to avoid index shifting)
 	for _, removalPath := range removals {
 		actualPath := strings.TrimSuffix(removalPath, "@remove")
 		elementIndex := extractIndexFromRemovalPath(actualPath)
 		arrayPath := getArrayPathFromElementPath(actualPath)
 		jsonLogger.Debug("Processing removal: path=%s, index=%d, arrayPath=%s", actualPath, elementIndex, arrayPath)
 		// Find the exact byte range to remove
 		from, to := findArrayElementRemovalRange(content, arrayPath, elementIndex)
 		jsonLogger.Debug("Removing bytes %d-%d", from, to)
 		commands = append(commands, utils.ReplaceCommand{
 			From: from,
 			To:   to,
 			With: "",
 		})
 		jsonLogger.Debug("Added removal command: From=%d, To=%d, With=\"\"", from, to)
 	}
 	// Apply additions (new fields)
 	for _, additionPath := range additions {
 		actualPath := strings.TrimSuffix(additionPath, "@add")
 		newValue := changes[additionPath]
 		jsonLogger.Debug("Processing addition: path=%s, value=%v", actualPath, newValue)
 		// Find the parent object to add the field to
 		parentPath := getParentPath(actualPath)
 		fieldName := getFieldName(actualPath)
 		jsonLogger.Debug("Parent path: %s, field name: %s", parentPath, fieldName)
 		// Get the parent object
 		var parentResult gjson.Result
 		if parentPath == "" {
 			// Adding to root object - get the entire JSON
 			parentResult = gjson.Parse(content)
 		} else {
 			parentResult = gjson.Get(content, parentPath)
 		}
 		if !parentResult.Exists() {
 			jsonLogger.Debug("Parent path %s does not exist, skipping", parentPath)
 			continue
 		}
 		// Find where to insert the new field (at the end of the object)
 		startPos := int(parentResult.Index + len(parentResult.Raw) - 1) // Before closing brace
 		jsonLogger.Debug("Inserting at pos %d", startPos)
 		// Convert the new value to JSON string
 		newValueStr := convertValueToJSONString(newValue)
 		// Insert the new field with pretty-printed formatting
 		// Format: ,"fieldName": { ... }
 		insertText := fmt.Sprintf(`,"%s": %s`, fieldName, newValueStr)
 		commands = append(commands, utils.ReplaceCommand{
 			From: startPos,
 			To:   startPos,
 			With: insertText,
 		})
 		jsonLogger.Debug("Added addition command: From=%d, To=%d, With=%q", startPos, startPos, insertText)
 	}
 	// Apply value changes (in reverse order to avoid position shifting)
 	sort.Slice(valueChanges, func(i, j int) bool {
 		// Get positions for comparison
 		resultI := gjson.Get(content, valueChanges[i])
 		resultJ := gjson.Get(content, valueChanges[j])
 		return resultI.Index > resultJ.Index // Descending order
 	})
 	for _, path := range valueChanges {
 		newValue := changes[path]
 		jsonLogger.Debug("Processing value change: path=%s, value=%v", path, newValue)
 		// Get the current value and its position in the original JSON
 		result := gjson.Get(content, path)
 		if !result.Exists() {
 			jsonLogger.Debug("Path %s does not exist, skipping", path)
 			continue // Skip if path doesn't exist
 		}
 		// Get the exact byte positions of this value
 		startPos := result.Index
 		endPos := startPos + len(result.Raw)
 		jsonLogger.Debug("Found value at pos %d-%d: %q", startPos, endPos, result.Raw)
 		// Convert the new value to JSON string
 		newValueStr := convertValueToJSONString(newValue)
 		jsonLogger.Debug("Converting to: %q", newValueStr)
 		// Create a replacement command for this specific value
 		commands = append(commands, utils.ReplaceCommand{
 			From: int(startPos),
 			To:   int(endPos),
 			With: newValueStr,
 		})
 		jsonLogger.Debug("Added command: From=%d, To=%d, With=%q", int(startPos), int(endPos), newValueStr)
 	}
 	return commands, nil
 }
 // extractIndexFromRemovalPath extracts the array index from a removal path like "Rows.0.Inputs.1@remove"
 func extractIndexFromRemovalPath(path string) int {
 	parts := strings.Split(strings.TrimSuffix(path, "@remove"), ".")
 	if len(parts) > 0 {
 		lastPart := parts[len(parts)-1]
 		if index, err := strconv.Atoi(lastPart); err == nil {
 			return index
 		}
 	}
 	return -1
 }
 // getArrayPathFromElementPath converts "Rows.0.Inputs.1" to "Rows.0.Inputs"
 func getArrayPathFromElementPath(elementPath string) string {
 	parts := strings.Split(elementPath, ".")
 	if len(parts) > 0 {
 		return strings.Join(parts[:len(parts)-1], ".")
 	}
 	return ""
 }
 // getParentPath extracts the parent path from a full path like "Rows.0.Inputs.1"
 func getParentPath(fullPath string) string {
 	parts := strings.Split(fullPath, ".")
 	if len(parts) > 0 {
 		return strings.Join(parts[:len(parts)-1], ".")
 	}
 	return ""
 }
 // getFieldName extracts the field name from a full path like "Rows.0.Inputs.1"
 func getFieldName(fullPath string) string {
 	parts := strings.Split(fullPath, ".")
 	if len(parts) > 0 {
 		return parts[len(parts)-1]
 	}
 	return ""
 }
 // convertValueToJSONString converts a Go interface{} to a JSON string representation
 func convertValueToJSONString(value interface{}) string {
 	switch v := value.(type) {
 	case string:
 		return `"` + strings.ReplaceAll(v, `"`, `\"`) + `"`
 	case float64:
 		if v == float64(int64(v)) {
 			return strconv.FormatInt(int64(v), 10)
 		}
 		return strconv.FormatFloat(v, 'f', -1, 64)
 	case bool:
 		return strconv.FormatBool(v)
 	case nil:
 		return "null"
 	case map[string]interface{}:
 		// Handle maps specially to avoid double-escaping of keys
 		var pairs []string
 		for key, val := range v {
 			// The key might already have escaped quotes from Lua, so we need to be careful
 			// If the key already contains escaped quotes, we need to unescape them first
 			keyStr := key
 			if strings.Contains(key, `\"`) {
 				// Key already has escaped quotes, use it as-is
 				keyStr = `"` + key + `"`
 			} else {
 				// Normal key, escape quotes
 				keyStr = `"` + strings.ReplaceAll(key, `"`, `\"`) + `"`
 			}
 			valStr := convertValueToJSONString(val)
 			pairs = append(pairs, keyStr+":"+valStr)
 		}
 		return "{" + strings.Join(pairs, ",") + "}"
 	default:
 		// For other complex types (arrays), we need to use json.Marshal
 		jsonBytes, err := json.Marshal(v)
 		if err != nil {
 			return "null" // Fallback to null if marshaling fails
 		}
 		return string(jsonBytes)
 	}
 }
 // findArrayElementRemovalRange finds the exact byte range to remove for an array element
 func findArrayElementRemovalRange(content, arrayPath string, elementIndex int) (int, int) {
 	// Get the array using gjson
 	arrayResult := gjson.Get(content, arrayPath)
 	if !arrayResult.Exists() || !arrayResult.IsArray() {
 		return -1, -1
 	}
 	// Get all array elements
 	elements := arrayResult.Array()
 	if elementIndex >= len(elements) {
 		return -1, -1
 	}
 	// Get the target element
 	elementResult := elements[elementIndex]
 	startPos := int(elementResult.Index)
 	endPos := int(elementResult.Index + len(elementResult.Raw))
 	// Handle comma removal properly
 	if elementIndex == 0 && len(elements) > 1 {
 		// First element but not the only one - remove comma after
 		for i := endPos; i < len(content) && i < endPos+50; i++ {
 			if content[i] == ',' {
 				endPos = i + 1
 				break
 			}
 		}
 	} else if elementIndex == len(elements)-1 && len(elements) > 1 {
 		// Last element and not the only one - remove comma before
 		prevElementEnd := int(elements[elementIndex-1].Index + len(elements[elementIndex-1].Raw))
 		for i := prevElementEnd; i < startPos && i < len(content); i++ {
 			if content[i] == ',' {
 				startPos = i
 				break
 			}
 		}
 	}
 	// If it's the only element, don't remove any commas
 	return startPos, endPos
 }
 // findDeepChanges recursively finds all paths that need to be changed
 func findDeepChanges(basePath string, original, modified interface{}) map[string]interface{} {
 	changes := make(map[string]interface{})
 	switch orig := original.(type) {
 	case map[string]interface{}:
 		if mod, ok := modified.(map[string]interface{}); ok {
 			// Check for new keys added in modified data
 			for key, modValue := range mod {
 				var currentPath string
 				if basePath == "" {
 					currentPath = key
 				} else {
 					currentPath = basePath + "." + key
 				}
 				if origValue, exists := orig[key]; exists {
 					// Key exists in both, check if value changed
 					switch modValue.(type) {
 					case map[string]interface{}, []interface{}:
 						// Recursively check nested structures
 						nestedChanges := findDeepChanges(currentPath, origValue, modValue)
 						for nestedPath, nestedValue := range nestedChanges {
 							changes[nestedPath] = nestedValue
 						}
 					default:
 						// Primitive value - check if changed
 						if !deepEqual(origValue, modValue) {
 							changes[currentPath] = modValue
 						}
 					}
 				} else {
 					// New key added - mark for addition
 					changes[currentPath+"@add"] = modValue
 				}
 			}
 		}
 	case []interface{}:
 		if mod, ok := modified.([]interface{}); ok {
 			// Handle array changes by detecting specific element operations
 			if len(orig) != len(mod) {
 				// Array length changed - detect if it's element removal
 				if len(orig) > len(mod) {
 					// Element(s) removed - find which ones by comparing content
 					removedIndices := findRemovedArrayElements(orig, mod)
 					for _, removedIndex := range removedIndices {
 						var currentPath string
 						if basePath == "" {
 							currentPath = fmt.Sprintf("%d@remove", removedIndex)
 						} else {
 							currentPath = fmt.Sprintf("%s.%d@remove", basePath, removedIndex)
 						}
 						changes[currentPath] = nil // Mark for removal
 					}
 				} else {
 					// Elements added - more complex, skip for now
 				}
 			} else {
 				// Same length - check individual elements for value changes
 				for i, modValue := range mod {
 					var currentPath string
 					if basePath == "" {
 						currentPath = strconv.Itoa(i)
 					} else {
 						currentPath = basePath + "." + strconv.Itoa(i)
 					}
 					if i < len(orig) {
 						// Index exists in both, check if value changed
 						switch modValue.(type) {
 						case map[string]interface{}, []interface{}:
 							// Recursively check nested structures
 							nestedChanges := findDeepChanges(currentPath, orig[i], modValue)
 							for nestedPath, nestedValue := range nestedChanges {
 								changes[nestedPath] = nestedValue
 							}
 						default:
 							// Primitive value - check if changed
 							if !deepEqual(orig[i], modValue) {
 								changes[currentPath] = modValue
 							}
 						}
 					}
 				}
 			}
 		}
 	default:
 		// For primitive types, compare directly
 		if !deepEqual(original, modified) {
 			if basePath == "" {
 				changes[""] = modified
 			} else {
 				changes[basePath] = modified
 			}
 		}
 	}
 	return changes
 }
 // findRemovedArrayElements compares two arrays and returns indices of removed elements
 func findRemovedArrayElements(original, modified []interface{}) []int {
 	var removedIndices []int
 	// Simple approach: find elements in original that don't exist in modified
 	for i, origElement := range original {
 		found := false
 		for _, modElement := range modified {
 			if deepEqual(origElement, modElement) {
 				found = true
 				break
 			}
 		}
 		if !found {
 			removedIndices = append(removedIndices, i)
 		}
 	}
 	return removedIndices
 }
 // deepEqual performs deep comparison of two values
 func deepEqual(a, b interface{}) bool {
 	if a == nil && b == nil {
 		return true
 	}
 	if a == nil || b == nil {
 		return false
 	}
 	switch av := a.(type) {
 	case map[string]interface{}:
 		if bv, ok := b.(map[string]interface{}); ok {
 			if len(av) != len(bv) {
 				return false
 			}
 			for k, v := range av {
 				if !deepEqual(v, bv[k]) {
 					return false
 				}
 			}
 			return true
 		}
 		return false
 	case []interface{}:
 		if bv, ok := b.([]interface{}); ok {
 			if len(av) != len(bv) {
 				return false
 			}
 			for i, v := range av {
 				if !deepEqual(v, bv[i]) {
 					return false
 				}
 			}
 			return true
 		}
 		return false
 	default:
 		return a == b
 	}
 }
 // ToLuaTable converts a Go interface{} to a Lua table recursively
 func ToLuaTable(L *lua.LState, data interface{}) (*lua.LTable, error) {
 	toLuaTableLogger := jsonLogger.WithPrefix("ToLuaTable")
 	toLuaTableLogger.Debug("Converting Go interface to Lua table")
 	toLuaTableLogger.Trace("Input data type: %T", data)
 	switch v := data.(type) {
 	case map[string]interface{}:
 		toLuaTableLogger.Debug("Converting map to Lua table")
 		table := L.CreateTable(0, len(v))
 		for key, value := range v {
 			luaValue, err := ToLuaValue(L, value)
 			if err != nil {
 				toLuaTableLogger.Error("Failed to convert map value for key %q: %v", key, err)
 				return nil, err
 			}
 			table.RawSetString(key, luaValue)
 		}
 		return table, nil
 	case []interface{}:
 		toLuaTableLogger.Debug("Converting slice to Lua table")
 		table := L.CreateTable(len(v), 0)
 		for i, value := range v {
 			luaValue, err := ToLuaValue(L, value)
 			if err != nil {
 				toLuaTableLogger.Error("Failed to convert slice value at index %d: %v", i, err)
 				return nil, err
 			}
 			table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
 		}
 		return table, nil
 	case string:
 		toLuaTableLogger.Debug("Converting string to Lua string")
 		return nil, fmt.Errorf("expected table or array, got string")
 	case float64:
 		toLuaTableLogger.Debug("Converting float64 to Lua number")
 		return nil, fmt.Errorf("expected table or array, got number")
 	case bool:
 		toLuaTableLogger.Debug("Converting bool to Lua boolean")
 		return nil, fmt.Errorf("expected table or array, got boolean")
 	case nil:
 		toLuaTableLogger.Debug("Converting nil to Lua nil")
 		return nil, fmt.Errorf("expected table or array, got nil")
 	default:
 		toLuaTableLogger.Error("Unsupported type for Lua table conversion: %T", v)
 		return nil, fmt.Errorf("unsupported type for Lua table conversion: %T", v)
 	}
 }
 // ToLuaValue converts a Go interface{} to a Lua value
 func ToLuaValue(L *lua.LState, data interface{}) (lua.LValue, error) {
 	toLuaValueLogger := jsonLogger.WithPrefix("ToLuaValue")
 	toLuaValueLogger.Debug("Converting Go interface to Lua value")
 	toLuaValueLogger.Trace("Input data type: %T", data)
 	switch v := data.(type) {
 	case map[string]interface{}:
 		toLuaValueLogger.Debug("Converting map to Lua table")
 		table := L.CreateTable(0, len(v))
 		for key, value := range v {
 			luaValue, err := ToLuaValue(L, value)
 			if err != nil {
 				toLuaValueLogger.Error("Failed to convert map value for key %q: %v", key, err)
 				return lua.LNil, err
 			}
 			table.RawSetString(key, luaValue)
 		}
 		return table, nil
 	case []interface{}:
 		toLuaValueLogger.Debug("Converting slice to Lua table")
 		table := L.CreateTable(len(v), 0)
 		for i, value := range v {
 			luaValue, err := ToLuaValue(L, value)
 			if err != nil {
 				toLuaValueLogger.Error("Failed to convert slice value at index %d: %v", i, err)
 				return lua.LNil, err
 			}
 			table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
 		}
 		return table, nil
 	case string:
 		toLuaValueLogger.Debug("Converting string to Lua string")
 		return lua.LString(v), nil
 	case float64:
 		toLuaValueLogger.Debug("Converting float64 to Lua number")
 		return lua.LNumber(v), nil
 	case bool:
 		toLuaValueLogger.Debug("Converting bool to Lua boolean")
 		return lua.LBool(v), nil
 	case nil:
 		toLuaValueLogger.Debug("Converting nil to Lua nil")
 		return lua.LNil, nil
 	default:
 		toLuaValueLogger.Error("Unsupported type for Lua value conversion: %T", v)
 		return lua.LNil, fmt.Errorf("unsupported type for Lua value conversion: %T", v)
 	}
 }
--- a/processor/json_test.go
+++ b/processor/json_test.go
@@ -0,0 +1,96 @@
 package processor
 import (
 	"cook/utils"
 	"testing"
 	"github.com/stretchr/testify/assert"
 )
 func TestProcessJSON(t *testing.T) {
 	tests := []struct {
 		name           string
 		input          string
 		luaExpression  string
 		expectedOutput string
 		expectedMods   int
 	}{
 		{
 			name:           "Basic JSON object modification",
 			input:          `{"name": "test", "value": 42}`,
 			luaExpression:  `data.value = data.value * 2; return true`,
 			expectedOutput: `{"name": "test", "value": 84}`,
 			expectedMods:   1,
 		},
 		{
 			name:           "JSON array modification",
 			input:          `{"items": [{"name": "item1", "value": 10}, {"name": "item2", "value": 20}]}`,
 			luaExpression:  `for i, item in ipairs(data.items) do item.value = item.value * 2 end modified = true`,
 			expectedOutput: `{"items": [{"name": "item1", "value": 20}, {"name": "item2", "value": 40}]}`,
 			expectedMods:   2, 
 		},
 		{
 			name:           "JSON nested object modification",
 			input:          `{"config": {"setting1": {"enabled": true, "value": 5}, "setting2": {"enabled": false, "value": 10}}}`,
 			luaExpression:  `data.config.setting1.enabled = false data.config.setting2.value = 15 modified = true`,
 			expectedOutput: `{"config": {"setting1": {"enabled": false, "value": 5}, "setting2": {"enabled": false, "value": 15}}}`,
 			expectedMods:   2,
 		},
 		{
 			name:           "JSON no modification",
 			input:          `{"name": "test", "value": 42}`,
 			luaExpression:  `return false`,
 			expectedOutput: `{"name": "test", "value": 42}`,
 			expectedMods:   0,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			command := utils.ModifyCommand{
 				Name: tt.name,
 				JSON: true,
 				Lua:  tt.luaExpression,
 			}
 			modifications, err := ProcessJSON(tt.input, command, "test.json")
 			assert.NoError(t, err, "ProcessJSON failed: %v", err)
 			if len(modifications) > 0 {
 				// Execute modifications
 				result, count := utils.ExecuteModifications(modifications, tt.input)
 				assert.Equal(t, tt.expectedMods, count, "Expected %d modifications, got %d", tt.expectedMods, count)
 				assert.Equal(t, tt.expectedOutput, result, "Expected output: %s, got: %s", tt.expectedOutput, result)
 			} else {
 				assert.Equal(t, 0, tt.expectedMods, "Expected no modifications but got some")
 			}
 		})
 	}
 }
 func TestToLuaValue(t *testing.T) {
 	L, err := NewLuaState()
 	if err != nil {
 		t.Fatalf("Failed to create Lua state: %v", err)
 	}
 	defer L.Close()
 	tests := []struct {
 		name     string
 		input    interface{}
 		expected string
 	}{
 		{"string", "hello", "hello"},
 		{"number", 42.0, "42"},
 		{"boolean", true, "true"},
 		{"nil", nil, "nil"},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := ToLuaValue(L, tt.input)
 			assert.NoError(t, err)
 			assert.Equal(t, tt.expected, result.String())
 		})
 	}
 }
--- a/processor/processor.go
+++ b/processor/processor.go
@@ -0,0 +1,567 @@
 package processor
 import (
 	"fmt"
 	"io"
 	"net/http"
 	"regexp"
 	"strings"
 	"cook/utils"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
 )
 // processorLogger is a scoped logger for the processor package.
 var processorLogger = logger.Default.WithPrefix("processor")
 // Maybe we make this an interface again for the shits and giggles
 // We will see, it could easily be...
 var globalVariables = map[string]interface{}{}
 func SetVariables(vars map[string]interface{}) {
 	for k, v := range vars {
 		globalVariables[k] = v
 	}
 }
 func NewLuaState() (*lua.LState, error) {
 	newLStateLogger := processorLogger.WithPrefix("NewLuaState")
 	newLStateLogger.Debug("Creating new Lua state")
 	L := lua.NewState()
 	// defer L.Close()
 	// Load math library
 	newLStateLogger.Debug("Loading Lua math library")
 	L.Push(L.GetGlobal("require"))
 	L.Push(lua.LString("math"))
 	if err := L.PCall(1, 1, nil); err != nil {
 		newLStateLogger.Error("Failed to load Lua math library: %v", err)
 		return nil, fmt.Errorf("error loading Lua math library: %v", err)
 	}
 	newLStateLogger.Debug("Lua math library loaded")
 	// Initialize helper functions
 	newLStateLogger.Debug("Initializing Lua helper functions")
 	if err := InitLuaHelpers(L); err != nil {
 		newLStateLogger.Error("Failed to initialize Lua helper functions: %v", err)
 		return nil, err
 	}
 	newLStateLogger.Debug("Lua helper functions initialized")
 	// Inject global variables
 	if len(globalVariables) > 0 {
 		newLStateLogger.Debug("Injecting %d global variables into Lua state", len(globalVariables))
 		for k, v := range globalVariables {
 			switch val := v.(type) {
 			case int:
 				L.SetGlobal(k, lua.LNumber(float64(val)))
 			case int64:
 				L.SetGlobal(k, lua.LNumber(float64(val)))
 			case float32:
 				L.SetGlobal(k, lua.LNumber(float64(val)))
 			case float64:
 				L.SetGlobal(k, lua.LNumber(val))
 			case string:
 				L.SetGlobal(k, lua.LString(val))
 			case bool:
 				if val {
 					L.SetGlobal(k, lua.LTrue)
 				} else {
 					L.SetGlobal(k, lua.LFalse)
 				}
 			default:
 				// Fallback to string representation
 				L.SetGlobal(k, lua.LString(fmt.Sprintf("%v", val)))
 			}
 		}
 	}
 	newLStateLogger.Debug("New Lua state created successfully")
 	return L, nil
 }
 // FromLua converts a Lua table to a struct or map recursively
 func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
 	fromLuaLogger := processorLogger.WithPrefix("FromLua").WithField("luaType", luaValue.Type().String())
 	fromLuaLogger.Debug("Converting Lua value to Go interface")
 	switch v := luaValue.(type) {
 	case *lua.LTable:
 		fromLuaLogger.Debug("Processing Lua table")
 		isArray, err := IsLuaTableArray(L, v)
 		if err != nil {
 			fromLuaLogger.Error("Failed to determine if Lua table is array: %v", err)
 			return nil, err
 		}
 		fromLuaLogger.Debug("Lua table is array: %t", isArray)
 		if isArray {
 			fromLuaLogger.Debug("Converting Lua table to Go array")
 			result := make([]interface{}, 0)
 			v.ForEach(func(key lua.LValue, value lua.LValue) {
 				converted, _ := FromLua(L, value)
 				result = append(result, converted)
 			})
 			fromLuaLogger.Trace("Converted Go array: %v", result)
 			return result, nil
 		} else {
 			fromLuaLogger.Debug("Converting Lua table to Go map")
 			result := make(map[string]interface{})
 			v.ForEach(func(key lua.LValue, value lua.LValue) {
 				converted, _ := FromLua(L, value)
 				result[key.String()] = converted
 			})
 			fromLuaLogger.Trace("Converted Go map: %v", result)
 			return result, nil
 		}
 	case lua.LString:
 		fromLuaLogger.Debug("Converting Lua string to Go string")
 		fromLuaLogger.Trace("Lua string: %q", string(v))
 		return string(v), nil
 	case lua.LBool:
 		fromLuaLogger.Debug("Converting Lua boolean to Go boolean")
 		fromLuaLogger.Trace("Lua boolean: %t", bool(v))
 		return bool(v), nil
 	case lua.LNumber:
 		fromLuaLogger.Debug("Converting Lua number to Go float64")
 		fromLuaLogger.Trace("Lua number: %f", float64(v))
 		return float64(v), nil
 	default:
 		fromLuaLogger.Debug("Unsupported Lua type, returning nil")
 		return nil, nil
 	}
 }
 func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
 	isLuaTableArrayLogger := processorLogger.WithPrefix("IsLuaTableArray")
 	isLuaTableArrayLogger.Debug("Checking if Lua table is an array")
 	isLuaTableArrayLogger.Trace("Lua table input: %v", v)
 	L.SetGlobal("table_to_check", v)
 	// Use our predefined helper function from InitLuaHelpers
 	err := L.DoString(`is_array = isArray(table_to_check)`)
 	if err != nil {
 		isLuaTableArrayLogger.Error("Error determining if table is an array: %v", err)
 		return false, fmt.Errorf("error determining if table is array: %w", err)
 	}
 	// Check the result of our Lua function
 	isArray := L.GetGlobal("is_array")
 	// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
 	result := !lua.LVIsFalse(isArray)
 	isLuaTableArrayLogger.Debug("Lua table is array: %t", result)
 	isLuaTableArrayLogger.Trace("isArray result Lua value: %v", isArray)
 	return result, nil
 }
 // InitLuaHelpers initializes common Lua helper functions
 func InitLuaHelpers(L *lua.LState) error {
 	initLuaHelpersLogger := processorLogger.WithPrefix("InitLuaHelpers")
 	initLuaHelpersLogger.Debug("Loading Lua helper functions")
 	helperScript := `
 -- Custom Lua helpers for math operations
 function min(a, b) return math.min(a, b) end
 function max(a, b) return math.max(a, b) end
 function round(x, n)
 	if n == nil then n = 0 end
 	return math.floor(x * 10^n + 0.5) / 10^n
 end
 function floor(x) return math.floor(x) end
 function ceil(x) return math.ceil(x) end
 function upper(s) return string.upper(s) end
 function lower(s) return string.lower(s) end
 function format(s, ...) return string.format(s, ...) end
 function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
 -- String split helper
 function strsplit(inputstr, sep)
  if sep == nil then
    sep = "%s"
  end
  local t = {}
  for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
    table.insert(t, str)
  end
  return t
 end
 ---@param table table
 ---@param depth number?
 function DumpTable(table, depth)
 	if depth == nil then
 		depth = 0
 	end
 	if (depth > 200) then
 		print("Error: Depth > 200 in dumpTable()")
 		return
 	end
 	for k, v in pairs(table) do
 		if (type(v) == "table") then
 			print(string.rep("  ", depth) .. k .. ":")
 			DumpTable(v, depth + 1)
 		else
 			print(string.rep("  ", depth) .. k .. ": ", v)
 		end
 	end
 end
 -- String to number conversion helper
 function num(str)
    return tonumber(str) or 0
 end
 -- Number to string conversion
 function str(num)
    return tostring(num)
 end
 -- Check if string is numeric
 function is_number(str)
    return tonumber(str) ~= nil
 end
 function isArray(t)
    if type(t) ~= "table" then return false end
    local max = 0
    local count = 0
    for k, _ in pairs(t) do
        if type(k) ~= "number" or k < 1 or math.floor(k) ~= k then
            return false
        end
        max = math.max(max, k)
        count = count + 1
    end
    return max == count
 end
 modified = false
 `
 	if err := L.DoString(helperScript); err != nil {
 		initLuaHelpersLogger.Error("Failed to load Lua helper functions: %v", err)
 		return fmt.Errorf("error loading helper functions: %v", err)
 	}
 	initLuaHelpersLogger.Debug("Lua helper functions loaded")
 	initLuaHelpersLogger.Debug("Setting up Lua print function to Go")
 	L.SetGlobal("print", L.NewFunction(printToGo))
 	L.SetGlobal("fetch", L.NewFunction(fetch))
 	L.SetGlobal("re", L.NewFunction(EvalRegex))
 	initLuaHelpersLogger.Debug("Lua print and fetch functions bound to Go")
 	return nil
 }
 func PrependLuaAssignment(luaExpr string) string {
 	prependLuaAssignmentLogger := processorLogger.WithPrefix("PrependLuaAssignment").WithField("originalLuaExpr", luaExpr)
 	prependLuaAssignmentLogger.Debug("Prepending Lua assignment if necessary")
 	// Auto-prepend v1 for expressions starting with operators
 	if strings.HasPrefix(luaExpr, "*") ||
 		strings.HasPrefix(luaExpr, "/") ||
 		strings.HasPrefix(luaExpr, "+") ||
 		strings.HasPrefix(luaExpr, "-") ||
 		strings.HasPrefix(luaExpr, "^") ||
 		strings.HasPrefix(luaExpr, "%") {
 		luaExpr = "v1 = v1" + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1 = v1' due to operator prefix")
 	} else if strings.HasPrefix(luaExpr, "=") {
 		// Handle direct assignment with = operator
 		luaExpr = "v1 " + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1' due to direct assignment operator")
 	}
 	// Add assignment if needed
 	if !strings.Contains(luaExpr, "=") {
 		luaExpr = "v1 = " + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1 =' as no assignment was found")
 	}
 	prependLuaAssignmentLogger.Trace("Final Lua expression after prepending: %q", luaExpr)
 	return luaExpr
 }
 // BuildLuaScript prepares a Lua expression from shorthand notation
 func BuildLuaScript(luaExpr string) string {
 	buildLuaScriptLogger := processorLogger.WithPrefix("BuildLuaScript").WithField("inputLuaExpr", luaExpr)
 	buildLuaScriptLogger.Debug("Building full Lua script from expression")
 	// Perform $var substitutions from globalVariables
 	luaExpr = replaceVariables(luaExpr)
 	luaExpr = PrependLuaAssignment(luaExpr)
 	fullScript := fmt.Sprintf(`
 		function run()
 			%s
 		end
 		local res = run()
 		modified = res == nil or res
 	`, luaExpr)
 	buildLuaScriptLogger.Trace("Generated full Lua script: %q", utils.LimitString(fullScript, 200))
 	return fullScript
 }
 // BuildJSONLuaScript prepares a Lua expression for JSON mode
 func BuildJSONLuaScript(luaExpr string) string {
 	buildJsonLuaScriptLogger := processorLogger.WithPrefix("BuildJSONLuaScript").WithField("inputLuaExpr", luaExpr)
 	buildJsonLuaScriptLogger.Debug("Building full Lua script for JSON mode from expression")
 	// Perform $var substitutions from globalVariables
 	luaExpr = replaceVariables(luaExpr)
 	fullScript := fmt.Sprintf(`
 		function run()
 			%s
 		end
 		local res = run()
 		modified = res == nil or res
 	`, luaExpr)
 	buildJsonLuaScriptLogger.Trace("Generated full JSON Lua script: %q", utils.LimitString(fullScript, 200))
 	return fullScript
 }
 func replaceVariables(expr string) string {
 	// $varName -> literal value
 	varNameRe := regexp.MustCompile(`\$(\w+)`)
 	return varNameRe.ReplaceAllStringFunc(expr, func(m string) string {
 		name := varNameRe.FindStringSubmatch(m)[1]
 		if v, ok := globalVariables[name]; ok {
 			switch val := v.(type) {
 			case int, int64, float32, float64:
 				return fmt.Sprintf("%v", val)
 			case bool:
 				if val {
 					return "true"
 				} else {
 					return "false"
 				}
 			case string:
 				// Quote strings for Lua literal
 				return fmt.Sprintf("%q", val)
 			default:
 				return fmt.Sprintf("%q", fmt.Sprintf("%v", val))
 			}
 		}
 		return m
 	})
 }
 func printToGo(L *lua.LState) int {
 	printToGoLogger := processorLogger.WithPrefix("printToGo")
 	printToGoLogger.Debug("Lua print function called, redirecting to Go logger")
 	top := L.GetTop()
 	args := make([]interface{}, top)
 	for i := 1; i <= top; i++ {
 		args[i-1] = L.Get(i)
 	}
 	// Format the message with proper spacing between arguments
 	var parts []string
 	for _, arg := range args {
 		parts = append(parts, fmt.Sprintf("%v", arg))
 	}
 	message := strings.Join(parts, " ")
 	printToGoLogger.Trace("Lua print message: %q", message)
 	// Use the LUA log level with a script tag
 	logger.Lua("%s", message)
 	printToGoLogger.Debug("Message logged from Lua")
 	return 0
 }
 func fetch(L *lua.LState) int {
 	fetchLogger := processorLogger.WithPrefix("fetch")
 	fetchLogger.Debug("Lua fetch function called")
 	// Get URL from first argument
 	url := L.ToString(1)
 	if url == "" {
 		fetchLogger.Error("Fetch failed: URL is required")
 		L.Push(lua.LNil)
 		L.Push(lua.LString("URL is required"))
 		return 2
 	}
 	fetchLogger.Debug("Fetching URL: %q", url)
 	// Get options from second argument if provided
 	var method string = "GET"
 	var headers map[string]string = make(map[string]string)
 	var body string = ""
 	if L.GetTop() > 1 {
 		options := L.ToTable(2)
 		if options != nil {
 			fetchLogger.Debug("Processing fetch options")
 			// Get method
 			if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
 				method = methodVal.String()
 				fetchLogger.Trace("Method from options: %q", method)
 			}
 			// Get headers
 			if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
 				if headersTable, ok := headersVal.(*lua.LTable); ok {
 					fetchLogger.Trace("Processing headers table")
 					headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
 						headers[key.String()] = value.String()
 						fetchLogger.Trace("Header: %q = %q", key.String(), value.String())
 					})
 				}
 				fetchLogger.Trace("All headers: %v", headers)
 			}
 			// Get body
 			if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
 				body = bodyVal.String()
 				fetchLogger.Trace("Body from options: %q", utils.LimitString(body, 100))
 			}
 		}
 	}
 	fetchLogger.Debug("Fetch request details: Method=%q, URL=%q, BodyLength=%d, Headers=%v", method, url, len(body), headers)
 	// Create HTTP request
 	req, err := http.NewRequest(method, url, strings.NewReader(body))
 	if err != nil {
 		fetchLogger.Error("Error creating HTTP request: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
 		return 2
 	}
 	// Set headers
 	for key, value := range headers {
 		req.Header.Set(key, value)
 	}
 	fetchLogger.Debug("HTTP request created and headers set")
 	fetchLogger.Trace("HTTP Request: %+v", req)
 	// Make request
 	client := &http.Client{}
 	resp, err := client.Do(req)
 	if err != nil {
 		fetchLogger.Error("Error making HTTP request: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
 		return 2
 	}
 	defer func() {
 		fetchLogger.Debug("Closing HTTP response body")
 		resp.Body.Close()
 	}()
 	fetchLogger.Debug("HTTP request executed. Status Code: %d", resp.StatusCode)
 	// Read response body
 	bodyBytes, err := io.ReadAll(resp.Body)
 	if err != nil {
 		fetchLogger.Error("Error reading response body: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
 		return 2
 	}
 	fetchLogger.Trace("Response body length: %d", len(bodyBytes))
 	// Create response table
 	responseTable := L.NewTable()
 	responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
 	responseTable.RawSetString("statusText", lua.LString(resp.Status))
 	responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
 	responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
 	fetchLogger.Debug("Created Lua response table")
 	// Set headers in response
 	headersTable := L.NewTable()
 	for key, values := range resp.Header {
 		headersTable.RawSetString(key, lua.LString(values[0]))
 		fetchLogger.Trace("Response header: %q = %q", key, values[0])
 	}
 	responseTable.RawSetString("headers", headersTable)
 	fetchLogger.Trace("Full response table: %v", responseTable)
 	L.Push(responseTable)
 	fetchLogger.Debug("Pushed response table to Lua stack")
 	return 1
 }
 func EvalRegex(L *lua.LState) int {
 	evalRegexLogger := processorLogger.WithPrefix("evalRegex")
 	evalRegexLogger.Debug("Lua evalRegex function called")
 	defer func() {
 		if r := recover(); r != nil {
 			evalRegexLogger.Error("Panic in EvalRegex: %v", r)
 			// Push empty table on panic
 			emptyTable := L.NewTable()
 			L.Push(emptyTable)
 		}
 	}()
 	pattern := L.ToString(1)
 	input := L.ToString(2)
 	evalRegexLogger.Debug("Pattern: %q, Input: %q", pattern, input)
 	re := regexp.MustCompile(pattern)
 	matches := re.FindStringSubmatch(input)
 	evalRegexLogger.Debug("Go regex matches: %v (count: %d)", matches, len(matches))
 	matchesTable := L.NewTable()
 	for i, match := range matches {
 		matchesTable.RawSetInt(i, lua.LString(match))
 		evalRegexLogger.Debug("Set table[%d] = %q", i, match)
 	}
 	L.Push(matchesTable)
 	evalRegexLogger.Debug("Pushed matches table to Lua stack")
 	return 1
 }
 // GetLuaFunctionsHelp returns a comprehensive help string for all available Lua functions
 func GetLuaFunctionsHelp() string {
 	return `Lua Functions Available in Global Environment:
 MATH FUNCTIONS:
  min(a, b)           - Returns the minimum of two numbers
  max(a, b)           - Returns the maximum of two numbers
  round(x, n)         - Rounds x to n decimal places (default 0)
  floor(x)            - Returns the floor of x
  ceil(x)             - Returns the ceiling of x
 STRING FUNCTIONS:
  upper(s)            - Converts string to uppercase
  lower(s)            - Converts string to lowercase
  format(s, ...)      - Formats string using Lua string.format
  trim(s)             - Removes leading/trailing whitespace
  strsplit(inputstr, sep) - Splits string by separator (default: whitespace)
  num(str)            - Converts string to number (returns 0 if invalid)
  str(num)            - Converts number to string
  is_number(str)      - Returns true if string is numeric
 TABLE FUNCTIONS:
  DumpTable(table, depth) - Prints table structure recursively
  isArray(t)          - Returns true if table is a sequential array
 HTTP FUNCTIONS:
  fetch(url, options) - Makes HTTP request, returns response table
    options: {method="GET", headers={}, body=""}
    returns: {status, statusText, ok, body, headers}
 REGEX FUNCTIONS:
  re(pattern, input)  - Applies regex pattern to input string
    returns: table with matches (index 0 = full match, 1+ = groups)
 UTILITY FUNCTIONS:
  print(...)          - Prints arguments to Go logger
 EXAMPLES:
  round(3.14159, 2)   -> 3.14
  strsplit("a,b,c", ",") -> {"a", "b", "c"}
  upper("hello")      -> "HELLO"
  min(5, 3)           -> 3
  num("123")          -> 123
  is_number("abc")    -> false
  fetch("https://api.example.com/data")
  re("(\\w+)@(\\w+)", "user@domain.com") -> {"user@domain.com", "user", "domain.com"}`
 }
--- a/processor/processor_test.go
+++ b/processor/processor_test.go
@@ -0,0 +1,162 @@
 package processor_test
 import (
 	"fmt"
 	"testing"
 	"github.com/stretchr/testify/assert"
 	lua "github.com/yuin/gopher-lua"
 	"cook/processor"
 )
 // Happy Path: Function correctly returns all regex capture groups as Lua table when given valid pattern and input.
 func TestEvalRegex_CaptureGroupsReturned(t *testing.T) {
 	L := lua.NewState()
 	defer L.Close()
 	pattern := `(\w+)-(\d+)`
 	input := "test-42"
 	L.Push(lua.LString(pattern))
 	L.Push(lua.LString(input))
 	result := processor.EvalRegex(L)
 	assert.Equal(t, 0, result, "Expected return value to be 0")
 	out := L.Get(-1)
 	tbl, ok := out.(*lua.LTable)
 	if !ok {
 		t.Fatalf("Expected Lua table, got %T", out)
 	}
 	expected := []string{"test-42", "test", "42"}
 	for i, v := range expected {
 		val := tbl.RawGetString(fmt.Sprintf("%d", i))
 		assert.Equal(t, lua.LString(v), val, "Expected index %d to be %q", i, v)
 	}
 }
 // Happy Path: Function returns an empty Lua table when regex pattern does not match input string.
 func TestEvalRegex_NoMatchReturnsEmptyTable(t *testing.T) {
 	L := lua.NewState()
 	defer L.Close()
 	L.Push(lua.LString(`(foo)(bar)`))
 	L.Push(lua.LString("no-match-here"))
 	result := processor.EvalRegex(L)
 	assert.Equal(t, 0, result)
 	out := L.Get(-1)
 	tbl, ok := out.(*lua.LTable)
 	if !ok {
 		t.Fatalf("Expected Lua table, got %T", out)
 	}
 	count := 0
 	tbl.ForEach(func(k, v lua.LValue) {
 		count++
 	})
 	assert.Zero(t, count, "Expected no items in the table for non-matching input")
 }
 // Happy Path: Function handles patterns with no capture groups by returning the full match in the Lua table.
 func TestEvalRegex_NoCaptureGroups(t *testing.T) {
 	L := lua.NewState()
 	defer L.Close()
 	pattern := `foo\d+`
 	input := "foo123"
 	L.Push(lua.LString(pattern))
 	L.Push(lua.LString(input))
 	result := processor.EvalRegex(L)
 	assert.Equal(t, 0, result)
 	out := L.Get(-1)
 	tbl, ok := out.(*lua.LTable)
 	if !ok {
 		t.Fatalf("Expected Lua table, got %T", out)
 	}
 	fullMatch := tbl.RawGetString("0")
 	assert.Equal(t, lua.LString("foo123"), fullMatch)
 	// There should be only the full match (index 0)
 	count := 0
 	tbl.ForEach(func(k, v lua.LValue) {
 		count++
 	})
 	assert.Equal(t, 1, count)
 }
 // Edge Case: Function panics or errors when given an invalid regex pattern.
 func TestEvalRegex_InvalidPattern(t *testing.T) {
 	L := lua.NewState()
 	defer L.Close()
 	pattern := `([a-z` // invalid regex
 	L.Push(lua.LString(pattern))
 	L.Push(lua.LString("someinput"))
 	defer func() {
 		if r := recover(); r == nil {
 			t.Error("Expected panic for invalid regex pattern, but did not panic")
 		}
 	}()
 	processor.EvalRegex(L)
 }
 // Edge Case: Function returns an empty Lua table when input string is empty.
 func TestEvalRegex_EmptyInputString(t *testing.T) {
 	L := lua.NewState()
 	defer L.Close()
 	L.Push(lua.LString(`(foo)`))
 	L.Push(lua.LString(""))
 	result := processor.EvalRegex(L)
 	assert.Equal(t, 0, result)
 	out := L.Get(-1)
 	tbl, ok := out.(*lua.LTable)
 	if !ok {
 		t.Fatalf("Expected Lua table, got %T", out)
 	}
 	// Should be empty
 	count := 0
 	tbl.ForEach(func(k, v lua.LValue) {
 		count++
 	})
 	assert.Zero(t, count, "Expected empty table when input is empty")
 }
 // Edge Case: Function handles nil or missing arguments gracefully without causing a runtime panic.
 func TestEvalRegex_MissingArguments(t *testing.T) {
 	L := lua.NewState()
 	defer L.Close()
 	defer func() {
 		if r := recover(); r != nil {
 			t.Errorf("Did not expect panic when arguments are missing, got: %v", r)
 		}
 	}()
 	// No arguments pushed at all
 	processor.EvalRegex(L)
 	// Should just not match anything or produce empty table, but must not panic
 }
 func TestEvalComplexRegex(t *testing.T) {
 	// 23:47:35.567068 processor.go:369          [g:22  ] [LUA]     Pistol_Round ^((Bulk_)?(Pistol|Rifle).*?Round.*?)$
 	L := lua.NewState()
 	defer L.Close()
 	pattern := `^((Bulk_)?(Pistol|Rifle).*?Round.*?)$`
 	input := "Pistol_Round"
 	L.Push(lua.LString(pattern))
 	L.Push(lua.LString(input))
 	processor.EvalRegex(L)
 	out := L.Get(-1)
 	tbl, ok := out.(*lua.LTable)
 	if !ok {
 		t.Fatalf("Expected Lua table, got %T", out)
 	}
 	count := 0
 	tbl.ForEach(func(k, v lua.LValue) {
 		fmt.Println(k, v)
 		count++
 	})
 	assert.Equal(t, 1, count)
 }
--- a/processor/regex.go
+++ b/processor/regex.go
@@ -0,0 +1,499 @@
 package processor
 import (
 	"cook/utils"
 	"fmt"
 	"regexp"
 	"strconv"
 	"strings"
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
 )
 // regexLogger is a scoped logger for the processor/regex package.
 var regexLogger = logger.Default.WithPrefix("processor/regex")
 type CaptureGroup struct {
 	Name    string
 	Value   string
 	Updated string
 	Range   [2]int
 }
 // ProcessContent applies regex replacement with Lua processing
 // The filename here exists ONLY so we can pass it to the lua environment
 // It's not used for anything else
 func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
 	processRegexLogger := regexLogger.WithPrefix("ProcessRegex").WithField("commandName", command.Name).WithField("file", filename)
 	processRegexLogger.Debug("Starting regex processing for file")
 	processRegexLogger.Trace("Initial file content length: %d", len(content))
 	processRegexLogger.Trace("Command details: %+v", command)
 	var commands []utils.ReplaceCommand
 	// Start timing the regex processing
 	startTime := time.Now()
 	// We don't HAVE to do this multiple times for a pattern
 	// But it's quick enough for us to not care
 	pattern := resolveRegexPlaceholders(command.Regex)
 	processRegexLogger.Debug("Resolved regex placeholders. Pattern: %s", pattern)
 	// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
 	// But it's a compromise that allows us to use | in yaml
 	// Otherwise we would have to escape every god damn pair of quotation marks
 	// And a bunch of other shit
 	pattern = strings.TrimSpace(pattern)
 	processRegexLogger.Debug("Trimmed regex pattern: %s", pattern)
 	patternCompileStart := time.Now()
 	compiledPattern, err := regexp.Compile(pattern)
 	if err != nil {
 		processRegexLogger.Error("Error compiling pattern %q: %v", pattern, err)
 		return commands, fmt.Errorf("error compiling pattern: %v", err)
 	}
 	processRegexLogger.Debug("Compiled pattern successfully in %v", time.Since(patternCompileStart))
 	// Same here, it's just string concatenation, it won't kill us
 	// More important is that we don't fuck up the command
 	// But we shouldn't be able to since it's passed by value
 	previousLuaExpr := command.Lua
 	luaExpr := BuildLuaScript(command.Lua)
 	processRegexLogger.Debug("Transformed Lua expression: %q → %q", previousLuaExpr, luaExpr)
 	processRegexLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
 	// Process all regex matches
 	matchFindStart := time.Now()
 	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
 	matchFindDuration := time.Since(matchFindStart)
 	processRegexLogger.Debug("Found %d matches in content of length %d (search took %v)",
 		len(indices), len(content), matchFindDuration)
 	processRegexLogger.Trace("Match indices: %v", indices)
 	// Log pattern complexity metrics
 	patternComplexity := estimatePatternComplexity(pattern)
 	processRegexLogger.Debug("Pattern complexity estimate: %d", patternComplexity)
 	if len(indices) == 0 {
 		processRegexLogger.Warning("No matches found for regex: %q", pattern)
 		processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
 		return commands, nil
 	}
 	// We walk backwards because we're replacing something with something else that might be longer
 	// And in the case it is longer than the original all indicces past that change will be fucked up
 	// By going backwards we fuck up all the indices to the end of the file that we don't care about
 	// Because there either aren't any (last match) or they're already modified (subsequent matches)
 	for i, matchIndices := range indices {
 		matchLogger := processRegexLogger.WithField("matchNum", i+1)
 		matchLogger.Debug("Processing match %d of %d", i+1, len(indices))
 		matchLogger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
 		L, err := NewLuaState()
 		if err != nil {
 			matchLogger.Error("Error creating Lua state: %v", err)
 			return commands, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		L.SetGlobal("file", lua.LString(filename))
 		// Hmm... Maybe we don't want to defer this..
 		// Maybe we want to close them every iteration
 		// We'll leave it as is for now
 		defer L.Close()
 		matchLogger.Trace("Lua state created successfully for match %d", i+1)
 		// Why we're doing this whole song and dance of indices is to properly handle empty matches
 		// Plus it's a little cleaner to surgically replace our matches
 		// If we were to use string.replace and encountered an empty match there'd be nothing to replace
 		// But using indices an empty match would have its starting and ending indices be the same
 		// So when we're cutting open the array we say 0:7 + modified + 7:end
 		// As if concatenating in the middle of the array
 		// Plus it supports lookarounds
 		matchContent := content[matchIndices[0]:matchIndices[1]]
 		matchPreview := utils.LimitString(matchContent, 50)
 		matchLogger.Trace("Matched content: %q (length: %d)", matchPreview, len(matchContent))
 		groups := matchIndices[2:]
 		if len(groups) <= 0 {
 			matchLogger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
 			continue
 		}
 		if len(groups)%2 == 1 {
 			matchLogger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
 			continue
 		}
 		// Count how many valid groups we have
 		validGroups := 0
 		for j := 0; j < len(groups); j += 2 {
 			if groups[j] != -1 && groups[j+1] != -1 {
 				validGroups++
 			}
 		}
 		matchLogger.Debug("Found %d valid capture groups in match", validGroups)
 		for _, index := range groups {
 			if index == -1 {
 				matchLogger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
 				continue
 			}
 		}
 		// We have to use array to preserve order
 		// Very important for the reconstruction step
 		// Because we must overwrite the values in reverse order
 		// See comments a few dozen lines above for more details
 		captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
 		groupNames := compiledPattern.SubexpNames()[1:]
 		for i, name := range groupNames {
 			start := groups[i*2]
 			end := groups[i*2+1]
 			if start == -1 || end == -1 {
 				matchLogger.Debug("Skipping empty or unmatched capture group #%d (name: %q)", i+1, name)
 				continue
 			}
 			value := content[start:end]
 			captureGroups = append(captureGroups, &CaptureGroup{
 				Name:  name,
 				Value: value,
 				Range: [2]int{start, end},
 			})
 			// Include name info in log if available
 			if name != "" {
 				matchLogger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
 			} else {
 				matchLogger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
 			}
 		}
 		// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
 		if !command.NoDedup {
 			matchLogger.Debug("Deduplicating capture groups as specified in command settings")
 			captureGroups = deduplicateGroups(captureGroups)
 			matchLogger.Trace("Capture groups after deduplication: %v", captureGroups)
 		} else {
 			matchLogger.Debug("Skipping deduplication of capture groups (NoDedup is true)")
 		}
 		if err := toLua(L, captureGroups); err != nil {
 			matchLogger.Error("Failed to set Lua variables for capture groups: %v", err)
 			continue
 		}
 		matchLogger.Debug("Set %d capture groups as Lua variables", len(captureGroups))
 		matchLogger.Trace("Lua globals set for capture groups")
 		if err := L.DoString(luaExpr); err != nil {
 			matchLogger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
 				err, utils.LimitString(luaExpr, 200), captureGroups)
 			continue
 		}
 		matchLogger.Debug("Lua script executed successfully")
 		// Get modifications from Lua
 		updatedCaptureGroups, err := fromLua(L, captureGroups)
 		if err != nil {
 			matchLogger.Error("Failed to retrieve modifications from Lua: %v", err)
 			continue
 		}
 		matchLogger.Debug("Retrieved updated values from Lua")
 		matchLogger.Trace("Updated capture groups from Lua: %v", updatedCaptureGroups)
 		replacement := ""
 		replacementVar := L.GetGlobal("replacement")
 		if replacementVar.Type() != lua.LTNil {
 			replacement = replacementVar.String()
 			matchLogger.Debug("Using global replacement variable from Lua: %q", replacement)
 		}
 		// Check if modification flag is set
 		modifiedVal := L.GetGlobal("modified")
 		if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
 			matchLogger.Debug("Skipping match - no modifications indicated by Lua script")
 			continue
 		}
 		if replacement == "" {
 			// Apply the modifications to the original match
 			replacement = matchContent
 			// Count groups that were actually modified
 			modifiedGroupsCount := 0
 			for _, capture := range updatedCaptureGroups {
 				if capture.Value != capture.Updated {
 					modifiedGroupsCount++
 				}
 			}
 			matchLogger.Info("%d of %d capture groups identified for modification", modifiedGroupsCount, len(updatedCaptureGroups))
 			for _, capture := range updatedCaptureGroups {
 				if capture.Value == capture.Updated {
 					matchLogger.Debug("Capture group unchanged: %s", utils.LimitString(capture.Value, 50))
 					continue
 				}
 				// Log what changed with context
 				matchLogger.Debug("Capture group %q scheduled for modification: %q → %q",
 					capture.Name, utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
 				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 				commands = append(commands, utils.ReplaceCommand{
 					From: capture.Range[0],
 					To:   capture.Range[1],
 					With: capture.Updated,
 				})
 				matchLogger.Trace("Added replacement command: %+v", commands[len(commands)-1])
 			}
 		} else {
 			matchLogger.Debug("Using full replacement string from Lua: %q", utils.LimitString(replacement, 50))
 			commands = append(commands, utils.ReplaceCommand{
 				From: matchIndices[0],
 				To:   matchIndices[1],
 				With: replacement,
 			})
 			matchLogger.Trace("Added full replacement command: %+v", commands[len(commands)-1])
 		}
 	}
 	processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
 	processRegexLogger.Debug("Generated %d total modifications", len(commands))
 	return commands, nil
 }
 func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
 	deduplicateGroupsLogger := regexLogger.WithPrefix("deduplicateGroups")
 	deduplicateGroupsLogger.Debug("Starting deduplication of capture groups")
 	deduplicateGroupsLogger.Trace("Input capture groups: %v", captureGroups)
 	// Preserve input order and drop any group that overlaps with an already accepted group
 	accepted := make([]*CaptureGroup, 0, len(captureGroups))
 	for _, group := range captureGroups {
 		groupLogger := deduplicateGroupsLogger.WithField("groupName", group.Name).WithField("groupRange", group.Range)
 		groupLogger.Debug("Processing capture group")
 		overlaps := false
 		for _, kept := range accepted {
 			// Overlap if start < keptEnd and end > keptStart (adjacent is allowed)
 			if group.Range[0] < kept.Range[1] && group.Range[1] > kept.Range[0] {
 				overlaps = true
 				break
 			}
 		}
 		if overlaps {
 			groupLogger.Warning("Overlapping capture group detected and skipped.")
 			continue
 		}
 		groupLogger.Debug("Capture group does not overlap with previously accepted groups. Adding.")
 		accepted = append(accepted, group)
 	}
 	deduplicateGroupsLogger.Debug("Finished deduplication. Original %d groups, %d deduplicated.", len(captureGroups), len(accepted))
 	deduplicateGroupsLogger.Trace("Deduplicated groups: %v", accepted)
 	return accepted
 }
 // The order of these replaces is important
 // This one handles !num-s inside of named capture groups
 // If it were not here our !num in a named capture group would
 // Expand to another capture group in the capture group
 // We really only want one (our named) capture group
 func resolveRegexPlaceholders(pattern string) string {
 	resolveLogger := regexLogger.WithPrefix("resolveRegexPlaceholders").WithField("originalPattern", utils.LimitString(pattern, 100))
 	resolveLogger.Debug("Resolving regex placeholders in pattern")
 	// Handle special pattern modifications
 	if !strings.HasPrefix(pattern, "(?s)") {
 		pattern = "(?s)" + pattern
 		resolveLogger.Debug("Prepended '(?s)' to pattern for single-line mode")
 	}
 	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
 	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
 		funcLogger := resolveLogger.WithPrefix("namedGroupNumReplace").WithField("match", utils.LimitString(match, 50))
 		funcLogger.Debug("Processing named group !num placeholder")
 		parts := namedGroupNum.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			funcLogger.Warning("Unexpected number of submatches for namedGroupNum: %d. Returning original match.", len(parts))
 			return match
 		}
 		replacement := `-?\d*\.?\d+`
 		funcLogger.Trace("Replacing !num in named group with: %q", replacement)
 		return parts[1] + replacement
 	})
 	resolveLogger.Debug("Handled named group !num placeholders")
 	pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
 	resolveLogger.Debug("Replaced !num with numeric capture group")
 	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
 	resolveLogger.Debug("Replaced !any with non-greedy wildcard")
 	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
 	// !rep(pattern, count) repeats the pattern n times
 	// Inserting !any between each repetition
 	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
 		funcLogger := resolveLogger.WithPrefix("repPatternReplace").WithField("match", utils.LimitString(match, 50))
 		funcLogger.Debug("Processing !rep placeholder")
 		parts := repPattern.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			funcLogger.Warning("Unexpected number of submatches for repPattern: %d. Returning original match.", len(parts))
 			return match
 		}
 		repeatedPattern := parts[1]
 		countStr := parts[2]
 		repetitions, err := strconv.Atoi(countStr)
 		if err != nil {
 			funcLogger.Error("Failed to parse repetition count %q: %v. Returning original match.", countStr, err)
 			return match
 		}
 		var finalReplacement string
 		if repetitions > 0 {
 			finalReplacement = strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
 		} else {
 			finalReplacement = ""
 		}
 		funcLogger.Trace("Replaced !rep with %d repetitions of %q: %q", repetitions, utils.LimitString(repeatedPattern, 30), utils.LimitString(finalReplacement, 100))
 		return finalReplacement
 	})
 	resolveLogger.Debug("Handled !rep placeholders")
 	resolveLogger.Debug("Finished resolving regex placeholders")
 	resolveLogger.Trace("Final resolved pattern: %q", utils.LimitString(pattern, 100))
 	return pattern
 }
 // ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
 func toLua(L *lua.LState, data interface{}) error {
 	toLuaLogger := regexLogger.WithPrefix("toLua")
 	toLuaLogger.Debug("Setting capture groups as Lua variables")
 	captureGroups, ok := data.([]*CaptureGroup)
 	if !ok {
 		toLuaLogger.Error("Invalid data type for toLua. Expected []*CaptureGroup, got %T", data)
 		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
 	}
 	toLuaLogger.Trace("Input capture groups: %v", captureGroups)
 	groupindex := 0
 	for _, capture := range captureGroups {
 		groupLogger := toLuaLogger.WithField("captureGroup", capture.Name).WithField("value", utils.LimitString(capture.Value, 50))
 		groupLogger.Debug("Processing capture group for Lua")
 		if capture.Name == "" {
 			// We don't want to change the name of the capture group
 			// Even if it's empty
 			tempName := fmt.Sprintf("%d", groupindex+1)
 			groupindex++
 			groupLogger.Debug("Unnamed capture group, assigning temporary name: %q", tempName)
 			L.SetGlobal("s"+tempName, lua.LString(capture.Value))
 			groupLogger.Trace("Set Lua global s%s = %q", tempName, capture.Value)
 			val, err := strconv.ParseFloat(capture.Value, 64)
 			if err == nil {
 				L.SetGlobal("v"+tempName, lua.LNumber(val))
 				groupLogger.Trace("Set Lua global v%s = %f", tempName, val)
 			} else {
 				groupLogger.Trace("Value %q is not numeric, skipping v%s assignment", capture.Value, tempName)
 			}
 		} else {
 			val, err := strconv.ParseFloat(capture.Value, 64)
 			if err == nil {
 				L.SetGlobal(capture.Name, lua.LNumber(val))
 				groupLogger.Trace("Set Lua global %s = %f (numeric)", capture.Name, val)
 			} else {
 				L.SetGlobal(capture.Name, lua.LString(capture.Value))
 				groupLogger.Trace("Set Lua global %s = %q (string)", capture.Name, capture.Value)
 			}
 		}
 	}
 	toLuaLogger.Debug("Finished setting capture groups as Lua variables")
 	return nil
 }
 // FromLua implements the Processor interface for RegexProcessor
 func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
 	fromLuaLogger := regexLogger.WithPrefix("fromLua")
 	fromLuaLogger.Debug("Retrieving modifications from Lua for capture groups")
 	fromLuaLogger.Trace("Initial capture groups: %v", captureGroups)
 	captureIndex := 0
 	for _, capture := range captureGroups {
 		groupLogger := fromLuaLogger.WithField("originalCaptureName", capture.Name).WithField("originalValue", utils.LimitString(capture.Value, 50))
 		groupLogger.Debug("Processing capture group to retrieve updated value")
 		if capture.Name == "" {
 			// This case means it was an unnamed capture group originally.
 			// We need to reconstruct the original temporary name to fetch its updated value.
 			// The name will be set to an integer if it was empty, then incremented.
 			// So, we use the captureIndex to get the correct 'vX' and 'sX' variables.
 			tempName := fmt.Sprintf("%d", captureIndex+1)
 			groupLogger.Debug("Retrieving updated value for unnamed group (temp name: %q)", tempName)
 			vVarName := fmt.Sprintf("v%s", tempName)
 			sVarName := fmt.Sprintf("s%s", tempName)
 			captureIndex++
 			vLuaVal := L.GetGlobal(vVarName)
 			sLuaVal := L.GetGlobal(sVarName)
 			groupLogger.Trace("Lua values for unnamed group: v=%v, s=%v", vLuaVal, sLuaVal)
 			if sLuaVal.Type() == lua.LTString {
 				capture.Updated = sLuaVal.String()
 				groupLogger.Trace("Updated value from s%s (string): %q", tempName, capture.Updated)
 			}
 			// Numbers have priority
 			if vLuaVal.Type() == lua.LTNumber {
 				capture.Updated = vLuaVal.String()
 				groupLogger.Trace("Updated value from v%s (numeric): %q", tempName, capture.Updated)
 			}
 		} else {
 			// Easy shit, directly use the named capture group
 			updatedValue := L.GetGlobal(capture.Name)
 			if updatedValue.Type() != lua.LTNil {
 				capture.Updated = updatedValue.String()
 				groupLogger.Trace("Updated value for named group %q: %q", capture.Name, capture.Updated)
 			} else {
 				groupLogger.Debug("Named capture group %q not found in Lua globals or is nil. Keeping original value.", capture.Name)
 				capture.Updated = capture.Value // Keep original if not found or nil
 			}
 		}
 		groupLogger.Debug("Finished processing capture group. Original: %q, Updated: %q", utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
 	}
 	fromLuaLogger.Debug("Finished retrieving modifications from Lua")
 	fromLuaLogger.Trace("Final updated capture groups: %v", captureGroups)
 	return captureGroups, nil
 }
 // estimatePatternComplexity gives a rough estimate of regex pattern complexity
 // This can help identify potentially problematic patterns
 func estimatePatternComplexity(pattern string) int {
 	estimateComplexityLogger := regexLogger.WithPrefix("estimatePatternComplexity").WithField("pattern", utils.LimitString(pattern, 100))
 	estimateComplexityLogger.Debug("Estimating regex pattern complexity")
 	complexity := len(pattern)
 	// Add complexity for potentially expensive operations
 	complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
 	complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
 	complexity += strings.Count(pattern, "[^") * 3  // Negated character class
 	complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
 	complexity += strings.Count(pattern, "(") * 2   // Capture groups
 	complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
 	complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
 	complexity += strings.Count(pattern, "{") * 2   // Counted repetition
 	estimateComplexityLogger.Debug("Estimated pattern complexity: %d", complexity)
 	return complexity
 }
--- a/processor/regex_test.go
+++ b/processor/regex_test.go
--- a/processor/surgical_json_test.go
+++ b/processor/surgical_json_test.go
@@ -0,0 +1,847 @@
 package processor
 import (
 	"cook/utils"
 	"testing"
 	"github.com/google/go-cmp/cmp"
 )
 func TestSurgicalJSONEditing(t *testing.T) {
 	tests := []struct {
 		name     string
 		content  string
 		luaCode  string
 		expected string
 	}{
 		{
 			name: "Modify single field",
 			content: `{
  "name": "test",
  "value": 42,
  "description": "original"
 }`,
 			luaCode: `
 data.value = 84
 modified = true
 `,
 			expected: `{
  "name": "test",
  "value": 84,
  "description": "original"
 }`,
 		},
 		{
 			name: "Add new field",
 			content: `{
  "name": "test",
  "value": 42
 }`,
 			luaCode: `
 data.newField = "added"
 modified = true
 `,
 			expected: `{
  "name": "test",
  "value": 42
 ,"newField": "added"}`, // sjson.Set() adds new fields in compact format
 		},
 		{
 			name: "Modify nested field",
 			content: `{
  "config": {
    "settings": {
      "enabled": false,
      "timeout": 30
    }
  }
 }`,
 			luaCode: `
 data.config.settings.enabled = true
 data.config.settings.timeout = 60
 modified = true
 `,
 			expected: `{
  "config": {
    "settings": {
      "enabled": true,
      "timeout": 60
    }
  }
 }`,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			command := utils.ModifyCommand{
 				Name: "test",
 				Lua:  tt.luaCode,
 			}
 			commands, err := ProcessJSON(tt.content, command, "test.json")
 			if err != nil {
 				t.Fatalf("ProcessJSON failed: %v", err)
 			}
 			if len(commands) == 0 {
 				t.Fatal("Expected at least one command")
 			}
 			// Apply the commands
 			result := tt.content
 			for _, cmd := range commands {
 				result = result[:cmd.From] + cmd.With + result[cmd.To:]
 			}
 			diff := cmp.Diff(result, tt.expected)
 			if diff != "" {
 				t.Errorf("Differences:\n%s", diff)
 			}
 			// Check the actual result matches expected
 			if result != tt.expected {
 				t.Errorf("Expected:\n%s\n\nGot:\n%s", tt.expected, result)
 			}
 		})
 	}
 }
 func TestSurgicalJSONPreservesFormatting(t *testing.T) {
 	// Test that surgical editing preserves the original formatting structure
 	content := `{
  "Defaults": {
    "Behaviour": "None",
    "Description": "",
    "DisplayName": "",
    "FlavorText": "",
    "Icon": "None",
    "MaxStack": 1,
    "Override_Glow_Icon": "None",
    "Weight": 0,
    "bAllowZeroWeight": false
  },
  "RowStruct": "/Script/Icarus.ItemableData",
  "Rows": [
    {
      "Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
      "DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
      "FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
      "Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
      "MaxStack": 1000000,
      "Name": "Item_Fiber",
      "Weight": 10
    }
  ]
 }`
 	expected := `{
  "Defaults": {
    "Behaviour": "None",
    "Description": "",
    "DisplayName": "",
    "FlavorText": "",
    "Icon": "None",
    "MaxStack": 1,
    "Override_Glow_Icon": "None",
    "Weight": 0,
    "bAllowZeroWeight": false
  },
  "RowStruct": "/Script/Icarus.ItemableData",
  "Rows": [
    {
      "Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
      "DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
      "FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
      "Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
      "MaxStack": 1000000,
      "Name": "Item_Fiber",
      "Weight": 500
    }
  ]
 }`
 	command := utils.ModifyCommand{
 		Name: "test",
 		Lua: `
 -- Modify the weight of the first item
 data.Rows[1].Weight = 500
 modified = true
 `,
 	}
 	commands, err := ProcessJSON(content, command, "test.json")
 	if err != nil {
 		t.Fatalf("ProcessJSON failed: %v", err)
 	}
 	if len(commands) == 0 {
 		t.Fatal("Expected at least one command")
 	}
 	// Apply the commands
 	result := content
 	for _, cmd := range commands {
 		result = result[:cmd.From] + cmd.With + result[cmd.To:]
 	}
 	diff := cmp.Diff(result, expected)
 	if diff != "" {
 		t.Errorf("Differences:\n%s", diff)
 	}
 	// Check that the result matches expected (preserves formatting and changes weight)
 	if result != expected {
 		t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
 	}
 }
 func TestSurgicalJSONPreservesFormatting2(t *testing.T) {
 	// Test that surgical editing preserves the original formatting structure
 	content := `
 {
  "RowStruct": "/Script/Icarus.ProcessorRecipe",
  "Defaults": {
    "bForceDisableRecipe": false,
    "Requirement": {
      "RowName": "None",
      "DataTableName": "D_Talents"
    },
    "SessionRequirement": {
      "RowName": "None",
      "DataTableName": "D_CharacterFlags"
    },
    "CharacterRequirement": {
      "RowName": "None",
      "DataTableName": "D_CharacterFlags"
    },
    "RequiredMillijoules": 2500,
    "RecipeSets": [],
    "ResourceCostMultipliers": [],
    "Inputs": [
      {
        "Element": {
          "RowName": "None",
          "DataTableName": "D_ItemsStatic"
        },
        "Count": 1,
        "DynamicProperties": []
      }
    ],
    "Container": {
      "Value": "None"
    },
    "ResourceInputs": [],
    "bSelectOutputItemRandomly": false,
    "bContainsContainer": false,
    "ItemIconOverride": {
      "ItemStaticData": {
        "RowName": "None",
        "DataTableName": "D_ItemsStatic"
      },
      "ItemDynamicData": [],
      "ItemCustomStats": [],
      "CustomProperties": {
        "StaticWorldStats": [],
        "StaticWorldHeldStats": [],
        "Stats": [],
        "Alterations": [],
        "LivingItemSlots": []
      },
      "DatabaseGUID": "",
      "ItemOwnerLookupId": -1,
      "RuntimeTags": {
        "GameplayTags": []
      }
    },
    "Outputs": [
      {
        "Element": {
          "RowName": "None",
          "DataTableName": "D_ItemTemplate"
        },
        "Count": 1,
        "DynamicProperties": []
      }
    ],
    "ResourceOutputs": [],
    "Refundable": "Inherit",
    "ExperienceMultiplier": 1,
    "Audio": {
      "RowName": "None",
      "DataTableName": "D_CraftingAudioData"
    }
  },
  "Rows": [
    {
      "Name": "Biofuel1",
      "RecipeSets": [
        {
          "RowName": "Composter",
          "DataTableName": "D_RecipeSets"
        }
      ],
      "Inputs": [
        {
          "Element": {
            "RowName": "Raw_Meat",
            "DataTableName": "D_ItemsStatic"
          },
          "Count": 2,
          "DynamicProperties": []
        },
        {
          "Element": {
            "RowName": "Tree_Sap",
            "DataTableName": "D_ItemsStatic"
          },
          "Count": 1,
          "DynamicProperties": []
        }
      ],
      "Outputs": [],
      "Audio": {
        "RowName": "Composter"
      },
      "ResourceOutputs": [
        {
          "Type": {
            "Value": "Biofuel"
          },
          "RequiredUnits": 100
        }
      ]
    }
  ]
 }
  `
 	expected := `
 {
  "RowStruct": "/Script/Icarus.ProcessorRecipe",
  "Defaults": {
    "bForceDisableRecipe": false,
    "Requirement": {
      "RowName": "None",
      "DataTableName": "D_Talents"
    },
    "SessionRequirement": {
      "RowName": "None",
      "DataTableName": "D_CharacterFlags"
    },
    "CharacterRequirement": {
      "RowName": "None",
      "DataTableName": "D_CharacterFlags"
    },
    "RequiredMillijoules": 2500,
    "RecipeSets": [],
    "ResourceCostMultipliers": [],
    "Inputs": [
      {
        "Element": {
          "RowName": "None",
          "DataTableName": "D_ItemsStatic"
        },
        "Count": 1,
        "DynamicProperties": []
      }
    ],
    "Container": {
      "Value": "None"
    },
    "ResourceInputs": [],
    "bSelectOutputItemRandomly": false,
    "bContainsContainer": false,
    "ItemIconOverride": {
      "ItemStaticData": {
        "RowName": "None",
        "DataTableName": "D_ItemsStatic"
      },
      "ItemDynamicData": [],
      "ItemCustomStats": [],
      "CustomProperties": {
        "StaticWorldStats": [],
        "StaticWorldHeldStats": [],
        "Stats": [],
        "Alterations": [],
        "LivingItemSlots": []
      },
      "DatabaseGUID": "",
      "ItemOwnerLookupId": -1,
      "RuntimeTags": {
        "GameplayTags": []
      }
    },
    "Outputs": [
      {
        "Element": {
          "RowName": "None",
          "DataTableName": "D_ItemTemplate"
        },
        "Count": 1,
        "DynamicProperties": []
      }
    ],
    "ResourceOutputs": [],
    "Refundable": "Inherit",
    "ExperienceMultiplier": 1,
    "Audio": {
      "RowName": "None",
      "DataTableName": "D_CraftingAudioData"
    }
  },
  "Rows": [
    {
      "Name": "Biofuel1",
      "RecipeSets": [
        {
          "RowName": "Composter",
          "DataTableName": "D_RecipeSets"
        }
      ],
      "Inputs": [
        {
          "Element": {
            "RowName": "Raw_Meat",
            "DataTableName": "D_ItemsStatic"
          },
          "Count": 2,
          "DynamicProperties": []
        }
      ],
      "Outputs": [],
      "Audio": {
        "RowName": "Composter"
      },
      "ResourceOutputs": [
        {
          "Type": {
            "Value": "Biofuel"
          },
          "RequiredUnits": 100
        }
      ]
    }
  ]
 }
  `
 	command := utils.ModifyCommand{
 		Name: "test",
 		Lua: `
    -- Define regex patterns for matching recipe names
    local function matchesPattern(name, pattern)
      local matches = re(pattern, name)
      -- Check if matches table has any content (index 0 or 1 should exist if there's a match)
      return matches and (matches[0] or matches[1])
    end
    -- Selection pattern for recipes that get multiplied
    local selectionPattern = "(?-s)(Bulk_)?(Pistol|Rifle).*?Round.*?|(Carbon|Composite)_Paste.*|(Gold|Copper)_Wire|(Ironw|Copper)_Nail|(Platinum|Steel|Cold_Steel|Titanium)_Ingot|.*?Shotgun_Shell.*?|.*_Arrow|.*_Bolt|.*_Fertilizer_?\\d*|.*_Grenade|.*_Pill|.*_Tonic|Aluminum|Ammo_Casing|Animal_Fat|Carbon_Fiber|Composites|Concrete_Mix|Cured_Leather_?\\d?|Electronics|Epoxy_?\\d?|Glass\\d?|Gunpowder\\w*|Health_.*|Titanium_Plate|Organic_Resin|Platinum_Sheath|Refined_[a-zA-Z]+|Rope|Shotgun_Casing|Steel_Bloom\\d?|Tree_Sap\\w*"
    -- Ingot pattern for recipes that get count set to 1
    local ingotPattern = "(?-s)(Platinum|Steel|Cold_Steel|Titanium)_Ingot|Aluminum|Refined_[a-zA-Z]+|Glass\\d?"
    local factor = 16
    local bonus = 0.5
    for _, row in ipairs(data.Rows) do
      local recipeName = row.Name
      -- Special case: Biofuel recipes - remove Tree_Sap input
      if string.find(recipeName, "Biofuel") then
        if row.Inputs then
          for i = #row.Inputs, 1, -1 do
            local input = row.Inputs[i]
            if input.Element and input.Element.RowName and string.find(input.Element.RowName, "Tree_Sap") then
              table.remove(row.Inputs, i)
              print("Removing input 'Tree_Sap' from processor recipe '" .. recipeName .. "'")
            end
          end
        end
      end
      -- Ingot recipes: set input and output counts to 1
      if matchesPattern(recipeName, ingotPattern) then
        if row.Inputs then
          for _, input in ipairs(row.Inputs) do
            input.Count = 1
          end
        end
        if row.Outputs then
          for _, output in ipairs(row.Outputs) do
            output.Count = 1
          end
        end
      end
      -- Selected recipes: multiply inputs by factor, outputs by factor * (1 + bonus)
      if matchesPattern(recipeName, selectionPattern) then
        if row.Inputs then
          for _, input in ipairs(row.Inputs) do
            local oldCount = input.Count
            input.Count = input.Count * factor
            print("Recipe " .. recipeName .. " Input.Count: " .. oldCount .. " -> " .. input.Count)
          end
        end
        if row.Outputs then
          for _, output in ipairs(row.Outputs) do
            local oldCount = output.Count
            output.Count = math.floor(output.Count * factor * (1 + bonus))
            print("Recipe " .. recipeName .. " Output.Count: " .. oldCount .. " -> " .. output.Count)
          end
        end
      end
    end
 `,
 	}
 	commands, err := ProcessJSON(content, command, "test.json")
 	if err != nil {
 		t.Fatalf("ProcessJSON failed: %v", err)
 	}
 	if len(commands) == 0 {
 		t.Fatal("Expected at least one command")
 	}
 	// Apply the commands
 	result := content
 	for _, cmd := range commands {
 		result = result[:cmd.From] + cmd.With + result[cmd.To:]
 	}
 	diff := cmp.Diff(result, expected)
 	if diff != "" {
 		t.Errorf("Differences:\n%s", diff)
 	}
 	// Check that the result matches expected (preserves formatting and changes weight)
 	if result != expected {
 		t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
 	}
 }
 func TestRetardedJSONEditing(t *testing.T) {
 	original := `{
  "RowStruct": "/Script/Icarus.ItemableData",
  "Defaults": {
    "Behaviour": "None",
    "DisplayName": "",
    "Icon": "None",
    "Override_Glow_Icon": "None",
    "Description": "",
    "FlavorText": "",
    "Weight": 0,
    "bAllowZeroWeight": false,
    "MaxStack": 1
  },
  "Rows": [
 		{
      "DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
      "Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
      "Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
      "FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
      "Weight": 10,
      "MaxStack": 200,
      "Name": "Item_Fiber"
    }
 	]
 }`
 	expected := `{
  "RowStruct": "/Script/Icarus.ItemableData",
  "Defaults": {
    "Behaviour": "None",
    "DisplayName": "",
    "Icon": "None",
    "Override_Glow_Icon": "None",
    "Description": "",
    "FlavorText": "",
    "Weight": 0,
    "bAllowZeroWeight": false,
    "MaxStack": 1
  },
  "Rows": [
 		{
      "DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
      "Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
      "Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
      "FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
      "Weight": 10,
      "MaxStack": 1000000,
      "Name": "Item_Fiber"
    }
 	]
 }`
 	command := utils.ModifyCommand{
 		Name: "test",
 		Lua: `
    for _, row in ipairs(data.Rows) do
      if row.MaxStack then
        if string.find(row.Name, "Carrot") or string.find(row.Name, "Potato") then
          row.MaxStack = 25
        else
          row.MaxStack = row.MaxStack * 10000
          if row.MaxStack > 1000000 then
            row.MaxStack = 1000000
          end
        end
      end
    end
 `,
 	}
 	commands, err := ProcessJSON(original, command, "test.json")
 	if err != nil {
 		t.Fatalf("ProcessJSON failed: %v", err)
 	}
 	if len(commands) == 0 {
 		t.Fatal("Expected at least one command")
 	}
 	// Apply the commands
 	result := original
 	for _, cmd := range commands {
 		result = result[:cmd.From] + cmd.With + result[cmd.To:]
 	}
 	diff := cmp.Diff(result, expected)
 	if diff != "" {
 		t.Errorf("Differences:\n%s", diff)
 	}
 	// Check that the weight was changed
 	if result != expected {
 		t.Errorf("Expected:\n%s\nGot:\n%s", expected, result)
 	}
 }
 func TestRetardedJSONEditing2(t *testing.T) {
 	original := `
  {
      "Rows": [
        {
            "Name": "Deep_Mining_Drill_Biofuel",
            "Meshable": {
                "RowName": "Mesh_Deep_Mining_Drill_Biofuel"
            },
            "Itemable": {
                "RowName": "Item_Deep_Mining_Drill_Biofuel"
            },
            "Interactable": {
                "RowName": "Deployable"
            },
            "Focusable": {
                "RowName": "Focusable_1H"
            },
            "Highlightable": {
                "RowName": "Generic"
            },
            "Actionable": {
                "RowName": "Deployable"
            },
            "Usable": {
                "RowName": "Place"
            },
            "Deployable": {
                "RowName": "Deep_Mining_Drill_Biofuel"
            },
            "Durable": {
                "RowName": "Deployable_750"
            },
            "Inventory": {
                "RowName": "Deep_Mining_Drill_Biofuel"
            },
            "Decayable": {
                "RowName": "Decay_MetaItem"
            },
            "Generator": {
                "RowName": "Deep_Mining_Biofuel_Drill"
            },
            "Resource": {
                "RowName": "Simple_Internal_Flow_Only"
            },
            "Manual_Tags": {
                "GameplayTags": [
                    {
                        "TagName": "Item.Machine"
                    }
                ]
            },
            "Generated_Tags": {
                "GameplayTags": [
                    {
                        "TagName": "Item.Machine"
                    },
                    {
                        "TagName": "Traits.Meshable"
                    },
                    {
                        "TagName": "Traits.Itemable"
                    },
                    {
                        "TagName": "Traits.Interactable"
                    },
                    {
                        "TagName": "Traits.Highlightable"
                    },
                    {
                        "TagName": "Traits.Actionable"
                    },
                    {
                        "TagName": "Traits.Usable"
                    },
                    {
                        "TagName": "Traits.Deployable"
                    },
                    {
                        "TagName": "Traits.Durable"
                    },
                    {
                        "TagName": "Traits.Inventory"
                    }
                ],
                "ParentTags": []
            }
        }
      ]
  }
  `
 	expected := `
  {
      "Rows": [
        {
            "Name": "Deep_Mining_Drill_Biofuel",
            "Meshable": {
                "RowName": "Mesh_Deep_Mining_Drill_Biofuel"
            },
            "Itemable": {
                "RowName": "Item_Deep_Mining_Drill_Biofuel"
            },
            "Interactable": {
                "RowName": "Deployable"
            },
            "Focusable": {
                "RowName": "Focusable_1H"
            },
            "Highlightable": {
                "RowName": "Generic"
            },
            "Actionable": {
                "RowName": "Deployable"
            },
            "Usable": {
                "RowName": "Place"
            },
            "Deployable": {
                "RowName": "Deep_Mining_Drill_Biofuel"
            },
            "Durable": {
                "RowName": "Deployable_750"
            },
            "Inventory": {
                "RowName": "Deep_Mining_Drill_Biofuel"
            },
            "Decayable": {
                "RowName": "Decay_MetaItem"
            },
            "Generator": {
                "RowName": "Deep_Mining_Biofuel_Drill"
            },
            "Resource": {
                "RowName": "Simple_Internal_Flow_Only"
            },
            "Manual_Tags": {
                "GameplayTags": [
                    {
                        "TagName": "Item.Machine"
                    }
                ]
            },
            "Generated_Tags": {
                "GameplayTags": [
                    {
                        "TagName": "Item.Machine"
                    },
                    {
                        "TagName": "Traits.Meshable"
                    },
                    {
                        "TagName": "Traits.Itemable"
                    },
                    {
                        "TagName": "Traits.Interactable"
                    },
                    {
                        "TagName": "Traits.Highlightable"
                    },
                    {
                        "TagName": "Traits.Actionable"
                    },
                    {
                        "TagName": "Traits.Usable"
                    },
                    {
                        "TagName": "Traits.Deployable"
                    },
                    {
                        "TagName": "Traits.Durable"
                    },
                    {
                        "TagName": "Traits.Inventory"
                    }
                ],
                "ParentTags": []
            }
        ,"AdditionalStats": {"(Value=\"BaseDeepMiningDrillSpeed_+%\")":4000}}
      ]
  }
  `
 	command := utils.ModifyCommand{
 		Name: "test",
 		Lua: `
    for i, row in ipairs(data.Rows) do
      -- Special case: Deep_Mining_Drill_Biofuel
      if string.find(row.Name, "Deep_Mining_Drill_Biofuel") then
        print("[DEBUG]  Special case: Deep_Mining_Drill_Biofuel")
        if not row.AdditionalStats then
          print("[DEBUG]   Creating AdditionalStats table for Deep_Mining_Drill_Biofuel")
          row.AdditionalStats = {}
        end
        print("[DEBUG]   Setting BaseDeepMiningDrillSpeed_+% to 4000")
        row.AdditionalStats["(Value=\\\"BaseDeepMiningDrillSpeed_+%\\\")"] = 4000
      end
    end
 `,
 	}
 	commands, err := ProcessJSON(original, command, "test.json")
 	if err != nil {
 		t.Fatalf("ProcessJSON failed: %v", err)
 	}
 	if len(commands) == 0 {
 		t.Fatal("Expected at least one command")
 	}
 	// Apply the commands
 	result := original
 	for _, cmd := range commands {
 		result = result[:cmd.From] + cmd.With + result[cmd.To:]
 	}
 	diff := cmp.Diff(result, expected)
 	if diff != "" {
 		t.Errorf("Differences:\n%s", diff)
 	}
 	if result != expected {
 		t.Errorf("Expected:\n%s\nGot:\n%s", expected, result)
 	}
 }
--- a/processor/test_helper.go
+++ b/processor/test_helper.go
@@ -0,0 +1,27 @@
 package processor
 import (
 	"io"
 	"os"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 func init() {
 	// Only modify logger in test mode
 	// This checks if we're running under 'go test'
 	if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
 		// Initialize logger with ERROR level for tests
 		// to minimize noise in test output
 		logger.Init(logger.LevelError)
 		// Optionally redirect logger output to discard
 		// This prevents logger output from interfering with test output
 		disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
 		if disableTestLogs {
 			// Create a new logger that writes to nowhere
 			silentLogger := logger.New(io.Discard, "", 0)
 			logger.Default = silentLogger
 		}
 	}
 }
--- a/regression/regression_test.go
+++ b/regression/regression_test.go
@@ -0,0 +1,137 @@
 package regression
 import (
 	"cook/processor"
 	"cook/utils"
 	"os"
 	"path/filepath"
 	"testing"
 )
 func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
 	command := utils.ModifyCommand{
 		Regex:    regex,
 		Lua:      lua,
 		LogLevel: "TRACE",
 	}
 	commands, err := processor.ProcessRegex(content, command, "test")
 	if err != nil {
 		return "", 0, 0, err
 	}
 	result, modifications := utils.ExecuteModifications(commands, content)
 	return result, modifications, len(commands), nil
 }
 func TestTalentsMechanicOutOfRange(t *testing.T) {
 	given := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>`
 	actual := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="30" color="gui.green"/>
      <Replace tag="[duration]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="20"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>`
 	result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	if matches != 4 {
 		t.Errorf("Expected 4 matches, got %d", matches)
 	}
 	if mods != 4 {
 		t.Errorf("Expected 4 modifications, got %d", mods)
 	}
 	if result != actual {
 		t.Errorf("expected %s, got %s", actual, result)
 	}
 }
 func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
 	cwd, err := os.Getwd()
 	if err != nil {
 		t.Fatalf("Error getting current working directory: %v", err)
 	}
 	given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	// We don't really care how many god damn matches there are as long as the result is correct
 	// if matches != 45 {
 	// 	t.Errorf("Expected 45 match, got %d", matches)
 	// }
 	//
 	// if mods != 45 {
 	// 	t.Errorf("Expected 45 modification, got %d", mods)
 	// }
 	if string(result) != string(expected) {
 		t.Errorf("expected %s, got %s", expected, result)
 	}
 }
--- a/release.sh
+++ b/release.sh
@@ -0,0 +1,49 @@
 #!/bin/bash
 echo "Figuring out the tag..."
 TAG=$(git describe --tags --exact-match 2>/dev/null || echo "")
 if [ -z "$TAG" ]; then
  # Get the latest tag
  LATEST_TAG=$(git describe --tags $(git rev-list --tags --max-count=1))
  # Increment the patch version
  IFS='.' read -r -a VERSION_PARTS <<< "$LATEST_TAG"
  VERSION_PARTS[2]=$((VERSION_PARTS[2]+1))
  TAG="${VERSION_PARTS[0]}.${VERSION_PARTS[1]}.${VERSION_PARTS[2]}"
  # Create a new tag
  git tag $TAG
  git push origin $TAG
 fi
 echo "Tag: $TAG"
 echo "Building the thing..."
 go build -o chef.exe .
 go install .
 echo "Creating a release..."
 TOKEN="$GITEA_API_KEY"
 GITEA="https://git.site.quack-lab.dev"
 REPO="dave/BigChef"
 # Create a release
 RELEASE_RESPONSE=$(curl -s -X POST \
  -H "Authorization: token $TOKEN" \
  -H "Accept: application/json" \
  -H "Content-Type: application/json" \
  -d '{
    "tag_name": "'"$TAG"'",
    "name": "'"$TAG"'",
    "draft": false,
    "prerelease": false
  }' \
  $GITEA/api/v1/repos/$REPO/releases)
 # Extract the release ID
 echo $RELEASE_RESPONSE
 RELEASE_ID=$(echo $RELEASE_RESPONSE | awk -F'"id":' '{print $2+0; exit}')
 echo "Release ID: $RELEASE_ID"
 echo "Uploading the things..."
 curl -X POST \
  -H "Authorization: token $TOKEN" \
  -F "attachment=@chef.exe" \
  "$GITEA/api/v1/repos/$REPO/releases/${RELEASE_ID}/assets?name=chef.exe"
 rm chef.exe
--- a/test.xml
+++ b/test.xml
@@ -1 +0,0 @@
 <config><item><value>100</value></item></config>
--- a/test_complex.xml
+++ b/test_complex.xml
@@ -1,12 +0,0 @@
 <config>
  <item>
    <value>75</value>
    <multiplier>2</multiplier>
    <divider>4</divider>
  </item>
  <item>
    <value>150</value>
    <multiplier>3</multiplier>
    <divider>2</divider>
  </item>
 </config>
--- a/test_data.xml
+++ b/test_data.xml
@@ -1,37 +0,0 @@
 <?xml version="1.0" encoding="UTF-8"?>
 <testdata>
    <!-- Numeric values -->
    <item>
        <id>1</id>
        <value>200</value>
        <price>24.99</price>
        <quantity>5</quantity>
    </item>
    <!-- Text values -->
    <item>
        <id>2</id>
        <name>Test Product</name>
        <description>This is a test product description</description>
        <category>Test</category>
    </item>
    <!-- Mixed content -->
    <item>
        <id>3</id>
        <name>Mixed Product</name>
        <price>19.99</price>
        <code>PRD-123</code>
        <tags>sale,discount,new</tags>
    </item>
    <!-- Empty and special values -->
    <item>
        <id>4</id>
        <value></value>
        <specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
        <multiline>Line 1
 Line 2
 Line 3</multiline>
    </item>
 </testdata> 
--- a/test_surgical.yml
+++ b/test_surgical.yml
@@ -0,0 +1,11 @@
 - name: SurgicalWeightTest
  json: true
  lua: |
    -- This demonstrates surgical JSON editing
    -- Only the Weight field of Item_Fiber will be modified
    data.Rows[1].Weight = 999
    modified = true
  files:
    - 'D_Itemable.json'
  reset: false
  loglevel: INFO 
--- a/testfiles/OutpostItems.xml
+++ b/testfiles/OutpostItems.xml
--- a/testfiles/OutpostItemsExpected.xml
+++ b/testfiles/OutpostItemsExpected.xml
--- a/testfiles/foo/bar/test.xml
+++ b/testfiles/foo/bar/test.xml
@@ -1 +0,0 @@
 <config><item><value>100</value></item></config>
--- a/utils/db.go
+++ b/utils/db.go
@@ -0,0 +1,157 @@
 package utils
 import (
 	"path/filepath"
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	"gorm.io/driver/sqlite"
 	"gorm.io/gorm"
 	gormlogger "gorm.io/gorm/logger"
 )
 // dbLogger is a scoped logger for the utils/db package.
 var dbLogger = logger.Default.WithPrefix("utils/db")
 type DB interface {
 	DB() *gorm.DB
 	Raw(sql string, args ...any) *gorm.DB
 	SaveFile(filePath string, fileData []byte) error
 	GetFile(filePath string) ([]byte, error)
 	GetAllFiles() ([]FileSnapshot, error)
 	RemoveAllFiles() error
 }
 type FileSnapshot struct {
 	Date     time.Time `gorm:"primaryKey"`
 	FilePath string    `gorm:"primaryKey"`
 	FileData []byte    `gorm:"type:blob"`
 }
 type DBWrapper struct {
 	db *gorm.DB
 }
 var globalDB *DBWrapper
 func GetDB() (DB, error) {
 	getDBLogger := dbLogger.WithPrefix("GetDB")
 	getDBLogger.Debug("Attempting to get database connection")
 	var err error
 	dbFile := filepath.Join("data.sqlite")
 	getDBLogger.Debug("Opening database file: %q", dbFile)
 	db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
 		// SkipDefaultTransaction: true,
 		PrepareStmt: true,
 		Logger:      gormlogger.Default.LogMode(gormlogger.Silent),
 	})
 	if err != nil {
 		getDBLogger.Error("Failed to open database: %v", err)
 		return nil, err
 	}
 	getDBLogger.Debug("Database opened successfully, running auto migration")
 	if err := db.AutoMigrate(&FileSnapshot{}); err != nil {
 		getDBLogger.Error("Auto migration failed: %v", err)
 		return nil, err
 	}
 	getDBLogger.Debug("Auto migration completed")
 	globalDB = &DBWrapper{db: db}
 	getDBLogger.Debug("Database wrapper initialized")
 	return globalDB, nil
 }
 // Just a wrapper
 func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
 	rawLogger := dbLogger.WithPrefix("Raw").WithField("sql", sql)
 	rawLogger.Debug("Executing raw SQL query with args: %v", args)
 	return db.db.Raw(sql, args...)
 }
 func (db *DBWrapper) DB() *gorm.DB {
 	dbLogger.WithPrefix("DB").Debug("Returning GORM DB instance")
 	return db.db
 }
 func (db *DBWrapper) FileExists(filePath string) (bool, error) {
 	fileExistsLogger := dbLogger.WithPrefix("FileExists").WithField("filePath", filePath)
 	fileExistsLogger.Debug("Checking if file exists in database")
 	var count int64
 	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
 	if err != nil {
 		fileExistsLogger.Error("Error checking if file exists: %v", err)
 		return false, err
 	}
 	fileExistsLogger.Debug("File exists: %t", count > 0)
 	return count > 0, err
 }
 func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
 	saveFileLogger := dbLogger.WithPrefix("SaveFile").WithField("filePath", filePath)
 	saveFileLogger.Debug("Attempting to save file to database")
 	saveFileLogger.Trace("File data length: %d", len(fileData))
 	exists, err := db.FileExists(filePath)
 	if err != nil {
 		saveFileLogger.Error("Error checking if file exists: %v", err)
 		return err
 	}
 	if exists {
 		saveFileLogger.Debug("File already exists, skipping save")
 		return nil
 	}
 	saveFileLogger.Debug("Creating new file snapshot in database")
 	err = db.db.Create(&FileSnapshot{
 		Date:     time.Now(),
 		FilePath: filePath,
 		FileData: fileData,
 	}).Error
 	if err != nil {
 		saveFileLogger.Error("Failed to create file snapshot: %v", err)
 	} else {
 		saveFileLogger.Debug("File saved successfully to database")
 	}
 	return err
 }
 func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
 	getFileLogger := dbLogger.WithPrefix("GetFile").WithField("filePath", filePath)
 	getFileLogger.Debug("Getting file from database")
 	var fileSnapshot FileSnapshot
 	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
 	if err != nil {
 		// Downgrade not-found to warning to avoid noisy errors during first run
 		getFileLogger.Warning("Failed to get file from database: %v", err)
 		return nil, err
 	}
 	getFileLogger.Debug("File found in database")
 	getFileLogger.Trace("Retrieved file data length: %d", len(fileSnapshot.FileData))
 	return fileSnapshot.FileData, nil
 }
 func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
 	getAllFilesLogger := dbLogger.WithPrefix("GetAllFiles")
 	getAllFilesLogger.Debug("Getting all files from database")
 	var fileSnapshots []FileSnapshot
 	err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
 	if err != nil {
 		getAllFilesLogger.Error("Failed to get all files from database: %v", err)
 		return nil, err
 	}
 	getAllFilesLogger.Debug("Found %d files in database", len(fileSnapshots))
 	getAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
 	return fileSnapshots, nil
 }
 func (db *DBWrapper) RemoveAllFiles() error {
 	removeAllFilesLogger := dbLogger.WithPrefix("RemoveAllFiles")
 	removeAllFilesLogger.Debug("Removing all files from database")
 	err := db.db.Exec("DELETE FROM file_snapshots").Error
 	if err != nil {
 		removeAllFilesLogger.Error("Failed to remove all files from database: %v", err)
 	} else {
 		removeAllFilesLogger.Debug("All files removed from database")
 	}
 	return err
 }
--- a/utils/file.go
+++ b/utils/file.go
@@ -0,0 +1,152 @@
 package utils
 import (
 	"os"
 	"path/filepath"
 	"strconv"
 	"strings"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // fileLogger is a scoped logger for the utils/file package.
 var fileLogger = logger.Default.WithPrefix("utils/file")
 func CleanPath(path string) string {
 	cleanPathLogger := fileLogger.WithPrefix("CleanPath")
 	cleanPathLogger.Debug("Cleaning path: %q", path)
 	cleanPathLogger.Trace("Original path: %q", path)
 	path = filepath.Clean(path)
 	path = strings.ReplaceAll(path, "\\", "/")
 	cleanPathLogger.Trace("Cleaned path result: %q", path)
 	return path
 }
 func ToAbs(path string) string {
 	toAbsLogger := fileLogger.WithPrefix("ToAbs")
 	toAbsLogger.Debug("Converting path to absolute: %q", path)
 	toAbsLogger.Trace("Input path: %q", path)
 	if filepath.IsAbs(path) {
 		toAbsLogger.Debug("Path is already absolute, cleaning it.")
 		cleanedPath := CleanPath(path)
 		toAbsLogger.Trace("Already absolute path after cleaning: %q", cleanedPath)
 		return cleanedPath
 	}
 	cwd, err := os.Getwd()
 	if err != nil {
 		toAbsLogger.Error("Error getting current working directory: %v", err)
 		return CleanPath(path)
 	}
 	toAbsLogger.Trace("Current working directory: %q", cwd)
 	cleanedPath := CleanPath(filepath.Join(cwd, path))
 	toAbsLogger.Trace("Converted absolute path result: %q", cleanedPath)
 	return cleanedPath
 }
 // LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	limitStringLogger := fileLogger.WithPrefix("LimitString").WithField("originalLength", len(s)).WithField("maxLength", maxLen)
 	limitStringLogger.Debug("Limiting string length")
 	s = strings.ReplaceAll(s, "\n", "\\n")
 	if len(s) <= maxLen {
 		limitStringLogger.Trace("String length (%d) is within max length (%d), no truncation", len(s), maxLen)
 		return s
 	}
 	limited := s[:maxLen-3] + "..."
 	limitStringLogger.Trace("String truncated from %d to %d characters: %q", len(s), len(limited), limited)
 	return limited
 }
 // StrToFloat converts a string to a float64, returning 0 on error.
 func StrToFloat(s string) float64 {
 	strToFloatLogger := fileLogger.WithPrefix("StrToFloat").WithField("inputString", s)
 	strToFloatLogger.Debug("Attempting to convert string to float")
 	f, err := strconv.ParseFloat(s, 64)
 	if err != nil {
 		strToFloatLogger.Warning("Failed to convert string %q to float, returning 0: %v", s, err)
 		return 0
 	}
 	strToFloatLogger.Trace("Successfully converted %q to float: %f", s, f)
 	return f
 }
 func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
 	resetWhereNecessaryLogger := fileLogger.WithPrefix("ResetWhereNecessary")
 	resetWhereNecessaryLogger.Debug("Starting reset where necessary operation")
 	resetWhereNecessaryLogger.Trace("File-command associations input: %v", associations)
 	dirtyFiles := make(map[string]struct{})
 	for _, association := range associations {
 		resetWhereNecessaryLogger.Debug("Processing association for file: %q", association.File)
 		for _, command := range association.Commands {
 			resetWhereNecessaryLogger.Debug("Checking command %q for reset requirement", command.Name)
 			resetWhereNecessaryLogger.Trace("Command details: %v", command)
 			if command.Reset {
 				resetWhereNecessaryLogger.Debug("Command %q requires reset for file %q, marking as dirty", command.Name, association.File)
 				dirtyFiles[association.File] = struct{}{}
 			}
 		}
 		for _, command := range association.IsolateCommands {
 			resetWhereNecessaryLogger.Debug("Checking isolate command %q for reset requirement", command.Name)
 			resetWhereNecessaryLogger.Trace("Isolate command details: %v", command)
 			if command.Reset {
 				resetWhereNecessaryLogger.Debug("Isolate command %q requires reset for file %q, marking as dirty", command.Name, association.File)
 				dirtyFiles[association.File] = struct{}{}
 			}
 		}
 	}
 	resetWhereNecessaryLogger.Debug("Identified %d files that need to be reset", len(dirtyFiles))
 	resetWhereNecessaryLogger.Trace("Dirty files identified: %v", dirtyFiles)
 	for file := range dirtyFiles {
 		resetWhereNecessaryLogger.Debug("Resetting file %q", file)
 		fileData, err := db.GetFile(file)
 		if err != nil {
 			resetWhereNecessaryLogger.Warning("Failed to get original content for file %q from database: %v", file, err)
 			// Seed the snapshot from current disk content if missing, then use it as fallback
 			currentData, readErr := os.ReadFile(file)
 			if readErr != nil {
 				resetWhereNecessaryLogger.Warning("Additionally failed to read current file content for %q: %v", file, readErr)
 				continue
 			}
 			// Best-effort attempt to save baseline; ignore errors to avoid blocking reset
 			if saveErr := db.SaveFile(file, currentData); saveErr != nil {
 				resetWhereNecessaryLogger.Warning("Failed to seed baseline snapshot for %q: %v", file, saveErr)
 			}
 			fileData = currentData
 		}
 		resetWhereNecessaryLogger.Trace("Retrieved original file data length for %q: %d", file, len(fileData))
 		resetWhereNecessaryLogger.Debug("Writing original content back to file %q", file)
 		err = os.WriteFile(file, fileData, 0644)
 		if err != nil {
 			resetWhereNecessaryLogger.Warning("Failed to write original content back to file %q: %v", file, err)
 			continue
 		}
 		resetWhereNecessaryLogger.Debug("Successfully reset file %q", file)
 	}
 	resetWhereNecessaryLogger.Debug("Finished reset where necessary operation")
 	return nil
 }
 func ResetAllFiles(db DB) error {
 	resetAllFilesLogger := fileLogger.WithPrefix("ResetAllFiles")
 	resetAllFilesLogger.Debug("Starting reset all files operation")
 	fileSnapshots, err := db.GetAllFiles()
 	if err != nil {
 		resetAllFilesLogger.Error("Failed to get all file snapshots from database: %v", err)
 		return err
 	}
 	resetAllFilesLogger.Debug("Found %d files in database to reset", len(fileSnapshots))
 	resetAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
 	for _, fileSnapshot := range fileSnapshots {
 		resetAllFilesLogger.Debug("Resetting file %q", fileSnapshot.FilePath)
 		err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
 		if err != nil {
 			resetAllFilesLogger.Warning("Failed to write file %q to disk: %v", fileSnapshot.FilePath, err)
 			continue
 		}
 		resetAllFilesLogger.Debug("File %q written to disk successfully", fileSnapshot.FilePath)
 	}
 	resetAllFilesLogger.Debug("Finished reset all files operation")
 	return nil
 }
--- a/utils/flags.go
+++ b/utils/flags.go
@@ -0,0 +1,21 @@
 package utils
 import (
 	"flag"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // flagsLogger is a scoped logger for the utils/flags package.
 var flagsLogger = logger.Default.WithPrefix("utils/flags")
 var (
 	ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
 	Filter        = flag.String("f", "", "Filter commands before running them")
 	JSON          = flag.Bool("json", false, "Enable JSON mode for processing JSON files")
 )
 func init() {
 	flagsLogger.Debug("Initializing flags")
 	flagsLogger.Trace("ParallelFiles initial value: %d, Filter initial value: %q, JSON initial value: %t", *ParallelFiles, *Filter, *JSON)
 }
--- a/utils/modifycommand.go
+++ b/utils/modifycommand.go
@@ -0,0 +1,375 @@
 package utils
 import (
 	"fmt"
 	"os"
 	"path/filepath"
 	"strings"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	"github.com/bmatcuk/doublestar/v4"
 	"gopkg.in/yaml.v3"
 )
 // modifyCommandLogger is a scoped logger for the utils/modifycommand package.
 var modifyCommandLogger = logger.Default.WithPrefix("utils/modifycommand")
 type ModifyCommand struct {
 	Name      string                 `yaml:"name,omitempty"`
 	Regex     string                 `yaml:"regex,omitempty"`
 	Regexes   []string               `yaml:"regexes,omitempty"`
 	Lua       string                 `yaml:"lua,omitempty"`
 	Files     []string               `yaml:"files,omitempty"`
 	Reset     bool                   `yaml:"reset,omitempty"`
 	LogLevel  string                 `yaml:"loglevel,omitempty"`
 	Isolate   bool                   `yaml:"isolate,omitempty"`
 	NoDedup   bool                   `yaml:"nodedup,omitempty"`
 	Disabled  bool                   `yaml:"disable,omitempty"`
 	JSON      bool                   `yaml:"json,omitempty"`
 	Modifiers map[string]interface{} `yaml:"modifiers,omitempty"`
 }
 type CookFile []ModifyCommand
 func (c *ModifyCommand) Validate() error {
 	validateLogger := modifyCommandLogger.WithPrefix("Validate").WithField("commandName", c.Name)
 	validateLogger.Debug("Validating command")
 	// For JSON mode, regex patterns are not required
 	if !c.JSON {
 		if c.Regex == "" && len(c.Regexes) == 0 {
 			validateLogger.Error("Validation failed: Regex pattern is required for non-JSON mode")
 			return fmt.Errorf("pattern is required for non-JSON mode")
 		}
 	}
 	if c.Lua == "" {
 		validateLogger.Error("Validation failed: Lua expression is required")
 		return fmt.Errorf("lua expression is required")
 	}
 	if len(c.Files) == 0 {
 		validateLogger.Error("Validation failed: At least one file is required")
 		return fmt.Errorf("at least one file is required")
 	}
 	if c.LogLevel == "" {
 		validateLogger.Debug("LogLevel not specified, defaulting to INFO")
 		c.LogLevel = "INFO"
 	}
 	validateLogger.Debug("Command validated successfully")
 	return nil
 }
 // Ehh.. Not much better... Guess this wasn't the big deal
 var matchesMemoTable map[string]bool = make(map[string]bool)
 func Matches(path string, glob string) (bool, error) {
 	matchesLogger := modifyCommandLogger.WithPrefix("Matches").WithField("path", path).WithField("glob", glob)
 	matchesLogger.Debug("Checking if path matches glob")
 	key := fmt.Sprintf("%s:%s", path, glob)
 	if matches, ok := matchesMemoTable[key]; ok {
 		matchesLogger.Debug("Found match in memo table: %t", matches)
 		return matches, nil
 	}
 	matches, err := doublestar.Match(glob, path)
 	if err != nil {
 		matchesLogger.Error("Failed to match glob: %v", err)
 		return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
 	}
 	matchesMemoTable[key] = matches
 	matchesLogger.Debug("Match result: %t, storing in memo table", matches)
 	return matches, nil
 }
 func SplitPattern(pattern string) (string, string) {
 	splitPatternLogger := modifyCommandLogger.WithPrefix("SplitPattern").WithField("pattern", pattern)
 	splitPatternLogger.Debug("Splitting pattern")
 	splitPatternLogger.Trace("Original pattern: %q", pattern)
 	static, pattern := doublestar.SplitPattern(pattern)
 	cwd, err := os.Getwd()
 	if err != nil {
 		splitPatternLogger.Error("Error getting current working directory: %v", err)
 		return "", ""
 	}
 	splitPatternLogger.Trace("Current working directory: %q", cwd)
 	if static == "" {
 		splitPatternLogger.Debug("Static part is empty, defaulting to current working directory")
 		static = cwd
 	}
 	if !filepath.IsAbs(static) {
 		splitPatternLogger.Debug("Static part is not absolute, joining with current working directory")
 		static = filepath.Join(cwd, static)
 		static = filepath.Clean(static)
 		splitPatternLogger.Trace("Static path after joining and cleaning: %q", static)
 	}
 	static = strings.ReplaceAll(static, "\\", "/")
 	splitPatternLogger.Trace("Final static path: %q, Remaining pattern: %q", static, pattern)
 	return static, pattern
 }
 type FileCommandAssociation struct {
 	File            string
 	IsolateCommands []ModifyCommand
 	Commands        []ModifyCommand
 }
 func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
 	associateFilesLogger := modifyCommandLogger.WithPrefix("AssociateFilesWithCommands")
 	associateFilesLogger.Debug("Associating files with commands")
 	associateFilesLogger.Trace("Input files: %v", files)
 	associateFilesLogger.Trace("Input commands: %v", commands)
 	associationCount := 0
 	fileCommands := make(map[string]FileCommandAssociation)
 	for _, file := range files {
 		file = strings.ReplaceAll(file, "\\", "/")
 		associateFilesLogger.Debug("Processing file: %q", file)
 		fileCommands[file] = FileCommandAssociation{
 			File:            file,
 			IsolateCommands: []ModifyCommand{},
 			Commands:        []ModifyCommand{},
 		}
 		for _, command := range commands {
 			associateFilesLogger.Debug("Checking command %q for file %q", command.Name, file)
 			for _, glob := range command.Files {
 				glob = strings.ReplaceAll(glob, "\\", "/")
 				static, pattern := SplitPattern(glob)
 				associateFilesLogger.Trace("Glob parts for %q → static=%q pattern=%q", glob, static, pattern)
 				// Build absolute path for the current file to compare with static
 				cwd, err := os.Getwd()
 				if err != nil {
 					associateFilesLogger.Warning("Failed to get CWD when matching %q for file %q: %v", glob, file, err)
 					continue
 				}
 				var absFile string
 				if filepath.IsAbs(file) {
 					absFile = filepath.Clean(file)
 				} else {
 					absFile = filepath.Clean(filepath.Join(cwd, file))
 				}
 				absFile = strings.ReplaceAll(absFile, "\\", "/")
 				associateFilesLogger.Trace("Absolute file path resolved for matching: %q", absFile)
 				// Only match if the file is under the static root
 				if !(strings.HasPrefix(absFile, static+"/") || absFile == static) {
 					associateFilesLogger.Trace("Skipping glob %q for file %q because file is outside static root %q", glob, file, static)
 					continue
 				}
 				patternFile := strings.TrimPrefix(absFile, static+`/`)
 				associateFilesLogger.Trace("Pattern-relative path used for match: %q", patternFile)
 				matches, err := Matches(patternFile, pattern)
 				if err != nil {
 					associateFilesLogger.Warning("Failed to match glob %q with file %q: %v", glob, file, err)
 					continue
 				}
 				if matches {
 					associateFilesLogger.Debug("File %q matches glob %q. Associating with command %q", file, glob, command.Name)
 					association := fileCommands[file]
 					if command.Isolate {
 						associateFilesLogger.Debug("Command %q is an isolate command, adding to isolate list", command.Name)
 						association.IsolateCommands = append(association.IsolateCommands, command)
 					} else {
 						associateFilesLogger.Debug("Command %q is a regular command, adding to regular list", command.Name)
 						association.Commands = append(association.Commands, command)
 					}
 					fileCommands[file] = association
 					associationCount++
 				} else {
 					associateFilesLogger.Trace("File %q did not match glob %q (pattern=%q, rel=%q)", file, glob, pattern, patternFile)
 				}
 			}
 		}
 		currentFileCommands := fileCommands[file]
 		associateFilesLogger.Debug("Finished processing file %q. Found %d regular commands and %d isolate commands", file, len(currentFileCommands.Commands), len(currentFileCommands.IsolateCommands))
 		associateFilesLogger.Trace("Commands for file %q: %v", file, currentFileCommands.Commands)
 		associateFilesLogger.Trace("Isolate commands for file %q: %v", file, currentFileCommands.IsolateCommands)
 	}
 	associateFilesLogger.Info("Completed association. Found %d total associations for %d files and %d commands", associationCount, len(files), len(commands))
 	return fileCommands, nil
 }
 func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
 	aggregateGlobsLogger := modifyCommandLogger.WithPrefix("AggregateGlobs")
 	aggregateGlobsLogger.Debug("Aggregating glob patterns from commands")
 	aggregateGlobsLogger.Trace("Input commands for aggregation: %v", commands)
 	globs := make(map[string]struct{})
 	for _, command := range commands {
 		aggregateGlobsLogger.Debug("Processing command %q for glob patterns", command.Name)
 		for _, glob := range command.Files {
 			resolvedGlob := strings.Replace(glob, "~", os.Getenv("HOME"), 1)
 			resolvedGlob = strings.ReplaceAll(resolvedGlob, "\\", "/")
 			aggregateGlobsLogger.Trace("Adding glob: %q (resolved to %q)", glob, resolvedGlob)
 			globs[resolvedGlob] = struct{}{}
 		}
 	}
 	aggregateGlobsLogger.Debug("Finished aggregating globs. Found %d unique glob patterns", len(globs))
 	aggregateGlobsLogger.Trace("Aggregated unique globs: %v", globs)
 	return globs
 }
 func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
 	expandGlobsLogger := modifyCommandLogger.WithPrefix("ExpandGLobs")
 	expandGlobsLogger.Debug("Expanding glob patterns to actual files")
 	expandGlobsLogger.Trace("Input patterns for expansion: %v", patterns)
 	var files []string
 	filesMap := make(map[string]bool)
 	cwd, err := os.Getwd()
 	if err != nil {
 		expandGlobsLogger.Error("Failed to get current working directory: %v", err)
 		return nil, fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	expandGlobsLogger.Debug("Current working directory: %q", cwd)
 	for pattern := range patterns {
 		expandGlobsLogger.Debug("Processing glob pattern: %q", pattern)
 		static, pattern := SplitPattern(pattern)
 		matches, err := doublestar.Glob(os.DirFS(static), pattern)
 		if err != nil {
 			expandGlobsLogger.Warning("Error expanding glob %q in %q: %v", pattern, static, err)
 			continue
 		}
 		expandGlobsLogger.Debug("Found %d matches for pattern %q", len(matches), pattern)
 		expandGlobsLogger.Trace("Raw matches for pattern %q: %v", pattern, matches)
 		for _, m := range matches {
 			m = filepath.Join(static, m)
 			info, err := os.Stat(m)
 			if err != nil {
 				expandGlobsLogger.Warning("Error getting file info for %q: %v", m, err)
 				continue
 			}
 			if !info.IsDir() && !filesMap[m] {
 				expandGlobsLogger.Trace("Adding unique file to list: %q", m)
 				filesMap[m], files = true, append(files, m)
 			}
 		}
 	}
 	if len(files) > 0 {
 		expandGlobsLogger.Debug("Finished expanding globs. Found %d unique files to process", len(files))
 		expandGlobsLogger.Trace("Unique files to process: %v", files)
 	} else {
 		expandGlobsLogger.Warning("No files found after expanding glob patterns.")
 	}
 	return files, nil
 }
 func LoadCommands(args []string) ([]ModifyCommand, error) {
 	loadCommandsLogger := modifyCommandLogger.WithPrefix("LoadCommands")
 	loadCommandsLogger.Debug("Loading commands from arguments (cook files or direct patterns)")
 	loadCommandsLogger.Trace("Input arguments: %v", args)
 	commands := []ModifyCommand{}
 	for _, arg := range args {
 		loadCommandsLogger.Debug("Processing argument for commands: %q", arg)
 		newCommands, err := LoadCommandsFromCookFiles(arg)
 		if err != nil {
 			loadCommandsLogger.Error("Failed to load commands from argument %q: %v", arg, err)
 			return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
 		}
 		loadCommandsLogger.Debug("Successfully loaded %d commands from %q", len(newCommands), arg)
 		for _, cmd := range newCommands {
 			if cmd.Disabled {
 				loadCommandsLogger.Debug("Skipping disabled command: %q", cmd.Name)
 				continue
 			}
 			commands = append(commands, cmd)
 			loadCommandsLogger.Trace("Added command %q. Current total commands: %d", cmd.Name, len(commands))
 		}
 	}
 	loadCommandsLogger.Info("Finished loading commands. Total %d commands loaded", len(commands))
 	return commands, nil
 }
 func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
 	loadCookFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFiles").WithField("pattern", pattern)
 	loadCookFilesLogger.Debug("Loading commands from cook files based on pattern")
 	loadCookFilesLogger.Trace("Input pattern: %q", pattern)
 	static, pattern := SplitPattern(pattern)
 	commands := []ModifyCommand{}
 	cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
 	if err != nil {
 		loadCookFilesLogger.Error("Failed to glob cook files for pattern %q: %v", pattern, err)
 		return nil, fmt.Errorf("failed to glob cook files: %w", err)
 	}
 	loadCookFilesLogger.Debug("Found %d cook files for pattern %q", len(cookFiles), pattern)
 	loadCookFilesLogger.Trace("Cook files found: %v", cookFiles)
 	for _, cookFile := range cookFiles {
 		cookFile = filepath.Join(static, cookFile)
 		cookFile = filepath.Clean(cookFile)
 		cookFile = strings.ReplaceAll(cookFile, "\\", "/")
 		loadCookFilesLogger.Debug("Loading commands from individual cook file: %q", cookFile)
 		cookFileData, err := os.ReadFile(cookFile)
 		if err != nil {
 			loadCookFilesLogger.Error("Failed to read cook file %q: %v", cookFile, err)
 			return nil, fmt.Errorf("failed to read cook file: %w", err)
 		}
 		loadCookFilesLogger.Trace("Read %d bytes from cook file %q", len(cookFileData), cookFile)
 		newCommands, err := LoadCommandsFromCookFile(cookFileData)
 		if err != nil {
 			loadCookFilesLogger.Error("Failed to load commands from cook file data for %q: %v", cookFile, err)
 			return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
 		}
 		commands = append(commands, newCommands...)
 		loadCookFilesLogger.Debug("Added %d commands from cook file %q. Total commands now: %d", len(newCommands), cookFile, len(commands))
 	}
 	loadCookFilesLogger.Debug("Finished loading commands from cook files. Total %d commands", len(commands))
 	return commands, nil
 }
 func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
 	loadCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFile")
 	loadCommandLogger.Debug("Unmarshaling commands from cook file data")
 	loadCommandLogger.Trace("Cook file data length: %d", len(cookFileData))
 	commands := []ModifyCommand{}
 	err := yaml.Unmarshal(cookFileData, &commands)
 	if err != nil {
 		loadCommandLogger.Error("Failed to unmarshal cook file data: %v", err)
 		return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
 	}
 	loadCommandLogger.Debug("Successfully unmarshaled %d commands", len(commands))
 	loadCommandLogger.Trace("Unmarshaled commands: %v", commands)
 	return commands, nil
 }
 // CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
 func CountGlobsBeforeDedup(commands []ModifyCommand) int {
 	countGlobsLogger := modifyCommandLogger.WithPrefix("CountGlobsBeforeDedup")
 	countGlobsLogger.Debug("Counting glob patterns before deduplication")
 	count := 0
 	for _, cmd := range commands {
 		countGlobsLogger.Trace("Processing command %q, adding %d globs", cmd.Name, len(cmd.Files))
 		count += len(cmd.Files)
 	}
 	countGlobsLogger.Debug("Total glob patterns before deduplication: %d", count)
 	return count
 }
 func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
 	filterCommandsLogger := modifyCommandLogger.WithPrefix("FilterCommands").WithField("filter", filter)
 	filterCommandsLogger.Debug("Filtering commands")
 	filterCommandsLogger.Trace("Input commands: %v", commands)
 	filteredCommands := []ModifyCommand{}
 	filters := strings.Split(filter, ",")
 	filterCommandsLogger.Trace("Split filters: %v", filters)
 	for _, cmd := range commands {
 		filterCommandsLogger.Debug("Checking command %q against filters", cmd.Name)
 		for _, f := range filters {
 			if strings.Contains(cmd.Name, f) {
 				filterCommandsLogger.Debug("Command %q matches filter %q, adding to filtered list", cmd.Name, f)
 				filteredCommands = append(filteredCommands, cmd)
 				break // Command matches, no need to check other filters
 			}
 		}
 	}
 	filterCommandsLogger.Debug("Finished filtering commands. Found %d filtered commands", len(filteredCommands))
 	filterCommandsLogger.Trace("Filtered commands: %v", filteredCommands)
 	return filteredCommands
 }
--- a/utils/modifycommand_test.go
+++ b/utils/modifycommand_test.go
--- a/utils/replacecommand.go
+++ b/utils/replacecommand.go
@@ -0,0 +1,79 @@
 package utils
 import (
 	"fmt"
 	"sort"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // replaceCommandLogger is a scoped logger for the utils/replacecommand package.
 var replaceCommandLogger = logger.Default.WithPrefix("utils/replacecommand")
 type ReplaceCommand struct {
 	From int
 	To   int
 	With string
 }
 func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
 	executeModificationsLogger := replaceCommandLogger.WithPrefix("ExecuteModifications")
 	executeModificationsLogger.Debug("Executing a batch of text modifications")
 	executeModificationsLogger.Trace("Number of modifications: %d, Original file data length: %d", len(modifications), len(fileData))
 	var err error
 	sort.Slice(modifications, func(i, j int) bool {
 		return modifications[i].From > modifications[j].From
 	})
 	executeModificationsLogger.Debug("Modifications sorted in reverse order for safe replacement")
 	executeModificationsLogger.Trace("Sorted modifications: %v", modifications)
 	executed := 0
 	for idx, modification := range modifications {
 		executeModificationsLogger.Debug("Applying modification %d/%d", idx+1, len(modifications))
 		executeModificationsLogger.Trace("Current modification details: From=%d, To=%d, With=%q", modification.From, modification.To, modification.With)
 		fileData, err = modification.Execute(fileData)
 		if err != nil {
 			executeModificationsLogger.Error("Failed to execute replacement for modification %+v: %v", modification, err)
 			continue
 		}
 		executed++
 		executeModificationsLogger.Trace("File data length after modification: %d", len(fileData))
 	}
 	executeModificationsLogger.Info("Successfully applied %d text replacements", executed)
 	return fileData, executed
 }
 func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
 	executeLogger := replaceCommandLogger.WithPrefix("Execute").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With))
 	executeLogger.Debug("Attempting to execute single replacement")
 	err := m.Validate(len(fileDataStr))
 	if err != nil {
 		executeLogger.Error("Failed to validate modification: %v", err)
 		return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
 	}
 	executeLogger.Trace("Applying replacement: fileDataStr[:%d] + %q + fileDataStr[%d:]", m.From, m.With, m.To)
 	result := fileDataStr[:m.From] + m.With + fileDataStr[m.To:]
 	executeLogger.Trace("Replacement executed. Result length: %d", len(result))
 	return result, nil
 }
 func (m *ReplaceCommand) Validate(maxsize int) error {
 	validateLogger := replaceCommandLogger.WithPrefix("Validate").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With)).WithField("maxSize", maxsize)
 	validateLogger.Debug("Validating replacement command against max size")
 	if m.To < m.From {
 		validateLogger.Error("Validation failed: 'To' (%d) is less than 'From' (%d)", m.To, m.From)
 		return fmt.Errorf("command to is less than from: %v", m)
 	}
 	if m.From > maxsize || m.To > maxsize {
 		validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is greater than max size (%d)", m.From, m.To, maxsize)
 		return fmt.Errorf("command from or to is greater than replacement length: %v", m)
 	}
 	if m.From < 0 || m.To < 0 {
 		validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is less than 0", m.From, m.To)
 		return fmt.Errorf("command from or to is less than 0: %v", m)
 	}
 	validateLogger.Debug("Modification command validated successfully")
 	return nil
 }
--- a/utils/replacecommand_test.go
+++ b/utils/replacecommand_test.go
@@ -0,0 +1,504 @@
 package utils
 import (
 	"testing"
 	"github.com/stretchr/testify/assert"
 )
 func TestReplaceCommandExecute(t *testing.T) {
 	tests := []struct {
 		name        string
 		input       string
 		command     ReplaceCommand
 		expected    string
 		shouldError bool
 	}{
 		{
 			name:        "Simple replacement",
 			input:       "This is a test string",
 			command:     ReplaceCommand{From: 5, To: 7, With: "was"},
 			expected:    "This was a test string",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at beginning",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 5, With: "Hi"},
 			expected:    "Hi world",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at end",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 6, To: 11, With: "everyone"},
 			expected:    "Hello everyone",
 			shouldError: false,
 		},
 		{
 			name:        "Replace entire string",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
 			expected:    "Goodbye!",
 			shouldError: false,
 		},
 		{
 			name:        "Error: From > To",
 			input:       "Test string",
 			command:     ReplaceCommand{From: 7, To: 5, With: "fail"},
 			expected:    "Test string",
 			shouldError: true,
 		},
 		{
 			name:        "Error: From > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 10, To: 12, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 		{
 			name:        "Error: To > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 2, To: 10, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			result, err := tc.command.Execute(tc.input)
 			if tc.shouldError {
 				if err == nil {
 					t.Errorf("Expected an error for command %+v but got none", tc.command)
 				}
 			} else {
 				if err != nil {
 					t.Errorf("Unexpected error: %v", err)
 				}
 				if result != tc.expected {
 					t.Errorf("Expected %q, got %q", tc.expected, result)
 				}
 			}
 		})
 	}
 }
 func TestExecuteModifications(t *testing.T) {
 	tests := []struct {
 		name          string
 		input         string
 		modifications []ReplaceCommand
 		expected      string
 		expectedCount int
 	}{
 		{
 			name:  "Single modification",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 			},
 			expected:      "Hi world",
 			expectedCount: 1,
 		},
 		{
 			name:  "Multiple modifications",
 			input: "This is a test string",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 4, With: "That"},
 				{From: 8, To: 14, With: "sample"},
 			},
 			expected:      "That is sample string",
 			expectedCount: 2,
 		},
 		{
 			name:  "Overlapping modifications",
 			input: "ABCDEF",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 3, With: "123"}, // ABC -> 123
 				{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
 			},
 			// The actual behavior with the current implementation
 			expected:      "123yzF",
 			expectedCount: 2,
 		},
 		{
 			name:  "Sequential modifications",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 				{From: 5, To: 6, With: ""}, // Remove the space
 				{From: 6, To: 11, With: "everyone"},
 			},
 			expected:      "Hieveryone",
 			expectedCount: 3,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			// Make a copy of the modifications to avoid modifying the test case
 			mods := make([]ReplaceCommand, len(tc.modifications))
 			copy(mods, tc.modifications)
 			result, count := ExecuteModifications(mods, tc.input)
 			if count != tc.expectedCount {
 				t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
 			}
 			if result != tc.expected {
 				t.Errorf("Expected %q, got %q", tc.expected, result)
 			}
 		})
 	}
 }
 func TestReverseOrderExecution(t *testing.T) {
 	// This test verifies the current behavior of modification application
 	input := "Original text with multiple sections"
 	// Modifications in specific positions
 	modifications := []ReplaceCommand{
 		{From: 0, To: 8, With: "Modified"},  // Original -> Modified
 		{From: 9, To: 13, With: "document"}, // text -> document
 		{From: 14, To: 22, With: "without"}, // with -> without
 		{From: 23, To: 31, With: "any"},     // multiple -> any
 	}
 	// The actual current behavior of our implementation
 	expected := "Modified document withouttanytions"
 	result, count := ExecuteModifications(modifications, input)
 	if count != 4 {
 		t.Errorf("Expected 4 modifications, got %d", count)
 	}
 	if result != expected {
 		t.Errorf("Expected %q, got %q", expected, result)
 	}
 }
 // Replace text in the middle of a string with new content
 func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello replaced, how are you?", result)
 }
 // Replace with empty string (deletion)
 func TestReplaceCommandExecute_DeletesText(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello , how are you?", result)
 }
 // Replace with longer string than original segment
 func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "longerreplacement",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello longerreplacement, how are you?", result)
 }
 // From and To values are the same (zero-length replacement)
 func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   5,
 		With: "inserted",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Helloinserted world", result)
 }
 // From value is greater than To value
 func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 10,
 		To:   5,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // From or To values exceed string length
 func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   50, // Exceeds the length of the fileContent
 		With: "replaced",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world", result)
 }
 // From or To values are negative
 func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: -1,
 		To:   10,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // Modifications are applied in reverse order (from highest to lowest 'From' value)
 func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 4, With: "That"},
 		{From: 10, To: 14, With: "sample"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a sample string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // One or more modifications fail but others succeed
 func TestExecuteModificationsWithPartialFailures(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	// Create a custom ReplaceCommand implementation that will fail
 	failingCommand := ReplaceCommand{
 		From: 15,
 		To:   10, // Invalid range (To < From) to cause failure
 		With: "will fail",
 	}
 	// Valid commands
 	validCommand1 := ReplaceCommand{
 		From: 0,
 		To:   4,
 		With: "That",
 	}
 	validCommand2 := ReplaceCommand{
 		From: 26,
 		To:   38,
 		With: "modifications",
 	}
 	modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a test string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	// Only 2 out of 3 modifications should succeed
 	if executed != 2 {
 		t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
 	}
 }
 // All valid modifications are executed and the modified string is returned
 func TestExecuteModificationsAllValid(t *testing.T) {
 	// Setup test data
 	fileData := "Hello world, this is a test"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 5, With: "Hi"},
 		{From: 18, To: 20, With: "was"},
 		{From: 21, To: 27, With: "an example"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "Hi world, this was an example"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // The count of successfully executed modifications is returned
 func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
 	// Setup test data
 	fileData := "Initial text for testing"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 7, With: "Final"},
 		{From: 12, To: 16, With: "example"},
 		{From: 17, To: 24, With: "process"},
 	}
 	// Execute the function
 	_, executed := ExecuteModifications(modifications, fileData)
 	// Verify the count of executed modifications
 	expectedExecuted := 3
 	if executed != expectedExecuted {
 		t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
 	}
 }
 // Empty modifications list returns the original string with zero executed count
 func TestExecuteModificationsWithEmptyList(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	if result != fileData {
 		t.Errorf("Expected result to be %q, but got %q", fileData, result)
 	}
 	if executed != 0 {
 		t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications with identical 'From' values
 func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 10, To: 14, With: "sample"},
 		{From: 10, To: 14, With: "example"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	// Yes, it's mangled, yes, it's intentional
 	// Every subsequent command works with the modified contents of the previous command
 	// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
 	// So we prepend "example" and end up with "examplele"
 	// Whether sample or example goes first here is irrelevant to us
 	// But it just so happens that sample goes first, so we end up with "examplele"
 	expectedResult := "This is a examplele string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications that would affect each other if not sorted properly
 func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
 	// Setup test data
 	fileData := "The quick brown fox jumps over the lazy dog"
 	modifications := []ReplaceCommand{
 		{From: 4, To: 9, With: "slow"},
 		{From: 10, To: 15, With: "red"},
 		{From: 16, To: 19, With: "cat"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "The slow red cat jumps over the lazy dog"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
Author	SHA1	Message	Date
PhatPhuckDave	969ccae25c	Use diffs for tests	2025-08-22 10:10:37 +02:00
PhatPhuckDave	5b46ff0efd	Fix broken test introduced in previous commit	2025-08-22 10:04:11 +02:00
PhatPhuckDave	d234616406	Add broken test	2025-08-22 09:53:00 +02:00
PhatPhuckDave	af3e55e518	Fix some retarded bullshit	2025-08-22 00:10:46 +02:00
PhatPhuckDave	13b48229ac	Fix some bullshit (the re)	2025-08-22 00:05:22 +02:00
PhatPhuckDave	670f6ed7a0	Add tests for EvalRegex	2025-08-21 23:56:05 +02:00
PhatPhuckDave	bbc7c50fae	Decringe	2025-08-21 23:17:36 +02:00
PhatPhuckDave	779d1e0a0e	Fix some more shit I guess	2025-08-21 23:16:23 +02:00
PhatPhuckDave	54581f0216	Clean up the cringe	2025-08-21 23:10:18 +02:00
PhatPhuckDave	3d01822e77	Fix failing test	2025-08-21 23:05:57 +02:00
PhatPhuckDave	4e0ca92c77	Add failing test	2025-08-21 23:05:57 +02:00
PhatPhuckDave	388e54b3e3	Add comprehensive help string for available Lua functions	2025-08-21 22:32:10 +02:00
PhatPhuckDave	6f2e76221a	Add real regex support to lua	2025-08-21 22:27:37 +02:00
PhatPhuckDave	e0d3b938e3	Fix tests	2025-08-21 22:26:20 +02:00
PhatPhuckDave	491a030bf8	Hallucinate actual json fucking thing	2025-08-21 22:19:21 +02:00
PhatPhuckDave	bff7cc2a27	Hallucinate a json mode implementation	2025-08-21 20:39:35 +02:00
PhatPhuckDave	ff30b00e71	refactor(db.go, file.go): improve database error handling and file snapshot seeding	2025-08-09 16:12:26 +02:00
PhatPhuckDave	e1eb5eeaa6	Improve config readability by removing unnecessary fields and adding omitempty	2025-08-08 09:58:03 +02:00
PhatPhuckDave	2a2e11d8e0	Add more examples to the configuration file generator	2025-08-08 09:52:47 +02:00
PhatPhuckDave	6eb4f31127	Implement regexes, an entry option allow for same modification to apply to multiple regexes and variables that can be referenced in lua	2025-08-08 09:50:31 +02:00
PhatPhuckDave	4b58e00c26	Hallucinate some logs Hallucinate more logs fix(utils/db.go): handle auto migration errors gracefully fix(utils/modifycommand.go): improve file matching accuracy fix(processor/regex.go): improve capture group deduplication logic fix(utils/db.go): add logging for database wrapper initialization feat(processor/regex.go): preserve input order when deduplicating capture groups fix(utils/modifycommand.go): add logging for file matching skips feat(processor/regex.go): add logging for capture group processing feat(main.go): add trace logging for arguments and parallel workers fix(main.go): add trace logging for file content fix(utils/db.go): add logging for database opening fix(main.go): add trace logging for file processing fix(utils/modifycommand.go): improve file matching by using absolute paths feat(modifycommand.go): add trace logging for file matching in AssociateFilesWithCommands feat(main.go): add per-file association summary for better visibility when debugging	2025-08-08 08:10:51 +02:00
PhatPhuckDave	8ffd8af13c	Use atomic values instead of mutexes	2025-08-01 16:38:31 +02:00
PhatPhuckDave	67861d4455	Now only save CHANGED files to database (before changes of course)	2025-08-01 16:34:48 +02:00
PhatPhuckDave	299e6d8bfe	Fix glob matching when backslashes are used as separators	2025-07-30 14:41:38 +02:00
PhatPhuckDave	388822e90a	Create example yml even when no args are provided ie. invalid usage	2025-07-30 14:38:29 +02:00
PhatPhuckDave	91993b4548	Improve error handling in ResetAllFiles function by logging warnings for failed file writes instead of returning errors	2025-07-27 12:47:21 +02:00
PhatPhuckDave	bb69558aaa	Fix issue where invalid isolate commands would prevent other isolate commands from running	2025-07-21 21:28:12 +02:00
PhatPhuckDave	052c670627	Add a simple trim to lua	2025-07-21 21:00:11 +02:00
PhatPhuckDave	67fd215d0e	Don't stroke out when backup doesn't exist in db	2025-07-20 11:48:55 +02:00
PhatPhuckDave	9ecbbff6fa	Implement special flags for dump and reset db	2025-07-20 11:47:45 +02:00
PhatPhuckDave	774ac0f0ca	Implement proper "reset" that reads snapshots from database	2025-07-20 11:43:25 +02:00
PhatPhuckDave	b785d24a08	Implement saving snapshots to a database	2025-07-20 11:38:08 +02:00
PhatPhuckDave	22f991e72e	Clean up shop a bit	2025-07-20 11:20:19 +02:00
PhatPhuckDave	5518b27663	Remove deprecated flags and rename filter to f	2025-07-20 11:12:58 +02:00
PhatPhuckDave	0b899dea2c	Add Disabled flag to ModifyCommand	2025-07-19 11:08:51 +02:00
PhatPhuckDave	3424fea8ad	Dump a basic "config" to example usage on failed command	2025-07-19 01:15:48 +02:00
PhatPhuckDave	ddc1d83d58	Fix file associations It was fucked because we were removing the static path and then cramming that into assications	2025-04-22 10:53:25 +02:00
PhatPhuckDave	4b0a85411d	From cook FILE - F I L E - FILEEEEE This is the 4th time I make the SAME fix	2025-04-22 10:46:03 +02:00
PhatPhuckDave	46e871b626	Fix flag collision with logger	2025-04-22 10:45:11 +02:00
PhatPhuckDave	258dcc88e7	Fix reference to utils	2025-04-18 12:48:24 +02:00
PhatPhuckDave	75bf449bed	Remove logger and replace it with a library	2025-04-18 12:47:47 +02:00
PhatPhuckDave	58586395fb	Add file util for later	2025-04-13 21:31:19 +02:00
PhatPhuckDave	c5a68af5e6	PROPERLY implement doublestar	2025-04-13 21:29:18 +02:00
PhatPhuckDave	b4c0284734	Add rimworld cook file	2025-04-09 09:47:53 +02:00
PhatPhuckDave	c5d1dad8de	Rename project to "cook" and ditch loading fgrom args, now files exclusively	2025-04-09 09:47:53 +02:00
PhatPhuckDave	4ff2ee80ee	And fix the god damn backslashes fuck windows	2025-04-01 11:29:57 +02:00
PhatPhuckDave	633eebfd2a	Support ~ in globs	2025-04-01 11:29:02 +02:00
PhatPhuckDave	5a31703840	Implement per command logger	2025-03-29 17:29:21 +01:00
PhatPhuckDave	162d0c758d	Fix some tests	2025-03-29 17:29:21 +01:00
PhatPhuckDave	14d64495b6	Add deduplicate flag	2025-03-29 17:29:21 +01:00
PhatPhuckDave	fe6e97e832	Don't deduplicate (yet)	2025-03-29 17:23:21 +01:00
PhatPhuckDave	35b3d8b099	Reduce some of the reads and writes It's really not necessary	2025-03-28 23:39:11 +01:00
PhatPhuckDave	2e3e958e15	Fix some tests and add some logs	2025-03-28 23:31:44 +01:00
PhatPhuckDave	955afc4295	Refactor running commands to separate functions	2025-03-28 16:59:22 +01:00
PhatPhuckDave	2c487bc443	Implement "Isolate" commands Commands that run alone one by one on reading and writing the file This should be used on commands that will modify a large part of the file (or generally large parts) Since that can fuck up the indices of other commands when ran together	2025-03-28 16:56:39 +01:00
PhatPhuckDave	b77224176b	Add file lua value	2025-03-28 16:47:21 +01:00
PhatPhuckDave	a2201053c5	Remove some random ass fmt printf	2025-03-28 13:24:12 +01:00
PhatPhuckDave	04cedf5ece	Fix the concurrent map writes	2025-03-28 11:35:38 +01:00
PhatPhuckDave	ebb07854cc	Memoize the match table	2025-03-28 11:31:27 +01:00
PhatPhuckDave	8a86ae2f40	Add filter flag	2025-03-28 11:20:44 +01:00
PhatPhuckDave	e8f16dda2b	Housekeeping	2025-03-28 02:14:27 +01:00
PhatPhuckDave	513773f641	Again	2025-03-28 01:26:26 +01:00
PhatPhuckDave	22914fe243	Add a lil log	2025-03-28 01:24:23 +01:00
PhatPhuckDave	2d523dfe64	Rename pattern to regex	2025-03-28 01:08:48 +01:00
PhatPhuckDave	2629722f67	Minor fixes and tweaks	2025-03-28 01:03:27 +01:00
PhatPhuckDave	1f6c4e4976	Fix up the tests and some minor bugs	2025-03-28 00:51:26 +01:00
PhatPhuckDave	bfd08e754e	Replace old tests with asserts	2025-03-28 00:40:53 +01:00
PhatPhuckDave	750010b71a	Add more tests to regex	2025-03-28 00:28:51 +01:00
PhatPhuckDave	9064a53820	Add more tests (and fix some things) for replacecommand	2025-03-28 00:23:42 +01:00
PhatPhuckDave	294c04a11a	Add more tests for modifycommand	2025-03-28 00:03:23 +01:00
PhatPhuckDave	ba7ac07001	Fix up the logs a little	2025-03-27 23:36:56 +01:00
PhatPhuckDave	5d10178bf9	Update old and add new tests	2025-03-27 23:33:57 +01:00
PhatPhuckDave	f91c2b4795	More cleaning up	2025-03-27 23:07:22 +01:00
PhatPhuckDave	057db23d09	Implement panic recovery :??	2025-03-27 23:06:46 +01:00
PhatPhuckDave	bf72734b90	Clean up regex.go a little	2025-03-27 23:04:39 +01:00
PhatPhuckDave	cc30c2bdcb	Cleanup	2025-03-27 22:56:42 +01:00
PhatPhuckDave	f453079c72	Fix up regex.go	2025-03-27 22:50:15 +01:00
PhatPhuckDave	e634fe28bd	Clean up processor	2025-03-27 22:24:59 +01:00
PhatPhuckDave	4e4b7bbd19	Implement parallel file processing	2025-03-27 22:22:43 +01:00
PhatPhuckDave	89eed3f847	Refactor git shit to its own module	2025-03-27 22:20:22 +01:00
PhatPhuckDave	f008efd5e1	Refactor modify and replace to their own files	2025-03-27 22:18:12 +01:00
PhatPhuckDave	f6def1e5a5	Refactor entirety of replace command to main for now	2025-03-27 22:11:03 +01:00
PhatPhuckDave	867b188718	Work out file reading and writing	2025-03-27 22:02:36 +01:00
PhatPhuckDave	aac29a4074	Refactor more stuff around	2025-03-27 21:58:52 +01:00
PhatPhuckDave	8a40f463f7	Implement file command association	2025-03-27 21:54:46 +01:00
PhatPhuckDave	8d4db1da91	Clean up code add some log lines and tidy up expandglobs	2025-03-27 21:49:28 +01:00
PhatPhuckDave	d41e2afe17	Update	2025-03-27 21:43:36 +01:00
PhatPhuckDave	76457d22cf	Partially rework reading args to modify command loading	2025-03-27 21:39:16 +01:00
PhatPhuckDave	912950d463	Remove the vestiges of xml and json	2025-03-27 21:31:45 +01:00
PhatPhuckDave	25326ea11b	Remove xml and json They are simply not as useful as regex at all There is nothing they can do regex cannot And they have one massive penalty: the encoding Which often results in MASSIVE diffs	2025-03-27 21:28:20 +01:00
PhatPhuckDave	df212b7fcc	Remove jsonpath and xpath	2025-03-27 21:27:47 +01:00
PhatPhuckDave	f4a963760a	Add dumptable helper function	2025-03-27 20:07:59 +01:00
PhatPhuckDave	d236811cb9	Introduce a new logging level for lua values	2025-03-27 20:06:50 +01:00
PhatPhuckDave	da93770334	Add strsplit lua helper	2025-03-27 19:56:31 +01:00
PhatPhuckDave	d9f54a8354	Fix test again	2025-03-27 19:49:57 +01:00
PhatPhuckDave	dc8da8ab63	Fix overlapping capture groups	2025-03-27 19:43:06 +01:00
PhatPhuckDave	24262a7dca	Remove old unused xml files	2025-03-27 19:31:54 +01:00
PhatPhuckDave	d77b13c363	Update regression test	2025-03-27 19:31:20 +01:00
PhatPhuckDave	a9c60a3698	Neatly align log columns	2025-03-27 19:26:14 +01:00
PhatPhuckDave	66bcf21d79	Add goroutine numbers to log lines	2025-03-27 19:19:39 +01:00
PhatPhuckDave	e847e5c3ce	Make little better logging	2025-03-27 18:53:02 +01:00
PhatPhuckDave	9a70c9696e	Fix logger	2025-03-27 18:46:28 +01:00
PhatPhuckDave	9cea103042	Implement a more better logging solution	2025-03-27 17:53:43 +01:00
PhatPhuckDave	81d8259dfc	Comment out some xml tests for now We're not working on it for now	2025-03-27 17:46:43 +01:00
PhatPhuckDave	5c5fbac63f	Make doublestar a little cleaner	2025-03-27 17:21:13 +01:00
PhatPhuckDave	3e818e61c7	Add string.format shortcut to lua	2025-03-27 15:38:07 +01:00
PhatPhuckDave	001470ffe4	Fix up regression tests	2025-03-27 15:37:57 +01:00
PhatPhuckDave	d88a76c4e2	Fix logging of groups	2025-03-26 22:26:02 +01:00
PhatPhuckDave	d3a1f1bd96	Rework regex grouping to avoid changing the same area twice	2025-03-26 22:24:19 +01:00
PhatPhuckDave	07a5f3f1a4	Add replaceCommands to avoid index suicide	2025-03-26 21:55:34 +01:00
PhatPhuckDave	e2257e082a	Add a regression test	2025-03-26 21:55:17 +01:00
PhatPhuckDave	b3fce4244d	Fix regex for numbers to support negative numbers	2025-03-26 18:30:21 +01:00
PhatPhuckDave	bd443067b6	Add support for !num inside of named capture groups	2025-03-26 14:04:39 +01:00
PhatPhuckDave	a9b6f7f984	Implement printing from lua	2025-03-26 13:37:39 +01:00
PhatPhuckDave	10c39b02a0	Fix some regex tests	2025-03-26 13:13:53 +01:00
PhatPhuckDave	7f4392b10e	Implement "replacement" variable that simply replaces the match	2025-03-26 13:00:52 +01:00
PhatPhuckDave	7e19cf4e2c	Rework named captures to be array To comply with the whole reverse replacing	2025-03-26 12:50:55 +01:00
PhatPhuckDave	c5fb20e96a	Implement named capture groups	2025-03-26 12:28:28 +01:00
PhatPhuckDave	a8c2257f20	Add named capture group tests	2025-03-26 12:17:01 +01:00
PhatPhuckDave	b63b4d1352	Add some more shorthands for regex	2025-03-26 12:06:04 +01:00
PhatPhuckDave	6a3d44ccd0	Redo what claude removed	2025-03-26 11:42:00 +01:00
PhatPhuckDave	c22e6ff41f	Code polish	2025-03-26 11:40:23 +01:00
PhatPhuckDave	068c64d714	Fix up file reseting	2025-03-26 11:10:43 +01:00
PhatPhuckDave	2c7a4f5d97	Add a lot more logs to regex What the fuck is going on?	2025-03-26 03:30:08 +01:00
PhatPhuckDave	0d7d251e76	Implement git reset	2025-03-26 03:23:16 +01:00
PhatPhuckDave	0d8c447ff6	Add support for git ie. automatically resetting changes to ensure clean slate	2025-03-26 03:22:05 +01:00
PhatPhuckDave	bb14087598	Fix oopsie	2025-03-26 02:52:28 +01:00
PhatPhuckDave	66a522aa12	Try to include xml node children in lua table	2025-03-26 02:50:33 +01:00
PhatPhuckDave	1a4b4f76f2	Map the weird numeric escapes to textual ones	2025-03-26 02:34:21 +01:00
PhatPhuckDave	2bfd9f951e	Fix up some more xml tests and other small bugs	2025-03-26 02:17:42 +01:00
PhatPhuckDave	e5092edf53	Implement parsing xml to and from lua A lot more complex than json.........	2025-03-26 01:36:49 +01:00
PhatPhuckDave	e31c0e4e8f	Implement xpath (by calling library)	2025-03-26 01:19:41 +01:00
PhatPhuckDave	73d93367a0	Refactor some things around a little	2025-03-25 23:16:03 +01:00
PhatPhuckDave	64f690f6b4	Fix usage to reflect recent flag changes	2025-03-25 23:02:32 +01:00
PhatPhuckDave	34477b2c34	Make readme and rework the flags a little	2025-03-25 22:55:01 +01:00
PhatPhuckDave	d5c08d86f5	Code polish	2025-03-25 19:22:44 +01:00
PhatPhuckDave	68127fe453	Add more json tests To bring it in line with the xml ones	2025-03-25 19:22:07 +01:00
PhatPhuckDave	872f2dd46d	Fix another changed test for json	2025-03-25 19:16:09 +01:00
PhatPhuckDave	4eed05c7c2	Fix some more minor bugs and tests	2025-03-25 19:14:21 +01:00
PhatPhuckDave	4640281fbf	Enable root modifications Though I can not see why you would want to..... But there's no reason you would not be able to	2025-03-25 18:57:32 +01:00
PhatPhuckDave	aba10267d1	Fix more tests	2025-03-25 18:47:55 +01:00
PhatPhuckDave	fed140254b	Fix some json tests	2025-03-25 18:32:51 +01:00
PhatPhuckDave	db92033642	Rework rounding and building lua script To allow user script to specify what was modified where	2025-03-25 18:28:33 +01:00
PhatPhuckDave	1b0b198297	Add xpath tests	2025-03-25 17:56:48 +01:00
PhatPhuckDave	15ae116447	Fix up some miscellaneous shit around the project regarding lua conversions	2025-03-25 17:46:21 +01:00
PhatPhuckDave	1bcc6735ab	Improve error handling across the board	2025-03-25 17:27:20 +01:00
PhatPhuckDave	20bab894e3	Add path data to the selected nodes for reconstruction via set	2025-03-25 17:27:20 +01:00
PhatPhuckDave	396992b3d0	Implement Set and SetAll (and Get)	2025-03-25 17:27:20 +01:00
PhatPhuckDave	054dcbf835	Fix up the recursive descent Again I guess?	2025-03-25 17:27:20 +01:00
PhatPhuckDave	88887b9a12	Fix up the recursive descent	2025-03-25 17:27:20 +01:00
PhatPhuckDave	533a563dc5	Fix up parser	2025-03-25 17:27:20 +01:00
PhatPhuckDave	7fc2956b6d	Begin to implement jsonpath	2025-03-25 17:27:20 +01:00
PhatPhuckDave	6f9f3f5eae	Begin to rework the json parsing	2025-03-25 17:27:20 +01:00
PhatPhuckDave	d2419b761e	Implement a generic translator between lua and go tables (maps)	2025-03-25 17:27:20 +01:00
PhatPhuckDave	ab98800ca0	Rework regex processor to be more betterer	2025-03-25 17:27:20 +01:00
PhatPhuckDave	0f7ee521ac	Fix up lua variable writing and reading for regex	2025-03-25 17:27:20 +01:00
PhatPhuckDave	fd81861a64	Fix reading lua variables	2025-03-25 17:27:20 +01:00
PhatPhuckDave	430234dd3b	Clean up after claude	2025-03-25 17:27:20 +01:00
PhatPhuckDave	17bb3d4f71	Refactor everything to processors and implement json and xml processors such as they are	2025-03-25 17:27:20 +01:00
PhatPhuckDave	84e0a8bed6	Add xpath dependencies	2025-03-25 17:27:20 +01:00
PhatPhuckDave	bdcf096fdd	Fix up the oopsies	2025-03-25 17:27:15 +01:00
PhatPhuckDave	1a90046c89	Add release script	2025-03-25 17:26:23 +01:00
		`@@ -1 +0,0 @@`
			`<config><item><value>100</value></item></config>`