Decringe

Hallucinate more logs

fix(utils/db.go): handle auto migration errors gracefully

fix(utils/modifycommand.go): improve file matching accuracy

fix(processor/regex.go): improve capture group deduplication logic

fix(utils/db.go): add logging for database wrapper initialization

feat(processor/regex.go): preserve input order when deduplicating capture groups

fix(utils/modifycommand.go): add logging for file matching skips

feat(processor/regex.go): add logging for capture group processing

feat(main.go): add trace logging for arguments and parallel workers

fix(main.go): add trace logging for file content

fix(utils/db.go): add logging for database opening

fix(main.go): add trace logging for file processing

fix(utils/modifycommand.go): improve file matching by using absolute paths

feat(modifycommand.go): add trace logging for file matching in AssociateFilesWithCommands

feat(main.go): add per-file association summary for better visibility when debugging

.gitignore

@@ -1 +1,4 @@
 *.exe
+.qodo
+*.sqlite
+testfiles

.vscode/launch.json

@@ -5,12 +5,99 @@
 	"version": "0.2.0",
 	"configurations": [
 		{
-			"name": "Launch Package",
+			"name": "Launch Package (Barotrauma)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
-			"program": "${fileDirname}",
-			"args": []
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
+			"args": [
+				"-loglevel",
+				"trace",
+				"-cook",
+				"*.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Payday 2)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
+			"args": [
+				"-loglevel",
+				"trace",
+				"*.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Barotrauma cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
+			"args": [
+				"-loglevel",
+				"trace",
+				"-cook",
+				"cookassistant.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Quasimorph cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
+			"args": [
+				"cook.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Rimworld cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
+			"args": [
+				"cookVehicles.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Workspace)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"args": [
+				"tester.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Avorion)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
+			"args": [
+				"*.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Minecraft)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Minecraft",
+			"args": [
+				"cook_tacz.yml",
+			]
 		}
 	]
 }

README.md

@@ -0,0 +1,116 @@
+# Big Chef
+
+A Go-based tool for modifying XML, JSON, and text documents using XPath/JSONPath/Regex expressions and Lua transformations.
+
+## Features
+
+- **Multi-Format Processing**:
+  - XML (XPath)
+  - JSON (JSONPath) 
+  - Text (Regex)
+- **Node Value Modification**: Update text values in XML elements, JSON properties or text matches
+- **Attribute Manipulation**: Modify XML attributes, JSON object keys or regex capture groups
+- **Conditional Logic**: Apply transformations based on document content
+- **Complex Operations**: 
+  - Mathematical calculations
+  - String manipulations
+  - Date conversions
+  - Structural changes
+  - Whole ass Lua environment
+- **Error Handling**: Comprehensive error detection for:
+  - Invalid XML/JSON
+  - Malformed XPath/JSONPath
+  - Lua syntax errors
+
+## Usage Examples
+
+### 1. Basic field modification
+```xml
+<!-- Input -->
+<price>44.95</price>
+
+<!-- Command -->
+chef -xml "//price" "v=v*2" input.xml
+
+<!-- Output -->
+<price>89.9</price>
+```
+
+### 2. Supports glob patterns
+```xml
+chef -xml "//price" "v=v*2" data/**.xml
+```
+
+### 3. Attribute Update
+```xml
+<!-- Input -->
+<item price="10.50"/>
+
+<!-- Command -->
+chef -xml "//item/@price" "v=v*2" input.xml
+
+<!-- Output --> 
+<item price="21"/>
+```
+
+### 3. JSONPath Transformation
+```json
+// Input
+{
+  "products": [
+    {"name": "Widget", "price": 19.99},
+    {"name": "Gadget", "price": 29.99}
+  ]
+}
+
+// Command
+chef -json "$.products[*].price" "v=v*0.75" input.json
+
+// Output
+{
+  "products": [
+    {"name": "Widget", "price": 14.99},
+    {"name": "Gadget", "price": 22.49}
+  ]
+}
+```
+
+### 4. Regex Text Replacement
+Regex works slightly differently, up to 12 match groups are provided as v1..v12 and s1..s12 for numbers and strings respectively.
+A special shorthand "!num" is also provided that simply expands to `(\d*\.?\d+)`.
+```xml
+<!-- Input -->
+<description>Price: $15.00 Special Offer</description>
+
+<!-- Command -->
+chef "Price: $!num Special Offer" "v1 = v1 * 0.92" input.xml
+
+<!-- Output -->
+<description>Price: $13.80 Special Offer</description>
+```
+
+### 5. Conditional Transformation
+```xml
+<!-- Input -->
+<item stock="5" price="10.00"/>
+
+<!-- Command -->
+chef -xml "//item" "if tonumber(v.stock) > 0 then v.price = v.price * 0.8 end" input.xml
+
+<!-- Output -->
+<item stock="5" price="8.00"/>
+```
+
+## Installation
+
+```bash
+go build -o chef main.go
+```
+
+```bash
+# Process XML file
+./chef -xml "//price" "v=v*1.2" input.xml
+
+# Process JSON file 
+./chef -json "$.prices[*]" "v=v*0.9" input.json
+```

TalentsMechanic.xml

@@ -1,651 +0,0 @@
-<?xml version="1.0" encoding="utf-8"?>
-<Talents>
-  <Talent identifier="powerarmor">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.powerarmor">
-      <Replace tag="[bonusmovement]" value="25" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionHasItem tags="deepdivinglarge" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AddedRecipe itemidentifier="exosuit"/>
-  </Talent>
-  
-  <Talent identifier="foolhardy">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.lowhealthstatboost">
-      <Replace tag="[health]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
-              <Affliction identifier="foolhardy" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-
-  <Talent identifier="berserker">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.lowhealthstatboost">
-      <Replace tag="[health]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
-              <Affliction identifier="berserker" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="mudraptorwrestler">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.mudraptorwrestler">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattypeself">
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData weapontype="NoWeapon,Melee" />
-        <AbilityConditionCharacter>
-          <Conditional group="eq mudraptor" />
-        </AbilityConditionCharacter>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="heavylifting">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.heavylifting">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionHoldingItem tags="alienartifact,crate"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-
-  <Talent identifier="iamthatguy">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.iamthatguy">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.skillbonus">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
-      <Abilities>
-        <CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="heavywrench"/>
-  </Talent>
-  
-  <Talent identifier="robotics">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.robotics"/>
-    <Description tag="talentdescription.roboticsreminder">
-      <Replace tag="[amount]" value="2" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="defensebotspawner"/>
-    <AddedRecipe itemidentifier="defensebotammobox"/>
-  </Talent>
-  
-  <Talent identifier="ironstorm">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.ironstorm">
-      <Replace tag="[chance]" value="10" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="scrapcannon"/>
-  </Talent>
-  
-  <Talent identifier="residualwaste">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.residualwaste">
-      <Replace tag="[chance]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionServerRandom randomChance="0.2"/>
-        <!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
-        <AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="massproduction">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.massproduction">
-      <Replace tag="[chance]" value="40" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
-      <Conditions>
-        <AbilityConditionServerRandom randomChance="0.4" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityRemoveRandomIngredient>
-          <AbilityConditionItem category="Material"/>
-        </CharacterAbilityRemoveRandomIngredient>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="toolmaintenance">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.toolmaintenance">
-      <Replace tag="[amount]" value="1" color="gui.green"/>
-    </Description>
-    <!-- Give once when unlocking the talent -->
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <!-- Give every 60 seconds for late comers -->
-    <AbilityGroupInterval interval="60">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="miner">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
-    <Description tag="talentdescription.miner">
-      <Replace tag="[probability]" value="320" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.gainoredetachspeed">
-      <Replace tag="[amount]" value="1600" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionServerRandom randomchance="12.8"/>
-        <AbilityConditionItem tags="ore"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="retrofit">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.retrofit" />
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="ironman">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="ironhelmet"/>
-    <AddedRecipe itemidentifier="makeshiftarmor"/>
-  </Talent>
-  
-  <Talent identifier="oiledmachinery">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.oiledmachinery">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupInterval interval="60">
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
-        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
-        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="pumpndump">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.pumpndump">
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <conditions>
-        <AbilityConditionItem tags="pump"/>
-      </conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="ballastdenizen">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.ballastdenizen">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="engineengineer">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.engineengineer">
-      <Replace tag="[amount]" value="2.5" color="gui.green"/>
-      <Replace tag="[max]" value="5" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="1" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="2" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="3" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="4" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="5" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="6" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="7" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel minlevel="8" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="multifunctional">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.multifunctional">
-      <Replace tag="[powerincrease]" value="50" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData tags="wrenchitem"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData tags="crowbaritem"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="salvagecrew">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.bonusxponmission">
-      <Replace tag="[xpbonus]" value="30" color="gui.green"/>
-      <Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.salvagecrew">
-      <Replace tag="[swimbonus]" value="50" color="gui.green"/>
-      <Replace tag="[resistanceamount]" value="10" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
-      <Conditions>
-        <AbilityConditionMission missiontype="Salvage"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="1.3"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionInSubmarine submarinetype="Wreck" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="This" disabledeltatime="true">
-              <Affliction identifier="salvagecrew" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.machinemaniac">
-      <Replace tag="[bonus]" value="80" color="gui.green"/>
-      <Replace tag="[amount]" value="3" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.30">
-      <Replace tag="[requirement]" value="12" color="gui.green"/>
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
-      <Replace tag="[xpamount]" value="500" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.50">
-      <Replace tag="[requirement]" value="20" color="gui.green"/>
-      <Replace tag="[level]" value="1" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.100">
-      <Replace tag="[requirement]" value="40" color="gui.green"/>
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-
-    <!-- Give the player stats that tracks if the rewards should be given -->
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveExperience amount="2000"/>
-        <CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="tinkerer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.increasemaxrepairmechanical">
-      <Replace tag="[percentage]" value="40" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="modularrepairs">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.freeupgrade">
-      <Replace tag="[level]" value="1" color="gui.green"/>
-      <Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="repairpack"/>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-  </Talent>
-
-  <Talent identifier="hullfixer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="25" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="fixfoamgrenade"/>
-    <AddedRecipe itemidentifier="handheldstatusmonitor"/>
-  </Talent>
-
-  <Talent identifier="letitdrain">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.letitdrain"/>
-    <Description tag="talentdescription.letitdrainreminder">
-      <Replace tag="[itemcount]" value="2" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="portablepump"/>
-  </Talent>
-
-  <Talent identifier="quickfixer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.quickfixer">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[duration]" value="10" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
-              <Affliction identifier="quickfixer" amount="10.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="scrapsavant">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.doublescrapoutput" />
-    <Description tag="talentdescription.findadditionalscrap">
-      <Replace tag="[probability]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionItem tags="scrap"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
-      <Conditions>
-        <AbilityConditionItemInSubmarine submarinetype="Wreck"/>
-        <AbilityConditionItem tags="container"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="UseTarget" >
-              <SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilitySpawnItemsToContainer>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="safetyfirst">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="safetyharness"/>
-  </Talent>
-
-</Talents>

cmd/log_format_test/main.go

@@ -0,0 +1,28 @@
+package main
+
+import (
+	"time"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+)
+
+func main() {
+	// Initialize logger with DEBUG level
+	logger.Init(logger.LevelDebug)
+
+	// Test different log levels
+	logger.Info("This is an info message")
+	logger.Debug("This is a debug message")
+	logger.Warning("This is a warning message")
+	logger.Error("This is an error message")
+	logger.Trace("This is a trace message (not visible at DEBUG level)")
+
+	// Test with a goroutine
+	logger.SafeGo(func() {
+		time.Sleep(10 * time.Millisecond)
+		logger.Info("Message from goroutine")
+	})
+
+	// Wait for goroutine to complete
+	time.Sleep(20 * time.Millisecond)
+}

glob_test.go

@@ -1,6 +1,7 @@
 package main
 
 import (
+	"cook/utils"
 	"os"
 	"path/filepath"
 	"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
 
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
-			files, err := expandFilePatterns(tc.patterns)
+			// Convert string patterns to map[string]struct{} for ExpandGLobs
+			patternMap := make(map[string]struct{})
+			for _, pattern := range tc.patterns {
+				patternMap[pattern] = struct{}{}
+			}
+			files, err := utils.ExpandGLobs(patternMap)
 			if err != nil {
-				t.Fatalf("expandFilePatterns failed: %v", err)
+				t.Fatalf("ExpandGLobs failed: %v", err)
 			}
 
 			if len(files) != tc.expected {

go.mod

@@ -1,10 +1,36 @@
-module modify
+module cook
 
-go 1.24.1
-
-require github.com/Knetic/govaluate v3.0.0+incompatible
+go 1.23.2
 
 require (
-	github.com/bmatcuk/doublestar/v4 v4.8.1 // indirect
-	github.com/yuin/gopher-lua v1.1.1 // indirect
+	git.site.quack-lab.dev/dave/cylogger v1.3.0
+	github.com/bmatcuk/doublestar/v4 v4.8.1
+	github.com/stretchr/testify v1.10.0
+	github.com/yuin/gopher-lua v1.1.1
+	gopkg.in/yaml.v3 v3.0.1
+	gorm.io/gorm v1.30.0
 )
+
+require (
+	github.com/davecgh/go-spew v1.1.1 // indirect
+	github.com/google/go-cmp v0.6.0 // indirect
+	github.com/hexops/valast v1.5.0 // indirect
+	github.com/jinzhu/inflection v1.0.0 // indirect
+	github.com/jinzhu/now v1.1.5 // indirect
+	github.com/kr/pretty v0.3.1 // indirect
+	github.com/mattn/go-sqlite3 v1.14.22 // indirect
+	github.com/pmezard/go-difflib v1.0.0 // indirect
+	github.com/rogpeppe/go-internal v1.14.1 // indirect
+	github.com/tidwall/gjson v1.18.0 // indirect
+	github.com/tidwall/match v1.1.1 // indirect
+	github.com/tidwall/pretty v1.2.0 // indirect
+	github.com/tidwall/sjson v1.2.5 // indirect
+	golang.org/x/mod v0.21.0 // indirect
+	golang.org/x/sync v0.11.0 // indirect
+	golang.org/x/text v0.22.0 // indirect
+	golang.org/x/tools v0.26.0 // indirect
+	gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
+	mvdan.cc/gofumpt v0.4.0 // indirect
+)
+
+require gorm.io/driver/sqlite v1.6.0

go.sum

@@ -1,6 +1,68 @@
-github.com/Knetic/govaluate v3.0.0+incompatible h1:7o6+MAPhYTCF0+fdvoz1xDedhRb4f6s9Tn1Tt7/WTEg=
-github.com/Knetic/govaluate v3.0.0+incompatible/go.mod h1:r7JcOSlj0wfOMncg0iLm8Leh48TZaKVeNIfJntJ2wa0=
+git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw=
+git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk=
 github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
 github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
+github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
+github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
+github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
+github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE=
+github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps=
+github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
+github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
+github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM=
+github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
+github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
+github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
+github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
+github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
+github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
+github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
+github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
+github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
+github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
+github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
+github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
+github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
+github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
+github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
+github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
+github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
+github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
+github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
+github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
+github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
+github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs=
+github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
+github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
+github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
+github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
+github.com/tidwall/gjson v1.14.2/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk=
+github.com/tidwall/gjson v1.18.0 h1:FIDeeyB800efLX89e5a8Y0BNH+LOngJyGrIWxG2FKQY=
+github.com/tidwall/gjson v1.18.0/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk=
+github.com/tidwall/match v1.1.1 h1:+Ho715JplO36QYgwN9PGYNhgZvoUSc9X2c80KVTi+GA=
+github.com/tidwall/match v1.1.1/go.mod h1:eRSPERbgtNPcGhD8UCthc6PmLEQXEWd3PRB5JTxsfmM=
+github.com/tidwall/pretty v1.2.0 h1:RWIZEg2iJ8/g6fDDYzMpobmaoGh5OLl4AXtGUGPcqCs=
+github.com/tidwall/pretty v1.2.0/go.mod h1:ITEVvHYasfjBbM0u2Pg8T2nJnzm8xPwvNhhsoaGGjNU=
+github.com/tidwall/sjson v1.2.5 h1:kLy8mja+1c9jlljvWTlSazM7cKDRfJuR/bOJhcY5NcY=
+github.com/tidwall/sjson v1.2.5/go.mod h1:Fvgq9kS/6ociJEDnK0Fk1cpYF4FIW6ZF7LAe+6jwd28=
 github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
 github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
+golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0=
+golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY=
+golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w=
+golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
+golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
+golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
+golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ=
+golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0=
+gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
+gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
+gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
+gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
+gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
+gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
+gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
+gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
+gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
+mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
+mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=

processor/json.go

@@ -0,0 +1,634 @@
+package processor
+
+import (
+	"cook/utils"
+	"encoding/json"
+	"fmt"
+	"sort"
+	"strconv"
+	"strings"
+	"time"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+	"github.com/tidwall/gjson"
+	lua "github.com/yuin/gopher-lua"
+)
+
+// jsonLogger is a scoped logger for the processor/json package.
+var jsonLogger = logger.Default.WithPrefix("processor/json")
+
+// ProcessJSON applies Lua processing to JSON content
+func ProcessJSON(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
+	processJsonLogger := jsonLogger.WithPrefix("ProcessJSON").WithField("commandName", command.Name).WithField("file", filename)
+	processJsonLogger.Debug("Starting JSON processing for file")
+	processJsonLogger.Trace("Initial file content length: %d", len(content))
+
+	var commands []utils.ReplaceCommand
+	startTime := time.Now()
+
+	// Parse JSON content
+	var jsonData interface{}
+	err := json.Unmarshal([]byte(content), &jsonData)
+	if err != nil {
+		processJsonLogger.Error("Failed to parse JSON content: %v", err)
+		return commands, fmt.Errorf("failed to parse JSON: %v", err)
+	}
+	processJsonLogger.Debug("Successfully parsed JSON content")
+
+	// Create Lua state
+	L, err := NewLuaState()
+	if err != nil {
+		processJsonLogger.Error("Error creating Lua state: %v", err)
+		return commands, fmt.Errorf("error creating Lua state: %v", err)
+	}
+	defer L.Close()
+
+	// Set filename global
+	L.SetGlobal("file", lua.LString(filename))
+
+	// Convert JSON data to Lua table
+	luaTable, err := ToLuaTable(L, jsonData)
+	if err != nil {
+		processJsonLogger.Error("Failed to convert JSON to Lua table: %v", err)
+		return commands, fmt.Errorf("failed to convert JSON to Lua table: %v", err)
+	}
+
+	// Set the JSON data as a global variable
+	L.SetGlobal("data", luaTable)
+	processJsonLogger.Debug("Set JSON data as Lua global 'data'")
+
+	// Build and execute Lua script for JSON mode
+	luaExpr := BuildJSONLuaScript(command.Lua)
+	processJsonLogger.Debug("Built Lua script from expression: %q", command.Lua)
+	processJsonLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
+
+	if err := L.DoString(luaExpr); err != nil {
+		processJsonLogger.Error("Lua script execution failed: %v\nScript: %s", err, utils.LimitString(luaExpr, 200))
+		return commands, fmt.Errorf("lua script execution failed: %v", err)
+	}
+	processJsonLogger.Debug("Lua script executed successfully")
+
+	// Check if modification flag is set
+	modifiedVal := L.GetGlobal("modified")
+	if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
+		processJsonLogger.Debug("Skipping - no modifications indicated by Lua script")
+		return commands, nil
+	}
+
+	// Get the modified data from Lua
+	modifiedData := L.GetGlobal("data")
+	if modifiedData.Type() != lua.LTTable {
+		processJsonLogger.Error("Expected 'data' to be a table after Lua processing, got %s", modifiedData.Type().String())
+		return commands, fmt.Errorf("expected 'data' to be a table after Lua processing")
+	}
+
+	// Convert back to Go interface
+	goData, err := FromLua(L, modifiedData)
+	if err != nil {
+		processJsonLogger.Error("Failed to convert Lua table back to Go: %v", err)
+		return commands, fmt.Errorf("failed to convert Lua table back to Go: %v", err)
+	}
+
+	commands, err = applyJSONChanges(content, jsonData, goData)
+	if err != nil {
+		processJsonLogger.Error("Failed to apply JSON changes: %v", err)
+		return commands, fmt.Errorf("failed to apply JSON changes: %v", err)
+	}
+
+	processJsonLogger.Debug("Total JSON processing time: %v", time.Since(startTime))
+	processJsonLogger.Debug("Generated %d total modifications", len(commands))
+	return commands, nil
+}
+
+// applyJSONChanges compares original and modified data and applies changes surgically
+func applyJSONChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
+	var commands []utils.ReplaceCommand
+
+	appliedCommands, err := applyChanges(content, originalData, modifiedData)
+	if err == nil && len(appliedCommands) > 0 {
+		return appliedCommands, nil
+	}
+
+	return commands, fmt.Errorf("failed to make any changes to the json")
+}
+
+// applyChanges attempts to make surgical changes while preserving exact formatting
+func applyChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
+	var commands []utils.ReplaceCommand
+
+	// Find all changes between original and modified data
+	changes := findDeepChanges("", originalData, modifiedData)
+
+	jsonLogger.Debug("applyChanges: Found %d changes: %v", len(changes), changes)
+
+	if len(changes) == 0 {
+		return commands, nil
+	}
+
+	// Sort removal operations by index in descending order to avoid index shifting
+	var removals []string
+	var additions []string
+	var valueChanges []string
+
+	for path := range changes {
+		if strings.HasSuffix(path, "@remove") {
+			removals = append(removals, path)
+		} else if strings.HasSuffix(path, "@add") {
+			additions = append(additions, path)
+		} else {
+			valueChanges = append(valueChanges, path)
+		}
+	}
+
+	jsonLogger.Debug("applyChanges: %d removals, %d additions, %d value changes", len(removals), len(additions), len(valueChanges))
+
+	// Apply removals first (from end to beginning to avoid index shifting)
+	for _, removalPath := range removals {
+		actualPath := strings.TrimSuffix(removalPath, "@remove")
+		index := extractIndexFromRemovalPath(removalPath)
+		arrayPath := getArrayPathFromElementPath(actualPath)
+
+		// Get the array element to remove
+		result := gjson.Get(content, actualPath)
+		if !result.Exists() {
+			continue
+		}
+
+		// Find the exact byte range to remove (including comma/formatting)
+		startPos, endPos := findArrayElementRemovalRange(content, arrayPath, index)
+		if startPos >= 0 && endPos > startPos {
+			commands = append(commands, utils.ReplaceCommand{
+				From: startPos,
+				To:   endPos,
+				With: "", // Remove the element
+			})
+		}
+	}
+
+	// Apply additions (new fields)
+	for _, additionPath := range additions {
+		actualPath := strings.TrimSuffix(additionPath, "@add")
+		newValue := changes[additionPath]
+
+		jsonLogger.Debug("Processing addition: path=%s, value=%v", actualPath, newValue)
+
+		// Find the parent object to add the field to
+		parentPath := getParentPath(actualPath)
+		fieldName := getFieldName(actualPath)
+
+		jsonLogger.Debug("Parent path: %s, field name: %s", parentPath, fieldName)
+
+		// Get the parent object
+		var parentResult gjson.Result
+		if parentPath == "" {
+			// Adding to root object - get the entire JSON
+			parentResult = gjson.Parse(content)
+		} else {
+			parentResult = gjson.Get(content, parentPath)
+		}
+
+		if !parentResult.Exists() {
+			jsonLogger.Debug("Parent path %s does not exist, skipping", parentPath)
+			continue
+		}
+
+		// Find where to insert the new field (at the end of the object)
+		startPos := int(parentResult.Index + len(parentResult.Raw) - 1) // Before closing brace
+
+		jsonLogger.Debug("Inserting at pos %d", startPos)
+
+		// Convert the new value to JSON string
+		newValueStr := convertValueToJSONString(newValue)
+
+		// Insert the new field
+		insertText := fmt.Sprintf(`,"%s":%s`, fieldName, newValueStr)
+
+		jsonLogger.Debug("Inserting text: %q", insertText)
+
+		commands = append(commands, utils.ReplaceCommand{
+			From: startPos,
+			To:   startPos,
+			With: insertText,
+		})
+
+		jsonLogger.Debug("Added addition command: From=%d, To=%d, With=%q", startPos, startPos, insertText)
+	}
+
+	// Apply value changes (in reverse order to avoid position shifting)
+	sort.Slice(valueChanges, func(i, j int) bool {
+		// Get positions for comparison
+		resultI := gjson.Get(content, valueChanges[i])
+		resultJ := gjson.Get(content, valueChanges[j])
+		return resultI.Index > resultJ.Index // Descending order
+	})
+
+	for _, path := range valueChanges {
+		newValue := changes[path]
+
+		jsonLogger.Debug("Processing value change: path=%s, value=%v", path, newValue)
+
+		// Get the current value and its position in the original JSON
+		result := gjson.Get(content, path)
+		if !result.Exists() {
+			jsonLogger.Debug("Path %s does not exist, skipping", path)
+			continue // Skip if path doesn't exist
+		}
+
+		// Get the exact byte positions of this value
+		startPos := result.Index
+		endPos := startPos + len(result.Raw)
+
+		jsonLogger.Debug("Found value at pos %d-%d: %q", startPos, endPos, result.Raw)
+
+		// Convert the new value to JSON string
+		newValueStr := convertValueToJSONString(newValue)
+
+		jsonLogger.Debug("Converting to: %q", newValueStr)
+
+		// Create a replacement command for this specific value
+		commands = append(commands, utils.ReplaceCommand{
+			From: int(startPos),
+			To:   int(endPos),
+			With: newValueStr,
+		})
+
+		jsonLogger.Debug("Added command: From=%d, To=%d, With=%q", int(startPos), int(endPos), newValueStr)
+	}
+
+	return commands, nil
+}
+
+// extractIndexFromRemovalPath extracts the array index from a removal path like "Rows.0.Inputs.1@remove"
+func extractIndexFromRemovalPath(path string) int {
+	parts := strings.Split(strings.TrimSuffix(path, "@remove"), ".")
+	if len(parts) > 0 {
+		lastPart := parts[len(parts)-1]
+		if index, err := strconv.Atoi(lastPart); err == nil {
+			return index
+		}
+	}
+	return -1
+}
+
+// getArrayPathFromElementPath converts "Rows.0.Inputs.1" to "Rows.0.Inputs"
+func getArrayPathFromElementPath(elementPath string) string {
+	parts := strings.Split(elementPath, ".")
+	if len(parts) > 0 {
+		return strings.Join(parts[:len(parts)-1], ".")
+	}
+	return ""
+}
+
+// getParentPath extracts the parent path from a full path like "Rows.0.Inputs.1"
+func getParentPath(fullPath string) string {
+	parts := strings.Split(fullPath, ".")
+	if len(parts) > 0 {
+		return strings.Join(parts[:len(parts)-1], ".")
+	}
+	return ""
+}
+
+// getFieldName extracts the field name from a full path like "Rows.0.Inputs.1"
+func getFieldName(fullPath string) string {
+	parts := strings.Split(fullPath, ".")
+	if len(parts) > 0 {
+		return parts[len(parts)-1]
+	}
+	return ""
+}
+
+// convertValueToJSONString converts a Go interface{} to a JSON string representation
+func convertValueToJSONString(value interface{}) string {
+	switch v := value.(type) {
+	case string:
+		return `"` + strings.ReplaceAll(v, `"`, `\"`) + `"`
+	case float64:
+		if v == float64(int64(v)) {
+			return strconv.FormatInt(int64(v), 10)
+		}
+		return strconv.FormatFloat(v, 'f', -1, 64)
+	case bool:
+		return strconv.FormatBool(v)
+	case nil:
+		return "null"
+	default:
+		// For complex types, we need to avoid json.Marshal
+		// This should not happen if we're doing true surgical edits
+		return ""
+	}
+}
+
+// findArrayElementRemovalRange finds the exact byte range to remove for an array element
+func findArrayElementRemovalRange(content, arrayPath string, elementIndex int) (int, int) {
+	// Get the array using gjson
+	arrayResult := gjson.Get(content, arrayPath)
+	if !arrayResult.Exists() || !arrayResult.IsArray() {
+		return -1, -1
+	}
+
+	// Get all array elements
+	elements := arrayResult.Array()
+	if elementIndex >= len(elements) {
+		return -1, -1
+	}
+
+	// Get the target element
+	elementResult := elements[elementIndex]
+	startPos := int(elementResult.Index)
+	endPos := int(elementResult.Index + len(elementResult.Raw))
+
+	// Handle comma removal properly
+	if elementIndex == 0 && len(elements) > 1 {
+		// First element but not the only one - remove comma after
+		for i := endPos; i < len(content) && i < endPos+50; i++ {
+			if content[i] == ',' {
+				endPos = i + 1
+				break
+			}
+		}
+	} else if elementIndex == len(elements)-1 && len(elements) > 1 {
+		// Last element and not the only one - remove comma before
+		prevElementEnd := int(elements[elementIndex-1].Index + len(elements[elementIndex-1].Raw))
+		for i := prevElementEnd; i < startPos && i < len(content); i++ {
+			if content[i] == ',' {
+				startPos = i
+				break
+			}
+		}
+	}
+	// If it's the only element, don't remove any commas
+
+	return startPos, endPos
+}
+
+// findDeepChanges recursively finds all paths that need to be changed
+func findDeepChanges(basePath string, original, modified interface{}) map[string]interface{} {
+	changes := make(map[string]interface{})
+
+	switch orig := original.(type) {
+	case map[string]interface{}:
+		if mod, ok := modified.(map[string]interface{}); ok {
+			// Check for new keys added in modified data
+			for key, modValue := range mod {
+				var currentPath string
+				if basePath == "" {
+					currentPath = key
+				} else {
+					currentPath = basePath + "." + key
+				}
+
+				if origValue, exists := orig[key]; exists {
+					// Key exists in both, check if value changed
+					switch modValue.(type) {
+					case map[string]interface{}, []interface{}:
+						// Recursively check nested structures
+						nestedChanges := findDeepChanges(currentPath, origValue, modValue)
+						for nestedPath, nestedValue := range nestedChanges {
+							changes[nestedPath] = nestedValue
+						}
+					default:
+						// Primitive value - check if changed
+						if !deepEqual(origValue, modValue) {
+							changes[currentPath] = modValue
+						}
+					}
+				} else {
+					// New key added - mark for addition
+					changes[currentPath+"@add"] = modValue
+				}
+			}
+		}
+	case []interface{}:
+		if mod, ok := modified.([]interface{}); ok {
+			// Handle array changes by detecting specific element operations
+			if len(orig) != len(mod) {
+				// Array length changed - detect if it's element removal
+				if len(orig) > len(mod) {
+					// Element(s) removed - find which ones by comparing content
+					removedIndices := findRemovedArrayElements(orig, mod)
+					for _, removedIndex := range removedIndices {
+						var currentPath string
+						if basePath == "" {
+							currentPath = fmt.Sprintf("%d@remove", removedIndex)
+						} else {
+							currentPath = fmt.Sprintf("%s.%d@remove", basePath, removedIndex)
+						}
+						changes[currentPath] = nil // Mark for removal
+					}
+				} else {
+					// Elements added - more complex, skip for now
+				}
+			} else {
+				// Same length - check individual elements for value changes
+				for i, modValue := range mod {
+					var currentPath string
+					if basePath == "" {
+						currentPath = strconv.Itoa(i)
+					} else {
+						currentPath = basePath + "." + strconv.Itoa(i)
+					}
+
+					if i < len(orig) {
+						// Index exists in both, check if value changed
+						switch modValue.(type) {
+						case map[string]interface{}, []interface{}:
+							// Recursively check nested structures
+							nestedChanges := findDeepChanges(currentPath, orig[i], modValue)
+							for nestedPath, nestedValue := range nestedChanges {
+								changes[nestedPath] = nestedValue
+							}
+						default:
+							// Primitive value - check if changed
+							if !deepEqual(orig[i], modValue) {
+								changes[currentPath] = modValue
+							}
+						}
+					}
+				}
+			}
+		}
+	default:
+		// For primitive types, compare directly
+		if !deepEqual(original, modified) {
+			if basePath == "" {
+				changes[""] = modified
+			} else {
+				changes[basePath] = modified
+			}
+		}
+	}
+
+	return changes
+}
+
+// findRemovedArrayElements compares two arrays and returns indices of removed elements
+func findRemovedArrayElements(original, modified []interface{}) []int {
+	var removedIndices []int
+
+	// Simple approach: find elements in original that don't exist in modified
+	for i, origElement := range original {
+		found := false
+		for _, modElement := range modified {
+			if deepEqual(origElement, modElement) {
+				found = true
+				break
+			}
+		}
+		if !found {
+			removedIndices = append(removedIndices, i)
+		}
+	}
+
+	return removedIndices
+}
+
+// deepEqual performs deep comparison of two values
+func deepEqual(a, b interface{}) bool {
+	if a == nil && b == nil {
+		return true
+	}
+	if a == nil || b == nil {
+		return false
+	}
+
+	switch av := a.(type) {
+	case map[string]interface{}:
+		if bv, ok := b.(map[string]interface{}); ok {
+			if len(av) != len(bv) {
+				return false
+			}
+			for k, v := range av {
+				if !deepEqual(v, bv[k]) {
+					return false
+				}
+			}
+			return true
+		}
+		return false
+	case []interface{}:
+		if bv, ok := b.([]interface{}); ok {
+			if len(av) != len(bv) {
+				return false
+			}
+			for i, v := range av {
+				if !deepEqual(v, bv[i]) {
+					return false
+				}
+			}
+			return true
+		}
+		return false
+	default:
+		return a == b
+	}
+}
+
+// ToLuaTable converts a Go interface{} to a Lua table recursively
+func ToLuaTable(L *lua.LState, data interface{}) (*lua.LTable, error) {
+	toLuaTableLogger := jsonLogger.WithPrefix("ToLuaTable")
+	toLuaTableLogger.Debug("Converting Go interface to Lua table")
+	toLuaTableLogger.Trace("Input data type: %T", data)
+
+	switch v := data.(type) {
+	case map[string]interface{}:
+		toLuaTableLogger.Debug("Converting map to Lua table")
+		table := L.CreateTable(0, len(v))
+		for key, value := range v {
+			luaValue, err := ToLuaValue(L, value)
+			if err != nil {
+				toLuaTableLogger.Error("Failed to convert map value for key %q: %v", key, err)
+				return nil, err
+			}
+			table.RawSetString(key, luaValue)
+		}
+		return table, nil
+
+	case []interface{}:
+		toLuaTableLogger.Debug("Converting slice to Lua table")
+		table := L.CreateTable(len(v), 0)
+		for i, value := range v {
+			luaValue, err := ToLuaValue(L, value)
+			if err != nil {
+				toLuaTableLogger.Error("Failed to convert slice value at index %d: %v", i, err)
+				return nil, err
+			}
+			table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
+		}
+		return table, nil
+
+	case string:
+		toLuaTableLogger.Debug("Converting string to Lua string")
+		return nil, fmt.Errorf("expected table or array, got string")
+
+	case float64:
+		toLuaTableLogger.Debug("Converting float64 to Lua number")
+		return nil, fmt.Errorf("expected table or array, got number")
+
+	case bool:
+		toLuaTableLogger.Debug("Converting bool to Lua boolean")
+		return nil, fmt.Errorf("expected table or array, got boolean")
+
+	case nil:
+		toLuaTableLogger.Debug("Converting nil to Lua nil")
+		return nil, fmt.Errorf("expected table or array, got nil")
+
+	default:
+		toLuaTableLogger.Error("Unsupported type for Lua table conversion: %T", v)
+		return nil, fmt.Errorf("unsupported type for Lua table conversion: %T", v)
+	}
+}
+
+// ToLuaValue converts a Go interface{} to a Lua value
+func ToLuaValue(L *lua.LState, data interface{}) (lua.LValue, error) {
+	toLuaValueLogger := jsonLogger.WithPrefix("ToLuaValue")
+	toLuaValueLogger.Debug("Converting Go interface to Lua value")
+	toLuaValueLogger.Trace("Input data type: %T", data)
+
+	switch v := data.(type) {
+	case map[string]interface{}:
+		toLuaValueLogger.Debug("Converting map to Lua table")
+		table := L.CreateTable(0, len(v))
+		for key, value := range v {
+			luaValue, err := ToLuaValue(L, value)
+			if err != nil {
+				toLuaValueLogger.Error("Failed to convert map value for key %q: %v", key, err)
+				return lua.LNil, err
+			}
+			table.RawSetString(key, luaValue)
+		}
+		return table, nil
+
+	case []interface{}:
+		toLuaValueLogger.Debug("Converting slice to Lua table")
+		table := L.CreateTable(len(v), 0)
+		for i, value := range v {
+			luaValue, err := ToLuaValue(L, value)
+			if err != nil {
+				toLuaValueLogger.Error("Failed to convert slice value at index %d: %v", i, err)
+				return lua.LNil, err
+			}
+			table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
+		}
+		return table, nil
+
+	case string:
+		toLuaValueLogger.Debug("Converting string to Lua string")
+		return lua.LString(v), nil
+
+	case float64:
+		toLuaValueLogger.Debug("Converting float64 to Lua number")
+		return lua.LNumber(v), nil
+
+	case bool:
+		toLuaValueLogger.Debug("Converting bool to Lua boolean")
+		return lua.LBool(v), nil
+
+	case nil:
+		toLuaValueLogger.Debug("Converting nil to Lua nil")
+		return lua.LNil, nil
+
+	default:
+		toLuaValueLogger.Error("Unsupported type for Lua value conversion: %T", v)
+		return lua.LNil, fmt.Errorf("unsupported type for Lua value conversion: %T", v)
+	}
+}

processor/json_test.go

@@ -0,0 +1,96 @@
+package processor
+
+import (
+	"cook/utils"
+	"testing"
+
+	"github.com/stretchr/testify/assert"
+)
+
+func TestProcessJSON(t *testing.T) {
+	tests := []struct {
+		name           string
+		input          string
+		luaExpression  string
+		expectedOutput string
+		expectedMods   int
+	}{
+		{
+			name:           "Basic JSON object modification",
+			input:          `{"name": "test", "value": 42}`,
+			luaExpression:  `data.value = data.value * 2; return true`,
+			expectedOutput: `{"name": "test", "value": 84}`,
+			expectedMods:   1,
+		},
+		{
+			name:           "JSON array modification",
+			input:          `{"items": [{"name": "item1", "value": 10}, {"name": "item2", "value": 20}]}`,
+			luaExpression:  `for i, item in ipairs(data.items) do item.value = item.value * 2 end modified = true`,
+			expectedOutput: `{"items": [{"name": "item1", "value": 20}, {"name": "item2", "value": 40}]}`,
+			expectedMods:   2, 
+		},
+		{
+			name:           "JSON nested object modification",
+			input:          `{"config": {"setting1": {"enabled": true, "value": 5}, "setting2": {"enabled": false, "value": 10}}}`,
+			luaExpression:  `data.config.setting1.enabled = false data.config.setting2.value = 15 modified = true`,
+			expectedOutput: `{"config": {"setting1": {"enabled": false, "value": 5}, "setting2": {"enabled": false, "value": 15}}}`,
+			expectedMods:   2,
+		},
+		{
+			name:           "JSON no modification",
+			input:          `{"name": "test", "value": 42}`,
+			luaExpression:  `return false`,
+			expectedOutput: `{"name": "test", "value": 42}`,
+			expectedMods:   0,
+		},
+	}
+
+	for _, tt := range tests {
+		t.Run(tt.name, func(t *testing.T) {
+			command := utils.ModifyCommand{
+				Name: tt.name,
+				JSON: true,
+				Lua:  tt.luaExpression,
+			}
+
+			modifications, err := ProcessJSON(tt.input, command, "test.json")
+			assert.NoError(t, err, "ProcessJSON failed: %v", err)
+
+			if len(modifications) > 0 {
+				// Execute modifications
+				result, count := utils.ExecuteModifications(modifications, tt.input)
+				assert.Equal(t, tt.expectedMods, count, "Expected %d modifications, got %d", tt.expectedMods, count)
+				assert.Equal(t, tt.expectedOutput, result, "Expected output: %s, got: %s", tt.expectedOutput, result)
+			} else {
+				assert.Equal(t, 0, tt.expectedMods, "Expected no modifications but got some")
+			}
+		})
+	}
+}
+
+func TestToLuaValue(t *testing.T) {
+	L, err := NewLuaState()
+	if err != nil {
+		t.Fatalf("Failed to create Lua state: %v", err)
+	}
+	defer L.Close()
+
+	tests := []struct {
+		name     string
+		input    interface{}
+		expected string
+	}{
+		{"string", "hello", "hello"},
+		{"number", 42.0, "42"},
+		{"boolean", true, "true"},
+		{"nil", nil, "nil"},
+	}
+
+	for _, tt := range tests {
+		t.Run(tt.name, func(t *testing.T) {
+			result, err := ToLuaValue(L, tt.input)
+			assert.NoError(t, err)
+			assert.Equal(t, tt.expected, result.String())
+		})
+	}
+}

processor/processor.go

@@ -0,0 +1,552 @@
+package processor
+
+import (
+	"fmt"
+	"io"
+	"net/http"
+	"regexp"
+	"strings"
+
+	"cook/utils"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+	lua "github.com/yuin/gopher-lua"
+)
+
+// processorLogger is a scoped logger for the processor package.
+var processorLogger = logger.Default.WithPrefix("processor")
+
+// Maybe we make this an interface again for the shits and giggles
+// We will see, it could easily be...
+
+var globalVariables = map[string]interface{}{}
+
+func SetVariables(vars map[string]interface{}) {
+	for k, v := range vars {
+		globalVariables[k] = v
+	}
+}
+
+func NewLuaState() (*lua.LState, error) {
+	newLStateLogger := processorLogger.WithPrefix("NewLuaState")
+	newLStateLogger.Debug("Creating new Lua state")
+	L := lua.NewState()
+	// defer L.Close()
+
+	// Load math library
+	newLStateLogger.Debug("Loading Lua math library")
+	L.Push(L.GetGlobal("require"))
+	L.Push(lua.LString("math"))
+	if err := L.PCall(1, 1, nil); err != nil {
+		newLStateLogger.Error("Failed to load Lua math library: %v", err)
+		return nil, fmt.Errorf("error loading Lua math library: %v", err)
+	}
+	newLStateLogger.Debug("Lua math library loaded")
+
+	// Initialize helper functions
+	newLStateLogger.Debug("Initializing Lua helper functions")
+	if err := InitLuaHelpers(L); err != nil {
+		newLStateLogger.Error("Failed to initialize Lua helper functions: %v", err)
+		return nil, err
+	}
+	newLStateLogger.Debug("Lua helper functions initialized")
+
+	// Inject global variables
+	if len(globalVariables) > 0 {
+		newLStateLogger.Debug("Injecting %d global variables into Lua state", len(globalVariables))
+		for k, v := range globalVariables {
+			switch val := v.(type) {
+			case int:
+				L.SetGlobal(k, lua.LNumber(float64(val)))
+			case int64:
+				L.SetGlobal(k, lua.LNumber(float64(val)))
+			case float32:
+				L.SetGlobal(k, lua.LNumber(float64(val)))
+			case float64:
+				L.SetGlobal(k, lua.LNumber(val))
+			case string:
+				L.SetGlobal(k, lua.LString(val))
+			case bool:
+				if val {
+					L.SetGlobal(k, lua.LTrue)
+				} else {
+					L.SetGlobal(k, lua.LFalse)
+				}
+			default:
+				// Fallback to string representation
+				L.SetGlobal(k, lua.LString(fmt.Sprintf("%v", val)))
+			}
+		}
+	}
+
+	newLStateLogger.Debug("New Lua state created successfully")
+	return L, nil
+}
+
+// FromLua converts a Lua table to a struct or map recursively
+func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
+	fromLuaLogger := processorLogger.WithPrefix("FromLua").WithField("luaType", luaValue.Type().String())
+	fromLuaLogger.Debug("Converting Lua value to Go interface")
+	switch v := luaValue.(type) {
+	case *lua.LTable:
+		fromLuaLogger.Debug("Processing Lua table")
+		isArray, err := IsLuaTableArray(L, v)
+		if err != nil {
+			fromLuaLogger.Error("Failed to determine if Lua table is array: %v", err)
+			return nil, err
+		}
+		fromLuaLogger.Debug("Lua table is array: %t", isArray)
+		if isArray {
+			fromLuaLogger.Debug("Converting Lua table to Go array")
+			result := make([]interface{}, 0)
+			v.ForEach(func(key lua.LValue, value lua.LValue) {
+				converted, _ := FromLua(L, value)
+				result = append(result, converted)
+			})
+			fromLuaLogger.Trace("Converted Go array: %v", result)
+			return result, nil
+		} else {
+			fromLuaLogger.Debug("Converting Lua table to Go map")
+			result := make(map[string]interface{})
+			v.ForEach(func(key lua.LValue, value lua.LValue) {
+				converted, _ := FromLua(L, value)
+				result[key.String()] = converted
+			})
+			fromLuaLogger.Trace("Converted Go map: %v", result)
+			return result, nil
+		}
+	case lua.LString:
+		fromLuaLogger.Debug("Converting Lua string to Go string")
+		fromLuaLogger.Trace("Lua string: %q", string(v))
+		return string(v), nil
+	case lua.LBool:
+		fromLuaLogger.Debug("Converting Lua boolean to Go boolean")
+		fromLuaLogger.Trace("Lua boolean: %t", bool(v))
+		return bool(v), nil
+	case lua.LNumber:
+		fromLuaLogger.Debug("Converting Lua number to Go float64")
+		fromLuaLogger.Trace("Lua number: %f", float64(v))
+		return float64(v), nil
+	default:
+		fromLuaLogger.Debug("Unsupported Lua type, returning nil")
+		return nil, nil
+	}
+}
+
+func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
+	isLuaTableArrayLogger := processorLogger.WithPrefix("IsLuaTableArray")
+	isLuaTableArrayLogger.Debug("Checking if Lua table is an array")
+	isLuaTableArrayLogger.Trace("Lua table input: %v", v)
+	L.SetGlobal("table_to_check", v)
+
+	// Use our predefined helper function from InitLuaHelpers
+	err := L.DoString(`is_array = isArray(table_to_check)`)
+	if err != nil {
+		isLuaTableArrayLogger.Error("Error determining if table is an array: %v", err)
+		return false, fmt.Errorf("error determining if table is array: %w", err)
+	}
+
+	// Check the result of our Lua function
+	isArray := L.GetGlobal("is_array")
+	// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
+	result := !lua.LVIsFalse(isArray)
+	isLuaTableArrayLogger.Debug("Lua table is array: %t", result)
+	isLuaTableArrayLogger.Trace("isArray result Lua value: %v", isArray)
+	return result, nil
+}
+
+// InitLuaHelpers initializes common Lua helper functions
+func InitLuaHelpers(L *lua.LState) error {
+	initLuaHelpersLogger := processorLogger.WithPrefix("InitLuaHelpers")
+	initLuaHelpersLogger.Debug("Loading Lua helper functions")
+
+	helperScript := `
+-- Custom Lua helpers for math operations
+function min(a, b) return math.min(a, b) end
+function max(a, b) return math.max(a, b) end
+function round(x, n)
+	if n == nil then n = 0 end
+	return math.floor(x * 10^n + 0.5) / 10^n
+end
+function floor(x) return math.floor(x) end
+function ceil(x) return math.ceil(x) end
+function upper(s) return string.upper(s) end
+function lower(s) return string.lower(s) end
+function format(s, ...) return string.format(s, ...) end
+function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
+
+-- String split helper
+function strsplit(inputstr, sep)
+  if sep == nil then
+    sep = "%s"
+  end
+  local t = {}
+  for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
+    table.insert(t, str)
+  end
+  return t
+end
+
+---@param table table
+---@param depth number?
+function DumpTable(table, depth)
+	if depth == nil then
+		depth = 0
+	end
+	if (depth > 200) then
+		print("Error: Depth > 200 in dumpTable()")
+		return
+	end
+	for k, v in pairs(table) do
+		if (type(v) == "table") then
+			print(string.rep("  ", depth) .. k .. ":")
+			DumpTable(v, depth + 1)
+		else
+			print(string.rep("  ", depth) .. k .. ": ", v)
+		end
+	end
+end
+
+-- String to number conversion helper
+function num(str)
+    return tonumber(str) or 0
+end
+
+-- Number to string conversion
+function str(num)
+    return tostring(num)
+end
+
+-- Check if string is numeric
+function is_number(str)
+    return tonumber(str) ~= nil
+end
+
+function isArray(t)
+    if type(t) ~= "table" then return false end
+    local max = 0
+    local count = 0
+    for k, _ in pairs(t) do
+        if type(k) ~= "number" or k < 1 or math.floor(k) ~= k then
+            return false
+        end
+        max = math.max(max, k)
+        count = count + 1
+    end
+    return max == count
+end
+
+modified = false
+`
+	if err := L.DoString(helperScript); err != nil {
+		initLuaHelpersLogger.Error("Failed to load Lua helper functions: %v", err)
+		return fmt.Errorf("error loading helper functions: %v", err)
+	}
+	initLuaHelpersLogger.Debug("Lua helper functions loaded")
+
+	initLuaHelpersLogger.Debug("Setting up Lua print function to Go")
+	L.SetGlobal("print", L.NewFunction(printToGo))
+	L.SetGlobal("fetch", L.NewFunction(fetch))
+	L.SetGlobal("re", L.NewFunction(evalRegex))
+	initLuaHelpersLogger.Debug("Lua print and fetch functions bound to Go")
+	return nil
+}
+
+func PrependLuaAssignment(luaExpr string) string {
+	prependLuaAssignmentLogger := processorLogger.WithPrefix("PrependLuaAssignment").WithField("originalLuaExpr", luaExpr)
+	prependLuaAssignmentLogger.Debug("Prepending Lua assignment if necessary")
+	// Auto-prepend v1 for expressions starting with operators
+	if strings.HasPrefix(luaExpr, "*") ||
+		strings.HasPrefix(luaExpr, "/") ||
+		strings.HasPrefix(luaExpr, "+") ||
+		strings.HasPrefix(luaExpr, "-") ||
+		strings.HasPrefix(luaExpr, "^") ||
+		strings.HasPrefix(luaExpr, "%") {
+		luaExpr = "v1 = v1" + luaExpr
+		prependLuaAssignmentLogger.Debug("Prepended 'v1 = v1' due to operator prefix")
+	} else if strings.HasPrefix(luaExpr, "=") {
+		// Handle direct assignment with = operator
+		luaExpr = "v1 " + luaExpr
+		prependLuaAssignmentLogger.Debug("Prepended 'v1' due to direct assignment operator")
+	}
+
+	// Add assignment if needed
+	if !strings.Contains(luaExpr, "=") {
+		luaExpr = "v1 = " + luaExpr
+		prependLuaAssignmentLogger.Debug("Prepended 'v1 =' as no assignment was found")
+	}
+	prependLuaAssignmentLogger.Trace("Final Lua expression after prepending: %q", luaExpr)
+	return luaExpr
+}
+
+// BuildLuaScript prepares a Lua expression from shorthand notation
+func BuildLuaScript(luaExpr string) string {
+	buildLuaScriptLogger := processorLogger.WithPrefix("BuildLuaScript").WithField("inputLuaExpr", luaExpr)
+	buildLuaScriptLogger.Debug("Building full Lua script from expression")
+
+	// Perform $var substitutions from globalVariables
+	luaExpr = replaceVariables(luaExpr)
+
+	luaExpr = PrependLuaAssignment(luaExpr)
+
+	fullScript := fmt.Sprintf(`
+		function run()
+			%s
+		end
+		local res = run()
+		modified = res == nil or res
+	`, luaExpr)
+	buildLuaScriptLogger.Trace("Generated full Lua script: %q", utils.LimitString(fullScript, 200))
+
+	return fullScript
+}
+
+// BuildJSONLuaScript prepares a Lua expression for JSON mode
+func BuildJSONLuaScript(luaExpr string) string {
+	buildJsonLuaScriptLogger := processorLogger.WithPrefix("BuildJSONLuaScript").WithField("inputLuaExpr", luaExpr)
+	buildJsonLuaScriptLogger.Debug("Building full Lua script for JSON mode from expression")
+
+	// Perform $var substitutions from globalVariables
+	luaExpr = replaceVariables(luaExpr)
+
+	fullScript := fmt.Sprintf(`
+		function run()
+			%s
+		end
+		local res = run()
+		modified = res == nil or res
+	`, luaExpr)
+	buildJsonLuaScriptLogger.Trace("Generated full JSON Lua script: %q", utils.LimitString(fullScript, 200))
+
+	return fullScript
+}
+
+func replaceVariables(expr string) string {
+	// $varName -> literal value
+	varNameRe := regexp.MustCompile(`\$(\w+)`)
+	return varNameRe.ReplaceAllStringFunc(expr, func(m string) string {
+		name := varNameRe.FindStringSubmatch(m)[1]
+		if v, ok := globalVariables[name]; ok {
+			switch val := v.(type) {
+			case int, int64, float32, float64:
+				return fmt.Sprintf("%v", val)
+			case bool:
+				if val {
+					return "true"
+				} else {
+					return "false"
+				}
+			case string:
+				// Quote strings for Lua literal
+				return fmt.Sprintf("%q", val)
+			default:
+				return fmt.Sprintf("%q", fmt.Sprintf("%v", val))
+			}
+		}
+		return m
+	})
+}
+
+func printToGo(L *lua.LState) int {
+	printToGoLogger := processorLogger.WithPrefix("printToGo")
+	printToGoLogger.Debug("Lua print function called, redirecting to Go logger")
+	top := L.GetTop()
+
+	args := make([]interface{}, top)
+	for i := 1; i <= top; i++ {
+		args[i-1] = L.Get(i)
+	}
+
+	// Format the message with proper spacing between arguments
+	var parts []string
+	for _, arg := range args {
+		parts = append(parts, fmt.Sprintf("%v", arg))
+	}
+	message := strings.Join(parts, " ")
+	printToGoLogger.Trace("Lua print message: %q", message)
+
+	// Use the LUA log level with a script tag
+	logger.Lua("%s", message)
+	printToGoLogger.Debug("Message logged from Lua")
+	return 0
+}
+
+func fetch(L *lua.LState) int {
+	fetchLogger := processorLogger.WithPrefix("fetch")
+	fetchLogger.Debug("Lua fetch function called")
+	// Get URL from first argument
+	url := L.ToString(1)
+	if url == "" {
+		fetchLogger.Error("Fetch failed: URL is required")
+		L.Push(lua.LNil)
+		L.Push(lua.LString("URL is required"))
+		return 2
+	}
+	fetchLogger.Debug("Fetching URL: %q", url)
+
+	// Get options from second argument if provided
+	var method string = "GET"
+	var headers map[string]string = make(map[string]string)
+	var body string = ""
+
+	if L.GetTop() > 1 {
+		options := L.ToTable(2)
+		if options != nil {
+			fetchLogger.Debug("Processing fetch options")
+			// Get method
+			if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
+				method = methodVal.String()
+				fetchLogger.Trace("Method from options: %q", method)
+			}
+
+			// Get headers
+			if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
+				if headersTable, ok := headersVal.(*lua.LTable); ok {
+					fetchLogger.Trace("Processing headers table")
+					headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
+						headers[key.String()] = value.String()
+						fetchLogger.Trace("Header: %q = %q", key.String(), value.String())
+					})
+				}
+				fetchLogger.Trace("All headers: %v", headers)
+			}
+
+			// Get body
+			if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
+				body = bodyVal.String()
+				fetchLogger.Trace("Body from options: %q", utils.LimitString(body, 100))
+			}
+		}
+	}
+	fetchLogger.Debug("Fetch request details: Method=%q, URL=%q, BodyLength=%d, Headers=%v", method, url, len(body), headers)
+
+	// Create HTTP request
+	req, err := http.NewRequest(method, url, strings.NewReader(body))
+	if err != nil {
+		fetchLogger.Error("Error creating HTTP request: %v", err)
+		L.Push(lua.LNil)
+		L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
+		return 2
+	}
+
+	// Set headers
+	for key, value := range headers {
+		req.Header.Set(key, value)
+	}
+	fetchLogger.Debug("HTTP request created and headers set")
+	fetchLogger.Trace("HTTP Request: %+v", req)
+
+	// Make request
+	client := &http.Client{}
+	resp, err := client.Do(req)
+	if err != nil {
+		fetchLogger.Error("Error making HTTP request: %v", err)
+		L.Push(lua.LNil)
+		L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
+		return 2
+	}
+	defer func() {
+		fetchLogger.Debug("Closing HTTP response body")
+		resp.Body.Close()
+	}()
+	fetchLogger.Debug("HTTP request executed. Status Code: %d", resp.StatusCode)
+
+	// Read response body
+	bodyBytes, err := io.ReadAll(resp.Body)
+	if err != nil {
+		fetchLogger.Error("Error reading response body: %v", err)
+		L.Push(lua.LNil)
+		L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
+		return 2
+	}
+	fetchLogger.Trace("Response body length: %d", len(bodyBytes))
+
+	// Create response table
+	responseTable := L.NewTable()
+	responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
+	responseTable.RawSetString("statusText", lua.LString(resp.Status))
+	responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
+	responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
+	fetchLogger.Debug("Created Lua response table")
+
+	// Set headers in response
+	headersTable := L.NewTable()
+	for key, values := range resp.Header {
+		headersTable.RawSetString(key, lua.LString(values[0]))
+		fetchLogger.Trace("Response header: %q = %q", key, values[0])
+	}
+	responseTable.RawSetString("headers", headersTable)
+	fetchLogger.Trace("Full response table: %v", responseTable)
+
+	L.Push(responseTable)
+	fetchLogger.Debug("Pushed response table to Lua stack")
+	return 1
+}
+
+func evalRegex(L *lua.LState) int {
+	evalRegexLogger := processorLogger.WithPrefix("evalRegex")
+	evalRegexLogger.Debug("Lua evalRegex function called")
+	pattern := L.ToString(1)
+	input := L.ToString(2)
+
+	re := regexp.MustCompile(pattern)
+	matches := re.FindStringSubmatch(input)
+
+	matchesTable := L.NewTable()
+	for i, match := range matches {
+		matchesTable.RawSetString(fmt.Sprintf("%d", i), lua.LString(match))
+	}
+
+	L.Push(matchesTable)
+	evalRegexLogger.Debug("Pushed matches table to Lua stack")
+
+	return 0
+}
+
+// GetLuaFunctionsHelp returns a comprehensive help string for all available Lua functions
+func GetLuaFunctionsHelp() string {
+	return `Lua Functions Available in Global Environment:
+
+MATH FUNCTIONS:
+  min(a, b)           - Returns the minimum of two numbers
+  max(a, b)           - Returns the maximum of two numbers
+  round(x, n)         - Rounds x to n decimal places (default 0)
+  floor(x)            - Returns the floor of x
+  ceil(x)             - Returns the ceiling of x
+
+STRING FUNCTIONS:
+  upper(s)            - Converts string to uppercase
+  lower(s)            - Converts string to lowercase
+  format(s, ...)      - Formats string using Lua string.format
+  trim(s)             - Removes leading/trailing whitespace
+  strsplit(inputstr, sep) - Splits string by separator (default: whitespace)
+  num(str)            - Converts string to number (returns 0 if invalid)
+  str(num)            - Converts number to string
+  is_number(str)      - Returns true if string is numeric
+
+TABLE FUNCTIONS:
+  DumpTable(table, depth) - Prints table structure recursively
+  isArray(t)          - Returns true if table is a sequential array
+
+HTTP FUNCTIONS:
+  fetch(url, options) - Makes HTTP request, returns response table
+    options: {method="GET", headers={}, body=""}
+    returns: {status, statusText, ok, body, headers}
+
+REGEX FUNCTIONS:
+  re(pattern, input)  - Applies regex pattern to input string
+    returns: table with matches (index 0 = full match, 1+ = groups)
+
+UTILITY FUNCTIONS:
+  print(...)          - Prints arguments to Go logger
+
+EXAMPLES:
+  round(3.14159, 2)   -> 3.14
+  strsplit("a,b,c", ",") -> {"a", "b", "c"}
+  upper("hello")      -> "HELLO"
+  min(5, 3)           -> 3
+  num("123")          -> 123
+  is_number("abc")    -> false
+  fetch("https://api.example.com/data")
+  re("(\\w+)@(\\w+)", "user@domain.com") -> {"user@domain.com", "user", "domain.com"}`
+}

processor/regex.go

@@ -0,0 +1,499 @@
+package processor
+
+import (
+	"cook/utils"
+	"fmt"
+	"regexp"
+	"strconv"
+	"strings"
+	"time"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+	lua "github.com/yuin/gopher-lua"
+)
+
+// regexLogger is a scoped logger for the processor/regex package.
+var regexLogger = logger.Default.WithPrefix("processor/regex")
+
+type CaptureGroup struct {
+	Name    string
+	Value   string
+	Updated string
+	Range   [2]int
+}
+
+// ProcessContent applies regex replacement with Lua processing
+// The filename here exists ONLY so we can pass it to the lua environment
+// It's not used for anything else
+func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
+	processRegexLogger := regexLogger.WithPrefix("ProcessRegex").WithField("commandName", command.Name).WithField("file", filename)
+	processRegexLogger.Debug("Starting regex processing for file")
+	processRegexLogger.Trace("Initial file content length: %d", len(content))
+	processRegexLogger.Trace("Command details: %+v", command)
+
+	var commands []utils.ReplaceCommand
+	// Start timing the regex processing
+	startTime := time.Now()
+
+	// We don't HAVE to do this multiple times for a pattern
+	// But it's quick enough for us to not care
+	pattern := resolveRegexPlaceholders(command.Regex)
+	processRegexLogger.Debug("Resolved regex placeholders. Pattern: %s", pattern)
+
+	// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
+	// But it's a compromise that allows us to use | in yaml
+	// Otherwise we would have to escape every god damn pair of quotation marks
+	// And a bunch of other shit
+	pattern = strings.TrimSpace(pattern)
+	processRegexLogger.Debug("Trimmed regex pattern: %s", pattern)
+
+	patternCompileStart := time.Now()
+	compiledPattern, err := regexp.Compile(pattern)
+	if err != nil {
+		processRegexLogger.Error("Error compiling pattern %q: %v", pattern, err)
+		return commands, fmt.Errorf("error compiling pattern: %v", err)
+	}
+	processRegexLogger.Debug("Compiled pattern successfully in %v", time.Since(patternCompileStart))
+
+	// Same here, it's just string concatenation, it won't kill us
+	// More important is that we don't fuck up the command
+	// But we shouldn't be able to since it's passed by value
+	previousLuaExpr := command.Lua
+	luaExpr := BuildLuaScript(command.Lua)
+	processRegexLogger.Debug("Transformed Lua expression: %q → %q", previousLuaExpr, luaExpr)
+	processRegexLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
+
+	// Process all regex matches
+	matchFindStart := time.Now()
+	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
+	matchFindDuration := time.Since(matchFindStart)
+
+	processRegexLogger.Debug("Found %d matches in content of length %d (search took %v)",
+		len(indices), len(content), matchFindDuration)
+	processRegexLogger.Trace("Match indices: %v", indices)
+
+	// Log pattern complexity metrics
+	patternComplexity := estimatePatternComplexity(pattern)
+	processRegexLogger.Debug("Pattern complexity estimate: %d", patternComplexity)
+
+	if len(indices) == 0 {
+		processRegexLogger.Warning("No matches found for regex: %q", pattern)
+		processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
+		return commands, nil
+	}
+
+	// We walk backwards because we're replacing something with something else that might be longer
+	// And in the case it is longer than the original all indicces past that change will be fucked up
+	// By going backwards we fuck up all the indices to the end of the file that we don't care about
+	// Because there either aren't any (last match) or they're already modified (subsequent matches)
+	for i, matchIndices := range indices {
+		matchLogger := processRegexLogger.WithField("matchNum", i+1)
+		matchLogger.Debug("Processing match %d of %d", i+1, len(indices))
+		matchLogger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
+
+		L, err := NewLuaState()
+		if err != nil {
+			matchLogger.Error("Error creating Lua state: %v", err)
+			return commands, fmt.Errorf("error creating Lua state: %v", err)
+		}
+		L.SetGlobal("file", lua.LString(filename))
+		// Hmm... Maybe we don't want to defer this..
+		// Maybe we want to close them every iteration
+		// We'll leave it as is for now
+		defer L.Close()
+		matchLogger.Trace("Lua state created successfully for match %d", i+1)
+
+		// Why we're doing this whole song and dance of indices is to properly handle empty matches
+		// Plus it's a little cleaner to surgically replace our matches
+		// If we were to use string.replace and encountered an empty match there'd be nothing to replace
+		// But using indices an empty match would have its starting and ending indices be the same
+		// So when we're cutting open the array we say 0:7 + modified + 7:end
+		// As if concatenating in the middle of the array
+		// Plus it supports lookarounds
+		matchContent := content[matchIndices[0]:matchIndices[1]]
+		matchPreview := utils.LimitString(matchContent, 50)
+		matchLogger.Trace("Matched content: %q (length: %d)", matchPreview, len(matchContent))
+
+		groups := matchIndices[2:]
+		if len(groups) <= 0 {
+			matchLogger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
+			continue
+		}
+		if len(groups)%2 == 1 {
+			matchLogger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
+			continue
+		}
+
+		// Count how many valid groups we have
+		validGroups := 0
+		for j := 0; j < len(groups); j += 2 {
+			if groups[j] != -1 && groups[j+1] != -1 {
+				validGroups++
+			}
+		}
+		matchLogger.Debug("Found %d valid capture groups in match", validGroups)
+
+		for _, index := range groups {
+			if index == -1 {
+				matchLogger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
+				continue
+			}
+		}
+
+		// We have to use array to preserve order
+		// Very important for the reconstruction step
+		// Because we must overwrite the values in reverse order
+		// See comments a few dozen lines above for more details
+		captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
+		groupNames := compiledPattern.SubexpNames()[1:]
+		for i, name := range groupNames {
+			start := groups[i*2]
+			end := groups[i*2+1]
+			if start == -1 || end == -1 {
+				matchLogger.Debug("Skipping empty or unmatched capture group #%d (name: %q)", i+1, name)
+				continue
+			}
+
+			value := content[start:end]
+			captureGroups = append(captureGroups, &CaptureGroup{
+				Name:  name,
+				Value: value,
+				Range: [2]int{start, end},
+			})
+
+			// Include name info in log if available
+			if name != "" {
+				matchLogger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
+			} else {
+				matchLogger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
+			}
+		}
+
+		// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
+		if !command.NoDedup {
+			matchLogger.Debug("Deduplicating capture groups as specified in command settings")
+			captureGroups = deduplicateGroups(captureGroups)
+			matchLogger.Trace("Capture groups after deduplication: %v", captureGroups)
+		} else {
+			matchLogger.Debug("Skipping deduplication of capture groups (NoDedup is true)")
+		}
+
+		if err := toLua(L, captureGroups); err != nil {
+			matchLogger.Error("Failed to set Lua variables for capture groups: %v", err)
+			continue
+		}
+		matchLogger.Debug("Set %d capture groups as Lua variables", len(captureGroups))
+		matchLogger.Trace("Lua globals set for capture groups")
+
+		if err := L.DoString(luaExpr); err != nil {
+			matchLogger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
+				err, utils.LimitString(luaExpr, 200), captureGroups)
+			continue
+		}
+		matchLogger.Debug("Lua script executed successfully")
+
+		// Get modifications from Lua
+		updatedCaptureGroups, err := fromLua(L, captureGroups)
+		if err != nil {
+			matchLogger.Error("Failed to retrieve modifications from Lua: %v", err)
+			continue
+		}
+		matchLogger.Debug("Retrieved updated values from Lua")
+		matchLogger.Trace("Updated capture groups from Lua: %v", updatedCaptureGroups)
+
+		replacement := ""
+		replacementVar := L.GetGlobal("replacement")
+		if replacementVar.Type() != lua.LTNil {
+			replacement = replacementVar.String()
+			matchLogger.Debug("Using global replacement variable from Lua: %q", replacement)
+		}
+
+		// Check if modification flag is set
+		modifiedVal := L.GetGlobal("modified")
+		if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
+			matchLogger.Debug("Skipping match - no modifications indicated by Lua script")
+			continue
+		}
+
+		if replacement == "" {
+			// Apply the modifications to the original match
+			replacement = matchContent
+
+			// Count groups that were actually modified
+			modifiedGroupsCount := 0
+			for _, capture := range updatedCaptureGroups {
+				if capture.Value != capture.Updated {
+					modifiedGroupsCount++
+				}
+			}
+			matchLogger.Info("%d of %d capture groups identified for modification", modifiedGroupsCount, len(updatedCaptureGroups))
+
+			for _, capture := range updatedCaptureGroups {
+				if capture.Value == capture.Updated {
+					matchLogger.Debug("Capture group unchanged: %s", utils.LimitString(capture.Value, 50))
+					continue
+				}
+
+				// Log what changed with context
+				matchLogger.Debug("Capture group %q scheduled for modification: %q → %q",
+					capture.Name, utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
+
+				// Indices of the group are relative to content
+				// To relate them to match we have to subtract the match start index
+				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
+				commands = append(commands, utils.ReplaceCommand{
+					From: capture.Range[0],
+					To:   capture.Range[1],
+					With: capture.Updated,
+				})
+				matchLogger.Trace("Added replacement command: %+v", commands[len(commands)-1])
+			}
+		} else {
+			matchLogger.Debug("Using full replacement string from Lua: %q", utils.LimitString(replacement, 50))
+			commands = append(commands, utils.ReplaceCommand{
+				From: matchIndices[0],
+				To:   matchIndices[1],
+				With: replacement,
+			})
+			matchLogger.Trace("Added full replacement command: %+v", commands[len(commands)-1])
+		}
+	}
+
+	processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
+	processRegexLogger.Debug("Generated %d total modifications", len(commands))
+	return commands, nil
+}
+
+func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
+	deduplicateGroupsLogger := regexLogger.WithPrefix("deduplicateGroups")
+	deduplicateGroupsLogger.Debug("Starting deduplication of capture groups")
+	deduplicateGroupsLogger.Trace("Input capture groups: %v", captureGroups)
+
+	// Preserve input order and drop any group that overlaps with an already accepted group
+	accepted := make([]*CaptureGroup, 0, len(captureGroups))
+	for _, group := range captureGroups {
+		groupLogger := deduplicateGroupsLogger.WithField("groupName", group.Name).WithField("groupRange", group.Range)
+		groupLogger.Debug("Processing capture group")
+
+		overlaps := false
+		for _, kept := range accepted {
+			// Overlap if start < keptEnd and end > keptStart (adjacent is allowed)
+			if group.Range[0] < kept.Range[1] && group.Range[1] > kept.Range[0] {
+				overlaps = true
+				break
+			}
+		}
+
+		if overlaps {
+			groupLogger.Warning("Overlapping capture group detected and skipped.")
+			continue
+		}
+
+		groupLogger.Debug("Capture group does not overlap with previously accepted groups. Adding.")
+		accepted = append(accepted, group)
+	}
+
+	deduplicateGroupsLogger.Debug("Finished deduplication. Original %d groups, %d deduplicated.", len(captureGroups), len(accepted))
+	deduplicateGroupsLogger.Trace("Deduplicated groups: %v", accepted)
+
+	return accepted
+}
+
+// The order of these replaces is important
+// This one handles !num-s inside of named capture groups
+// If it were not here our !num in a named capture group would
+// Expand to another capture group in the capture group
+// We really only want one (our named) capture group
+func resolveRegexPlaceholders(pattern string) string {
+	resolveLogger := regexLogger.WithPrefix("resolveRegexPlaceholders").WithField("originalPattern", utils.LimitString(pattern, 100))
+	resolveLogger.Debug("Resolving regex placeholders in pattern")
+
+	// Handle special pattern modifications
+	if !strings.HasPrefix(pattern, "(?s)") {
+		pattern = "(?s)" + pattern
+		resolveLogger.Debug("Prepended '(?s)' to pattern for single-line mode")
+	}
+
+	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
+	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
+		funcLogger := resolveLogger.WithPrefix("namedGroupNumReplace").WithField("match", utils.LimitString(match, 50))
+		funcLogger.Debug("Processing named group !num placeholder")
+		parts := namedGroupNum.FindStringSubmatch(match)
+		if len(parts) != 3 {
+			funcLogger.Warning("Unexpected number of submatches for namedGroupNum: %d. Returning original match.", len(parts))
+			return match
+		}
+		replacement := `-?\d*\.?\d+`
+		funcLogger.Trace("Replacing !num in named group with: %q", replacement)
+		return parts[1] + replacement
+	})
+	resolveLogger.Debug("Handled named group !num placeholders")
+
+	pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
+	resolveLogger.Debug("Replaced !num with numeric capture group")
+
+	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
+	resolveLogger.Debug("Replaced !any with non-greedy wildcard")
+
+	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
+	// !rep(pattern, count) repeats the pattern n times
+	// Inserting !any between each repetition
+	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
+		funcLogger := resolveLogger.WithPrefix("repPatternReplace").WithField("match", utils.LimitString(match, 50))
+		funcLogger.Debug("Processing !rep placeholder")
+		parts := repPattern.FindStringSubmatch(match)
+		if len(parts) != 3 {
+			funcLogger.Warning("Unexpected number of submatches for repPattern: %d. Returning original match.", len(parts))
+			return match
+		}
+		repeatedPattern := parts[1]
+		countStr := parts[2]
+		repetitions, err := strconv.Atoi(countStr)
+		if err != nil {
+			funcLogger.Error("Failed to parse repetition count %q: %v. Returning original match.", countStr, err)
+			return match
+		}
+
+		var finalReplacement string
+		if repetitions > 0 {
+			finalReplacement = strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
+		} else {
+			finalReplacement = ""
+		}
+
+		funcLogger.Trace("Replaced !rep with %d repetitions of %q: %q", repetitions, utils.LimitString(repeatedPattern, 30), utils.LimitString(finalReplacement, 100))
+		return finalReplacement
+	})
+	resolveLogger.Debug("Handled !rep placeholders")
+
+	resolveLogger.Debug("Finished resolving regex placeholders")
+	resolveLogger.Trace("Final resolved pattern: %q", utils.LimitString(pattern, 100))
+	return pattern
+}
+
+// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
+func toLua(L *lua.LState, data interface{}) error {
+	toLuaLogger := regexLogger.WithPrefix("toLua")
+	toLuaLogger.Debug("Setting capture groups as Lua variables")
+
+	captureGroups, ok := data.([]*CaptureGroup)
+	if !ok {
+		toLuaLogger.Error("Invalid data type for toLua. Expected []*CaptureGroup, got %T", data)
+		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
+	}
+	toLuaLogger.Trace("Input capture groups: %v", captureGroups)
+
+	groupindex := 0
+	for _, capture := range captureGroups {
+		groupLogger := toLuaLogger.WithField("captureGroup", capture.Name).WithField("value", utils.LimitString(capture.Value, 50))
+		groupLogger.Debug("Processing capture group for Lua")
+
+		if capture.Name == "" {
+			// We don't want to change the name of the capture group
+			// Even if it's empty
+			tempName := fmt.Sprintf("%d", groupindex+1)
+			groupindex++
+			groupLogger.Debug("Unnamed capture group, assigning temporary name: %q", tempName)
+
+			L.SetGlobal("s"+tempName, lua.LString(capture.Value))
+			groupLogger.Trace("Set Lua global s%s = %q", tempName, capture.Value)
+
+			val, err := strconv.ParseFloat(capture.Value, 64)
+			if err == nil {
+				L.SetGlobal("v"+tempName, lua.LNumber(val))
+				groupLogger.Trace("Set Lua global v%s = %f", tempName, val)
+			} else {
+				groupLogger.Trace("Value %q is not numeric, skipping v%s assignment", capture.Value, tempName)
+			}
+		} else {
+			val, err := strconv.ParseFloat(capture.Value, 64)
+			if err == nil {
+				L.SetGlobal(capture.Name, lua.LNumber(val))
+				groupLogger.Trace("Set Lua global %s = %f (numeric)", capture.Name, val)
+			} else {
+				L.SetGlobal(capture.Name, lua.LString(capture.Value))
+				groupLogger.Trace("Set Lua global %s = %q (string)", capture.Name, capture.Value)
+			}
+		}
+	}
+
+	toLuaLogger.Debug("Finished setting capture groups as Lua variables")
+	return nil
+}
+
+// FromLua implements the Processor interface for RegexProcessor
+func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
+	fromLuaLogger := regexLogger.WithPrefix("fromLua")
+	fromLuaLogger.Debug("Retrieving modifications from Lua for capture groups")
+	fromLuaLogger.Trace("Initial capture groups: %v", captureGroups)
+
+	captureIndex := 0
+	for _, capture := range captureGroups {
+		groupLogger := fromLuaLogger.WithField("originalCaptureName", capture.Name).WithField("originalValue", utils.LimitString(capture.Value, 50))
+		groupLogger.Debug("Processing capture group to retrieve updated value")
+
+		if capture.Name == "" {
+			// This case means it was an unnamed capture group originally.
+			// We need to reconstruct the original temporary name to fetch its updated value.
+			// The name will be set to an integer if it was empty, then incremented.
+			// So, we use the captureIndex to get the correct 'vX' and 'sX' variables.
+			tempName := fmt.Sprintf("%d", captureIndex+1)
+			groupLogger.Debug("Retrieving updated value for unnamed group (temp name: %q)", tempName)
+
+			vVarName := fmt.Sprintf("v%s", tempName)
+			sVarName := fmt.Sprintf("s%s", tempName)
+			captureIndex++
+
+			vLuaVal := L.GetGlobal(vVarName)
+			sLuaVal := L.GetGlobal(sVarName)
+
+			groupLogger.Trace("Lua values for unnamed group: v=%v, s=%v", vLuaVal, sLuaVal)
+
+			if sLuaVal.Type() == lua.LTString {
+				capture.Updated = sLuaVal.String()
+				groupLogger.Trace("Updated value from s%s (string): %q", tempName, capture.Updated)
+			}
+			// Numbers have priority
+			if vLuaVal.Type() == lua.LTNumber {
+				capture.Updated = vLuaVal.String()
+				groupLogger.Trace("Updated value from v%s (numeric): %q", tempName, capture.Updated)
+			}
+		} else {
+			// Easy shit, directly use the named capture group
+			updatedValue := L.GetGlobal(capture.Name)
+			if updatedValue.Type() != lua.LTNil {
+				capture.Updated = updatedValue.String()
+				groupLogger.Trace("Updated value for named group %q: %q", capture.Name, capture.Updated)
+			} else {
+				groupLogger.Debug("Named capture group %q not found in Lua globals or is nil. Keeping original value.", capture.Name)
+				capture.Updated = capture.Value // Keep original if not found or nil
+			}
+		}
+		groupLogger.Debug("Finished processing capture group. Original: %q, Updated: %q", utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
+	}
+
+	fromLuaLogger.Debug("Finished retrieving modifications from Lua")
+	fromLuaLogger.Trace("Final updated capture groups: %v", captureGroups)
+	return captureGroups, nil
+}
+
+// estimatePatternComplexity gives a rough estimate of regex pattern complexity
+// This can help identify potentially problematic patterns
+func estimatePatternComplexity(pattern string) int {
+	estimateComplexityLogger := regexLogger.WithPrefix("estimatePatternComplexity").WithField("pattern", utils.LimitString(pattern, 100))
+	estimateComplexityLogger.Debug("Estimating regex pattern complexity")
+	complexity := len(pattern)
+
+	// Add complexity for potentially expensive operations
+	complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
+	complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
+	complexity += strings.Count(pattern, "[^") * 3  // Negated character class
+	complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
+	complexity += strings.Count(pattern, "(") * 2   // Capture groups
+	complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
+	complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
+	complexity += strings.Count(pattern, "{") * 2   // Counted repetition
+
+	estimateComplexityLogger.Debug("Estimated pattern complexity: %d", complexity)
+	return complexity
+}

processor/surgical_json_test.go

@@ -0,0 +1,599 @@
+package processor
+
+import (
+	"cook/utils"
+	"testing"
+)
+
+func TestSurgicalJSONEditing(t *testing.T) {
+	tests := []struct {
+		name     string
+		content  string
+		luaCode  string
+		expected string
+	}{
+		{
+			name: "Modify single field",
+			content: `{
+  "name": "test",
+  "value": 42,
+  "description": "original"
+}`,
+			luaCode: `
+data.value = 84
+modified = true
+`,
+			expected: `{
+  "name": "test",
+  "value": 84,
+  "description": "original"
+}`,
+		},
+		{
+			name: "Add new field",
+			content: `{
+  "name": "test",
+  "value": 42
+}`,
+			luaCode: `
+data.newField = "added"
+modified = true
+`,
+			expected: `{
+  "name": "test",
+  "value": 42
+,"newField":"added"}`, // sjson.Set() adds new fields in compact format
+		},
+		{
+			name: "Modify nested field",
+			content: `{
+  "config": {
+    "settings": {
+      "enabled": false,
+      "timeout": 30
+    }
+  }
+}`,
+			luaCode: `
+data.config.settings.enabled = true
+data.config.settings.timeout = 60
+modified = true
+`,
+			expected: `{
+  "config": {
+    "settings": {
+      "enabled": true,
+      "timeout": 60
+    }
+  }
+}`,
+		},
+	}
+
+	for _, tt := range tests {
+		t.Run(tt.name, func(t *testing.T) {
+			command := utils.ModifyCommand{
+				Name: "test",
+				Lua:  tt.luaCode,
+			}
+
+			commands, err := ProcessJSON(tt.content, command, "test.json")
+			if err != nil {
+				t.Fatalf("ProcessJSON failed: %v", err)
+			}
+
+			if len(commands) == 0 {
+				t.Fatal("Expected at least one command")
+			}
+
+			// Apply the commands
+			result := tt.content
+			for _, cmd := range commands {
+				result = result[:cmd.From] + cmd.With + result[cmd.To:]
+			}
+
+			// Check the actual result matches expected
+			if result != tt.expected {
+				t.Errorf("Expected:\n%s\n\nGot:\n%s", tt.expected, result)
+			}
+		})
+	}
+}
+
+func TestSurgicalJSONPreservesFormatting(t *testing.T) {
+	// Test that surgical editing preserves the original formatting structure
+	content := `{
+  "Defaults": {
+    "Behaviour": "None",
+    "Description": "",
+    "DisplayName": "",
+    "FlavorText": "",
+    "Icon": "None",
+    "MaxStack": 1,
+    "Override_Glow_Icon": "None",
+    "Weight": 0,
+    "bAllowZeroWeight": false
+  },
+  "RowStruct": "/Script/Icarus.ItemableData",
+  "Rows": [
+    {
+      "Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
+      "DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
+      "FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
+      "Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
+      "MaxStack": 1000000,
+      "Name": "Item_Fiber",
+      "Weight": 10
+    }
+  ]
+}`
+
+	expected := `{
+  "Defaults": {
+    "Behaviour": "None",
+    "Description": "",
+    "DisplayName": "",
+    "FlavorText": "",
+    "Icon": "None",
+    "MaxStack": 1,
+    "Override_Glow_Icon": "None",
+    "Weight": 0,
+    "bAllowZeroWeight": false
+  },
+  "RowStruct": "/Script/Icarus.ItemableData",
+  "Rows": [
+    {
+      "Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
+      "DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
+      "FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
+      "Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
+      "MaxStack": 1000000,
+      "Name": "Item_Fiber",
+      "Weight": 500
+    }
+  ]
+}`
+
+	command := utils.ModifyCommand{
+		Name: "test",
+		Lua: `
+-- Modify the weight of the first item
+data.Rows[1].Weight = 500
+modified = true
+`,
+	}
+
+	commands, err := ProcessJSON(content, command, "test.json")
+	if err != nil {
+		t.Fatalf("ProcessJSON failed: %v", err)
+	}
+
+	if len(commands) == 0 {
+		t.Fatal("Expected at least one command")
+	}
+
+	// Apply the commands
+	result := content
+	for _, cmd := range commands {
+		result = result[:cmd.From] + cmd.With + result[cmd.To:]
+	}
+
+	// Check that the result matches expected (preserves formatting and changes weight)
+	if result != expected {
+		t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
+	}
+}
+
+func TestSurgicalJSONPreservesFormatting2(t *testing.T) {
+	// Test that surgical editing preserves the original formatting structure
+	content := `
+{
+  "RowStruct": "/Script/Icarus.ProcessorRecipe",
+  "Defaults": {
+    "bForceDisableRecipe": false,
+    "Requirement": {
+      "RowName": "None",
+      "DataTableName": "D_Talents"
+    },
+    "SessionRequirement": {
+      "RowName": "None",
+      "DataTableName": "D_CharacterFlags"
+    },
+    "CharacterRequirement": {
+      "RowName": "None",
+      "DataTableName": "D_CharacterFlags"
+    },
+    "RequiredMillijoules": 2500,
+    "RecipeSets": [],
+    "ResourceCostMultipliers": [],
+    "Inputs": [
+      {
+        "Element": {
+          "RowName": "None",
+          "DataTableName": "D_ItemsStatic"
+        },
+        "Count": 1,
+        "DynamicProperties": []
+      }
+    ],
+    "Container": {
+      "Value": "None"
+    },
+    "ResourceInputs": [],
+    "bSelectOutputItemRandomly": false,
+    "bContainsContainer": false,
+    "ItemIconOverride": {
+      "ItemStaticData": {
+        "RowName": "None",
+        "DataTableName": "D_ItemsStatic"
+      },
+      "ItemDynamicData": [],
+      "ItemCustomStats": [],
+      "CustomProperties": {
+        "StaticWorldStats": [],
+        "StaticWorldHeldStats": [],
+        "Stats": [],
+        "Alterations": [],
+        "LivingItemSlots": []
+      },
+      "DatabaseGUID": "",
+      "ItemOwnerLookupId": -1,
+      "RuntimeTags": {
+        "GameplayTags": []
+      }
+    },
+    "Outputs": [
+      {
+        "Element": {
+          "RowName": "None",
+          "DataTableName": "D_ItemTemplate"
+        },
+        "Count": 1,
+        "DynamicProperties": []
+      }
+    ],
+    "ResourceOutputs": [],
+    "Refundable": "Inherit",
+    "ExperienceMultiplier": 1,
+    "Audio": {
+      "RowName": "None",
+      "DataTableName": "D_CraftingAudioData"
+    }
+  },
+  "Rows": [
+    {
+      "Name": "Biofuel1",
+      "RecipeSets": [
+        {
+          "RowName": "Composter",
+          "DataTableName": "D_RecipeSets"
+        }
+      ],
+      "Inputs": [
+        {
+          "Element": {
+            "RowName": "Raw_Meat",
+            "DataTableName": "D_ItemsStatic"
+          },
+          "Count": 2,
+          "DynamicProperties": []
+        },
+        {
+          "Element": {
+            "RowName": "Tree_Sap",
+            "DataTableName": "D_ItemsStatic"
+          },
+          "Count": 1,
+          "DynamicProperties": []
+        }
+      ],
+      "Outputs": [],
+      "Audio": {
+        "RowName": "Composter"
+      },
+      "ResourceOutputs": [
+        {
+          "Type": {
+            "Value": "Biofuel"
+          },
+          "RequiredUnits": 100
+        }
+      ]
+    }
+  ]
+}
+  `
+
+	expected := `
+{
+  "RowStruct": "/Script/Icarus.ProcessorRecipe",
+  "Defaults": {
+    "bForceDisableRecipe": false,
+    "Requirement": {
+      "RowName": "None",
+      "DataTableName": "D_Talents"
+    },
+    "SessionRequirement": {
+      "RowName": "None",
+      "DataTableName": "D_CharacterFlags"
+    },
+    "CharacterRequirement": {
+      "RowName": "None",
+      "DataTableName": "D_CharacterFlags"
+    },
+    "RequiredMillijoules": 2500,
+    "RecipeSets": [],
+    "ResourceCostMultipliers": [],
+    "Inputs": [
+      {
+        "Element": {
+          "RowName": "None",
+          "DataTableName": "D_ItemsStatic"
+        },
+        "Count": 1,
+        "DynamicProperties": []
+      }
+    ],
+    "Container": {
+      "Value": "None"
+    },
+    "ResourceInputs": [],
+    "bSelectOutputItemRandomly": false,
+    "bContainsContainer": false,
+    "ItemIconOverride": {
+      "ItemStaticData": {
+        "RowName": "None",
+        "DataTableName": "D_ItemsStatic"
+      },
+      "ItemDynamicData": [],
+      "ItemCustomStats": [],
+      "CustomProperties": {
+        "StaticWorldStats": [],
+        "StaticWorldHeldStats": [],
+        "Stats": [],
+        "Alterations": [],
+        "LivingItemSlots": []
+      },
+      "DatabaseGUID": "",
+      "ItemOwnerLookupId": -1,
+      "RuntimeTags": {
+        "GameplayTags": []
+      }
+    },
+    "Outputs": [
+      {
+        "Element": {
+          "RowName": "None",
+          "DataTableName": "D_ItemTemplate"
+        },
+        "Count": 1,
+        "DynamicProperties": []
+      }
+    ],
+    "ResourceOutputs": [],
+    "Refundable": "Inherit",
+    "ExperienceMultiplier": 1,
+    "Audio": {
+      "RowName": "None",
+      "DataTableName": "D_CraftingAudioData"
+    }
+  },
+  "Rows": [
+    {
+      "Name": "Biofuel1",
+      "RecipeSets": [
+        {
+          "RowName": "Composter",
+          "DataTableName": "D_RecipeSets"
+        }
+      ],
+      "Inputs": [
+        {
+          "Element": {
+            "RowName": "Raw_Meat",
+            "DataTableName": "D_ItemsStatic"
+          },
+          "Count": 2,
+          "DynamicProperties": []
+        }
+      ],
+      "Outputs": [],
+      "Audio": {
+        "RowName": "Composter"
+      },
+      "ResourceOutputs": [
+        {
+          "Type": {
+            "Value": "Biofuel"
+          },
+          "RequiredUnits": 100
+        }
+      ]
+    }
+  ]
+}
+  `
+
+	command := utils.ModifyCommand{
+		Name: "test",
+		Lua: `
+    -- Define regex patterns for matching recipe names
+    local function matchesPattern(name, pattern)
+      local matches = re(pattern, name)
+      -- Check if matches table has any content (index 0 or 1 should exist if there's a match)
+      return matches and (matches[0] or matches[1])
+    end
+
+    -- Selection pattern for recipes that get multiplied
+    local selectionPattern = "(?-s)(Bulk_)?(Pistol|Rifle).*?Round.*?|(Carbon|Composite)_Paste.*|(Gold|Copper)_Wire|(Ironw|Copper)_Nail|(Platinum|Steel|Cold_Steel|Titanium)_Ingot|.*?Shotgun_Shell.*?|.*_Arrow|.*_Bolt|.*_Fertilizer_?\\d*|.*_Grenade|.*_Pill|.*_Tonic|Aluminum|Ammo_Casing|Animal_Fat|Carbon_Fiber|Composites|Concrete_Mix|Cured_Leather_?\\d?|Electronics|Epoxy_?\\d?|Glass\\d?|Gunpowder\\w*|Health_.*|Titanium_Plate|Organic_Resin|Platinum_Sheath|Refined_[a-zA-Z]+|Rope|Shotgun_Casing|Steel_Bloom\\d?|Tree_Sap\\w*"
+
+    -- Ingot pattern for recipes that get count set to 1
+    local ingotPattern = "(?-s)(Platinum|Steel|Cold_Steel|Titanium)_Ingot|Aluminum|Refined_[a-zA-Z]+|Glass\\d?"
+
+    local factor = 16
+    local bonus = 0.5
+
+    for _, row in ipairs(data.Rows) do
+      local recipeName = row.Name
+
+      -- Special case: Biofuel recipes - remove Tree_Sap input
+      if string.find(recipeName, "Biofuel") then
+        if row.Inputs then
+          for i = #row.Inputs, 1, -1 do
+            local input = row.Inputs[i]
+            if input.Element and input.Element.RowName and string.find(input.Element.RowName, "Tree_Sap") then
+              table.remove(row.Inputs, i)
+              print("Removing input 'Tree_Sap' from processor recipe '" .. recipeName .. "'")
+            end
+          end
+        end
+      end
+
+      -- Ingot recipes: set input and output counts to 1
+      if matchesPattern(recipeName, ingotPattern) then
+        if row.Inputs then
+          for _, input in ipairs(row.Inputs) do
+            input.Count = 1
+          end
+        end
+        if row.Outputs then
+          for _, output in ipairs(row.Outputs) do
+            output.Count = 1
+          end
+        end
+      end
+
+      -- Selected recipes: multiply inputs by factor, outputs by factor * (1 + bonus)
+      if matchesPattern(recipeName, selectionPattern) then
+        if row.Inputs then
+          for _, input in ipairs(row.Inputs) do
+            local oldCount = input.Count
+            input.Count = input.Count * factor
+            print("Recipe " .. recipeName .. " Input.Count: " .. oldCount .. " -> " .. input.Count)
+          end
+        end
+
+        if row.Outputs then
+          for _, output in ipairs(row.Outputs) do
+            local oldCount = output.Count
+            output.Count = math.floor(output.Count * factor * (1 + bonus))
+            print("Recipe " .. recipeName .. " Output.Count: " .. oldCount .. " -> " .. output.Count)
+          end
+        end
+      end
+    end
+`,
+	}
+
+	commands, err := ProcessJSON(content, command, "test.json")
+	if err != nil {
+		t.Fatalf("ProcessJSON failed: %v", err)
+	}
+
+	if len(commands) == 0 {
+		t.Fatal("Expected at least one command")
+	}
+
+	// Apply the commands
+	result := content
+	for _, cmd := range commands {
+		result = result[:cmd.From] + cmd.With + result[cmd.To:]
+	}
+
+	// Check that the result matches expected (preserves formatting and changes weight)
+	if result != expected {
+		t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
+	}
+}
+
+func TestRetardedJSONEditing(t *testing.T) {
+	original := `{
+  "RowStruct": "/Script/Icarus.ItemableData",
+  "Defaults": {
+    "Behaviour": "None",
+    "DisplayName": "",
+    "Icon": "None",
+    "Override_Glow_Icon": "None",
+    "Description": "",
+    "FlavorText": "",
+    "Weight": 0,
+    "bAllowZeroWeight": false,
+    "MaxStack": 1
+  },
+  "Rows": [
+		{
+      "DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
+      "Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
+      "Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
+      "FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
+      "Weight": 10,
+      "MaxStack": 200,
+      "Name": "Item_Fiber"
+    }
+	]
+}`
+
+	expected := `{
+  "RowStruct": "/Script/Icarus.ItemableData",
+  "Defaults": {
+    "Behaviour": "None",
+    "DisplayName": "",
+    "Icon": "None",
+    "Override_Glow_Icon": "None",
+    "Description": "",
+    "FlavorText": "",
+    "Weight": 0,
+    "bAllowZeroWeight": false,
+    "MaxStack": 1
+  },
+  "Rows": [
+		{
+      "DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
+      "Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
+      "Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
+      "FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
+      "Weight": 10,
+      "MaxStack": 1000000,
+      "Name": "Item_Fiber"
+    }
+	]
+}`
+
+	command := utils.ModifyCommand{
+		Name: "test",
+		Lua: `
+    for _, row in ipairs(data.Rows) do
+      if row.MaxStack then
+        if string.find(row.Name, "Carrot") or string.find(row.Name, "Potato") then
+          row.MaxStack = 25
+        else
+          row.MaxStack = row.MaxStack * 10000
+          if row.MaxStack > 1000000 then
+            row.MaxStack = 1000000
+          end
+        end
+      end
+    end
+`,
+	}
+
+	commands, err := ProcessJSON(original, command, "test.json")
+	if err != nil {
+		t.Fatalf("ProcessJSON failed: %v", err)
+	}
+
+	if len(commands) == 0 {
+		t.Fatal("Expected at least one command")
+	}
+
+	// Apply the commands
+	result := original
+	for _, cmd := range commands {
+		result = result[:cmd.From] + cmd.With + result[cmd.To:]
+	}
+
+	// Check that the weight was changed
+	if result != expected {
+		t.Errorf("Expected:\n%s\nGot:\n%s", expected, result)
+	}
+}

processor/test_helper.go

@@ -0,0 +1,27 @@
+package processor
+
+import (
+	"io"
+	"os"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+)
+
+func init() {
+	// Only modify logger in test mode
+	// This checks if we're running under 'go test'
+	if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
+		// Initialize logger with ERROR level for tests
+		// to minimize noise in test output
+		logger.Init(logger.LevelError)
+
+		// Optionally redirect logger output to discard
+		// This prevents logger output from interfering with test output
+		disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
+		if disableTestLogs {
+			// Create a new logger that writes to nowhere
+			silentLogger := logger.New(io.Discard, "", 0)
+			logger.Default = silentLogger
+		}
+	}
+}

regression/regression_test.go

@@ -0,0 +1,137 @@
+package regression
+
+import (
+	"cook/processor"
+	"cook/utils"
+	"os"
+	"path/filepath"
+	"testing"
+)
+
+func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
+	command := utils.ModifyCommand{
+		Regex:    regex,
+		Lua:      lua,
+		LogLevel: "TRACE",
+	}
+
+	commands, err := processor.ProcessRegex(content, command, "test")
+	if err != nil {
+		return "", 0, 0, err
+	}
+
+	result, modifications := utils.ExecuteModifications(commands, content)
+	return result, modifications, len(commands), nil
+}
+
+func TestTalentsMechanicOutOfRange(t *testing.T) {
+	given := `<Talent identifier="quickfixer">
+    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
+    <Description tag="talentdescription.quickfixer">
+      <Replace tag="[amount]" value="20" color="gui.green"/>
+      <Replace tag="[duration]" value="10" color="gui.green"/>
+    </Description>
+    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
+    <AbilityGroupEffect abilityeffecttype="None">
+      <Abilities>
+        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
+      </Abilities>
+    </AbilityGroupEffect>
+    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
+      <Conditions>
+        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
+      </Conditions>
+      <Abilities>
+        <CharacterAbilityApplyStatusEffects>
+          <StatusEffects>
+            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
+              <Affliction identifier="quickfixer" amount="10.0"/>
+            </StatusEffect>
+          </StatusEffects>
+        </CharacterAbilityApplyStatusEffects>
+      </Abilities>
+    </AbilityGroupEffect>
+  </Talent>`
+
+	actual := `<Talent identifier="quickfixer">
+    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
+    <Description tag="talentdescription.quickfixer">
+      <Replace tag="[amount]" value="30" color="gui.green"/>
+      <Replace tag="[duration]" value="20" color="gui.green"/>
+    </Description>
+    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
+    <AbilityGroupEffect abilityeffecttype="None">
+      <Abilities>
+        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
+      </Abilities>
+    </AbilityGroupEffect>
+    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
+      <Conditions>
+        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
+      </Conditions>
+      <Abilities>
+        <CharacterAbilityApplyStatusEffects>
+          <StatusEffects>
+            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
+              <Affliction identifier="quickfixer" amount="20"/>
+            </StatusEffect>
+          </StatusEffects>
+        </CharacterAbilityApplyStatusEffects>
+      </Abilities>
+    </AbilityGroupEffect>
+  </Talent>`
+
+	result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
+
+	if err != nil {
+		t.Fatalf("Error processing content: %v", err)
+	}
+
+	if matches != 4 {
+		t.Errorf("Expected 4 matches, got %d", matches)
+	}
+
+	if mods != 4 {
+		t.Errorf("Expected 4 modifications, got %d", mods)
+	}
+
+	if result != actual {
+		t.Errorf("expected %s, got %s", actual, result)
+	}
+}
+
+func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
+	cwd, err := os.Getwd()
+	if err != nil {
+		t.Fatalf("Error getting current working directory: %v", err)
+	}
+
+	given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
+	if err != nil {
+		t.Fatalf("Error reading file: %v", err)
+	}
+
+	expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
+	if err != nil {
+		t.Fatalf("Error reading file: %v", err)
+	}
+
+	result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
+
+	if err != nil {
+		t.Fatalf("Error processing content: %v", err)
+	}
+
+	// We don't really care how many god damn matches there are as long as the result is correct
+	// if matches != 45 {
+	// 	t.Errorf("Expected 45 match, got %d", matches)
+	// }
+	//
+	// if mods != 45 {
+	// 	t.Errorf("Expected 45 modification, got %d", mods)
+	// }
+
+	if string(result) != string(expected) {
+		t.Errorf("expected %s, got %s", expected, result)
+	}
+}

release.sh

@@ -0,0 +1,49 @@
+#!/bin/bash
+
+echo "Figuring out the tag..."
+TAG=$(git describe --tags --exact-match 2>/dev/null || echo "")
+if [ -z "$TAG" ]; then
+  # Get the latest tag
+  LATEST_TAG=$(git describe --tags $(git rev-list --tags --max-count=1))
+  # Increment the patch version
+  IFS='.' read -r -a VERSION_PARTS <<< "$LATEST_TAG"
+  VERSION_PARTS[2]=$((VERSION_PARTS[2]+1))
+  TAG="${VERSION_PARTS[0]}.${VERSION_PARTS[1]}.${VERSION_PARTS[2]}"
+  # Create a new tag
+  git tag $TAG
+  git push origin $TAG
+fi
+echo "Tag: $TAG"
+
+echo "Building the thing..."
+go build -o chef.exe .
+go install .
+
+echo "Creating a release..."
+TOKEN="$GITEA_API_KEY"
+GITEA="https://git.site.quack-lab.dev"
+REPO="dave/BigChef"
+# Create a release
+RELEASE_RESPONSE=$(curl -s -X POST \
+  -H "Authorization: token $TOKEN" \
+  -H "Accept: application/json" \
+  -H "Content-Type: application/json" \
+  -d '{
+    "tag_name": "'"$TAG"'",
+    "name": "'"$TAG"'",
+    "draft": false,
+    "prerelease": false
+  }' \
+  $GITEA/api/v1/repos/$REPO/releases)
+
+# Extract the release ID
+echo $RELEASE_RESPONSE
+RELEASE_ID=$(echo $RELEASE_RESPONSE | awk -F'"id":' '{print $2+0; exit}')
+echo "Release ID: $RELEASE_ID"
+
+echo "Uploading the things..."
+curl -X POST \
+  -H "Authorization: token $TOKEN" \
+  -F "attachment=@chef.exe" \
+  "$GITEA/api/v1/repos/$REPO/releases/${RELEASE_ID}/assets?name=chef.exe"
+rm chef.exe

test.xml

@@ -1 +0,0 @@
-<config><item><value>100</value></item></config>

test_complex.xml

@@ -1,12 +0,0 @@
-<config>
-  <item>
-    <value>75</value>
-    <multiplier>2</multiplier>
-    <divider>4</divider>
-  </item>
-  <item>
-    <value>150</value>
-    <multiplier>3</multiplier>
-    <divider>2</divider>
-  </item>
-</config>

test_data.xml

@@ -1,37 +0,0 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<testdata>
-    <!-- Numeric values -->
-    <item>
-        <id>1</id>
-        <value>200</value>
-        <price>24.99</price>
-        <quantity>5</quantity>
-    </item>
-    
-    <!-- Text values -->
-    <item>
-        <id>2</id>
-        <name>Test Product</name>
-        <description>This is a test product description</description>
-        <category>Test</category>
-    </item>
-    
-    <!-- Mixed content -->
-    <item>
-        <id>3</id>
-        <name>Mixed Product</name>
-        <price>19.99</price>
-        <code>PRD-123</code>
-        <tags>sale,discount,new</tags>
-    </item>
-    
-    <!-- Empty and special values -->
-    <item>
-        <id>4</id>
-        <value></value>
-        <specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
-        <multiline>Line 1
-Line 2
-Line 3</multiline>
-    </item>
-</testdata> 

test_surgical.yml

@@ -0,0 +1,11 @@
+- name: SurgicalWeightTest
+  json: true
+  lua: |
+    -- This demonstrates surgical JSON editing
+    -- Only the Weight field of Item_Fiber will be modified
+    data.Rows[1].Weight = 999
+    modified = true
+  files:
+    - 'D_Itemable.json'
+  reset: false
+  loglevel: INFO 

testfiles/foo/bar/test.xml

@@ -1 +0,0 @@
-<config><item><value>100</value></item></config>

utils/db.go

@@ -0,0 +1,157 @@
+package utils
+
+import (
+	"path/filepath"
+	"time"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+	"gorm.io/driver/sqlite"
+	"gorm.io/gorm"
+	gormlogger "gorm.io/gorm/logger"
+)
+
+// dbLogger is a scoped logger for the utils/db package.
+var dbLogger = logger.Default.WithPrefix("utils/db")
+
+type DB interface {
+	DB() *gorm.DB
+	Raw(sql string, args ...any) *gorm.DB
+	SaveFile(filePath string, fileData []byte) error
+	GetFile(filePath string) ([]byte, error)
+	GetAllFiles() ([]FileSnapshot, error)
+	RemoveAllFiles() error
+}
+
+type FileSnapshot struct {
+	Date     time.Time `gorm:"primaryKey"`
+	FilePath string    `gorm:"primaryKey"`
+	FileData []byte    `gorm:"type:blob"`
+}
+
+type DBWrapper struct {
+	db *gorm.DB
+}
+
+var globalDB *DBWrapper
+
+func GetDB() (DB, error) {
+	getDBLogger := dbLogger.WithPrefix("GetDB")
+	getDBLogger.Debug("Attempting to get database connection")
+	var err error
+
+	dbFile := filepath.Join("data.sqlite")
+	getDBLogger.Debug("Opening database file: %q", dbFile)
+	db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
+		// SkipDefaultTransaction: true,
+		PrepareStmt: true,
+		Logger:      gormlogger.Default.LogMode(gormlogger.Silent),
+	})
+	if err != nil {
+		getDBLogger.Error("Failed to open database: %v", err)
+		return nil, err
+	}
+	getDBLogger.Debug("Database opened successfully, running auto migration")
+	if err := db.AutoMigrate(&FileSnapshot{}); err != nil {
+		getDBLogger.Error("Auto migration failed: %v", err)
+		return nil, err
+	}
+	getDBLogger.Debug("Auto migration completed")
+
+	globalDB = &DBWrapper{db: db}
+	getDBLogger.Debug("Database wrapper initialized")
+	return globalDB, nil
+}
+
+// Just a wrapper
+func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
+	rawLogger := dbLogger.WithPrefix("Raw").WithField("sql", sql)
+	rawLogger.Debug("Executing raw SQL query with args: %v", args)
+	return db.db.Raw(sql, args...)
+}
+
+func (db *DBWrapper) DB() *gorm.DB {
+	dbLogger.WithPrefix("DB").Debug("Returning GORM DB instance")
+	return db.db
+}
+
+func (db *DBWrapper) FileExists(filePath string) (bool, error) {
+	fileExistsLogger := dbLogger.WithPrefix("FileExists").WithField("filePath", filePath)
+	fileExistsLogger.Debug("Checking if file exists in database")
+	var count int64
+	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
+	if err != nil {
+		fileExistsLogger.Error("Error checking if file exists: %v", err)
+		return false, err
+	}
+	fileExistsLogger.Debug("File exists: %t", count > 0)
+	return count > 0, err
+}
+
+func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
+	saveFileLogger := dbLogger.WithPrefix("SaveFile").WithField("filePath", filePath)
+	saveFileLogger.Debug("Attempting to save file to database")
+	saveFileLogger.Trace("File data length: %d", len(fileData))
+
+	exists, err := db.FileExists(filePath)
+	if err != nil {
+		saveFileLogger.Error("Error checking if file exists: %v", err)
+		return err
+	}
+	if exists {
+		saveFileLogger.Debug("File already exists, skipping save")
+		return nil
+	}
+	saveFileLogger.Debug("Creating new file snapshot in database")
+	err = db.db.Create(&FileSnapshot{
+		Date:     time.Now(),
+		FilePath: filePath,
+		FileData: fileData,
+	}).Error
+	if err != nil {
+		saveFileLogger.Error("Failed to create file snapshot: %v", err)
+	} else {
+		saveFileLogger.Debug("File saved successfully to database")
+	}
+	return err
+}
+
+func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
+	getFileLogger := dbLogger.WithPrefix("GetFile").WithField("filePath", filePath)
+	getFileLogger.Debug("Getting file from database")
+	var fileSnapshot FileSnapshot
+	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
+	if err != nil {
+		// Downgrade not-found to warning to avoid noisy errors during first run
+		getFileLogger.Warning("Failed to get file from database: %v", err)
+		return nil, err
+	}
+	getFileLogger.Debug("File found in database")
+	getFileLogger.Trace("Retrieved file data length: %d", len(fileSnapshot.FileData))
+	return fileSnapshot.FileData, nil
+}
+
+func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
+	getAllFilesLogger := dbLogger.WithPrefix("GetAllFiles")
+	getAllFilesLogger.Debug("Getting all files from database")
+	var fileSnapshots []FileSnapshot
+	err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
+	if err != nil {
+		getAllFilesLogger.Error("Failed to get all files from database: %v", err)
+		return nil, err
+	}
+	getAllFilesLogger.Debug("Found %d files in database", len(fileSnapshots))
+	getAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
+	return fileSnapshots, nil
+}
+
+func (db *DBWrapper) RemoveAllFiles() error {
+	removeAllFilesLogger := dbLogger.WithPrefix("RemoveAllFiles")
+	removeAllFilesLogger.Debug("Removing all files from database")
+	err := db.db.Exec("DELETE FROM file_snapshots").Error
+	if err != nil {
+		removeAllFilesLogger.Error("Failed to remove all files from database: %v", err)
+	} else {
+		removeAllFilesLogger.Debug("All files removed from database")
+	}
+	return err
+}

utils/file.go

@@ -0,0 +1,152 @@
+package utils
+
+import (
+	"os"
+	"path/filepath"
+	"strconv"
+	"strings"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+)
+
+// fileLogger is a scoped logger for the utils/file package.
+var fileLogger = logger.Default.WithPrefix("utils/file")
+
+func CleanPath(path string) string {
+	cleanPathLogger := fileLogger.WithPrefix("CleanPath")
+	cleanPathLogger.Debug("Cleaning path: %q", path)
+	cleanPathLogger.Trace("Original path: %q", path)
+	path = filepath.Clean(path)
+	path = strings.ReplaceAll(path, "\\", "/")
+	cleanPathLogger.Trace("Cleaned path result: %q", path)
+	return path
+}
+
+func ToAbs(path string) string {
+	toAbsLogger := fileLogger.WithPrefix("ToAbs")
+	toAbsLogger.Debug("Converting path to absolute: %q", path)
+	toAbsLogger.Trace("Input path: %q", path)
+	if filepath.IsAbs(path) {
+		toAbsLogger.Debug("Path is already absolute, cleaning it.")
+		cleanedPath := CleanPath(path)
+		toAbsLogger.Trace("Already absolute path after cleaning: %q", cleanedPath)
+		return cleanedPath
+	}
+	cwd, err := os.Getwd()
+	if err != nil {
+		toAbsLogger.Error("Error getting current working directory: %v", err)
+		return CleanPath(path)
+	}
+	toAbsLogger.Trace("Current working directory: %q", cwd)
+	cleanedPath := CleanPath(filepath.Join(cwd, path))
+	toAbsLogger.Trace("Converted absolute path result: %q", cleanedPath)
+	return cleanedPath
+}
+
+// LimitString truncates a string to maxLen and adds "..." if truncated
+func LimitString(s string, maxLen int) string {
+	limitStringLogger := fileLogger.WithPrefix("LimitString").WithField("originalLength", len(s)).WithField("maxLength", maxLen)
+	limitStringLogger.Debug("Limiting string length")
+	s = strings.ReplaceAll(s, "\n", "\\n")
+	if len(s) <= maxLen {
+		limitStringLogger.Trace("String length (%d) is within max length (%d), no truncation", len(s), maxLen)
+		return s
+	}
+	limited := s[:maxLen-3] + "..."
+	limitStringLogger.Trace("String truncated from %d to %d characters: %q", len(s), len(limited), limited)
+	return limited
+}
+
+// StrToFloat converts a string to a float64, returning 0 on error.
+func StrToFloat(s string) float64 {
+	strToFloatLogger := fileLogger.WithPrefix("StrToFloat").WithField("inputString", s)
+	strToFloatLogger.Debug("Attempting to convert string to float")
+	f, err := strconv.ParseFloat(s, 64)
+	if err != nil {
+		strToFloatLogger.Warning("Failed to convert string %q to float, returning 0: %v", s, err)
+		return 0
+	}
+	strToFloatLogger.Trace("Successfully converted %q to float: %f", s, f)
+	return f
+}
+
+func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
+	resetWhereNecessaryLogger := fileLogger.WithPrefix("ResetWhereNecessary")
+	resetWhereNecessaryLogger.Debug("Starting reset where necessary operation")
+	resetWhereNecessaryLogger.Trace("File-command associations input: %v", associations)
+	dirtyFiles := make(map[string]struct{})
+	for _, association := range associations {
+		resetWhereNecessaryLogger.Debug("Processing association for file: %q", association.File)
+		for _, command := range association.Commands {
+			resetWhereNecessaryLogger.Debug("Checking command %q for reset requirement", command.Name)
+			resetWhereNecessaryLogger.Trace("Command details: %v", command)
+			if command.Reset {
+				resetWhereNecessaryLogger.Debug("Command %q requires reset for file %q, marking as dirty", command.Name, association.File)
+				dirtyFiles[association.File] = struct{}{}
+			}
+		}
+		for _, command := range association.IsolateCommands {
+			resetWhereNecessaryLogger.Debug("Checking isolate command %q for reset requirement", command.Name)
+			resetWhereNecessaryLogger.Trace("Isolate command details: %v", command)
+			if command.Reset {
+				resetWhereNecessaryLogger.Debug("Isolate command %q requires reset for file %q, marking as dirty", command.Name, association.File)
+				dirtyFiles[association.File] = struct{}{}
+			}
+		}
+	}
+	resetWhereNecessaryLogger.Debug("Identified %d files that need to be reset", len(dirtyFiles))
+	resetWhereNecessaryLogger.Trace("Dirty files identified: %v", dirtyFiles)
+
+	for file := range dirtyFiles {
+		resetWhereNecessaryLogger.Debug("Resetting file %q", file)
+		fileData, err := db.GetFile(file)
+		if err != nil {
+			resetWhereNecessaryLogger.Warning("Failed to get original content for file %q from database: %v", file, err)
+			// Seed the snapshot from current disk content if missing, then use it as fallback
+			currentData, readErr := os.ReadFile(file)
+			if readErr != nil {
+				resetWhereNecessaryLogger.Warning("Additionally failed to read current file content for %q: %v", file, readErr)
+				continue
+			}
+			// Best-effort attempt to save baseline; ignore errors to avoid blocking reset
+			if saveErr := db.SaveFile(file, currentData); saveErr != nil {
+				resetWhereNecessaryLogger.Warning("Failed to seed baseline snapshot for %q: %v", file, saveErr)
+			}
+			fileData = currentData
+		}
+		resetWhereNecessaryLogger.Trace("Retrieved original file data length for %q: %d", file, len(fileData))
+		resetWhereNecessaryLogger.Debug("Writing original content back to file %q", file)
+		err = os.WriteFile(file, fileData, 0644)
+		if err != nil {
+			resetWhereNecessaryLogger.Warning("Failed to write original content back to file %q: %v", file, err)
+			continue
+		}
+		resetWhereNecessaryLogger.Debug("Successfully reset file %q", file)
+	}
+	resetWhereNecessaryLogger.Debug("Finished reset where necessary operation")
+	return nil
+}
+
+func ResetAllFiles(db DB) error {
+	resetAllFilesLogger := fileLogger.WithPrefix("ResetAllFiles")
+	resetAllFilesLogger.Debug("Starting reset all files operation")
+	fileSnapshots, err := db.GetAllFiles()
+	if err != nil {
+		resetAllFilesLogger.Error("Failed to get all file snapshots from database: %v", err)
+		return err
+	}
+	resetAllFilesLogger.Debug("Found %d files in database to reset", len(fileSnapshots))
+	resetAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
+
+	for _, fileSnapshot := range fileSnapshots {
+		resetAllFilesLogger.Debug("Resetting file %q", fileSnapshot.FilePath)
+		err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
+		if err != nil {
+			resetAllFilesLogger.Warning("Failed to write file %q to disk: %v", fileSnapshot.FilePath, err)
+			continue
+		}
+		resetAllFilesLogger.Debug("File %q written to disk successfully", fileSnapshot.FilePath)
+	}
+	resetAllFilesLogger.Debug("Finished reset all files operation")
+	return nil
+}

utils/flags.go

@@ -0,0 +1,21 @@
+package utils
+
+import (
+	"flag"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+)
+
+// flagsLogger is a scoped logger for the utils/flags package.
+var flagsLogger = logger.Default.WithPrefix("utils/flags")
+
+var (
+	ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
+	Filter        = flag.String("f", "", "Filter commands before running them")
+	JSON          = flag.Bool("json", false, "Enable JSON mode for processing JSON files")
+)
+
+func init() {
+	flagsLogger.Debug("Initializing flags")
+	flagsLogger.Trace("ParallelFiles initial value: %d, Filter initial value: %q, JSON initial value: %t", *ParallelFiles, *Filter, *JSON)
+}

utils/modifycommand.go

@@ -0,0 +1,375 @@
+package utils
+
+import (
+	"fmt"
+	"os"
+	"path/filepath"
+	"strings"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+	"github.com/bmatcuk/doublestar/v4"
+	"gopkg.in/yaml.v3"
+)
+
+// modifyCommandLogger is a scoped logger for the utils/modifycommand package.
+var modifyCommandLogger = logger.Default.WithPrefix("utils/modifycommand")
+
+type ModifyCommand struct {
+	Name      string                 `yaml:"name,omitempty"`
+	Regex     string                 `yaml:"regex,omitempty"`
+	Regexes   []string               `yaml:"regexes,omitempty"`
+	Lua       string                 `yaml:"lua,omitempty"`
+	Files     []string               `yaml:"files,omitempty"`
+	Reset     bool                   `yaml:"reset,omitempty"`
+	LogLevel  string                 `yaml:"loglevel,omitempty"`
+	Isolate   bool                   `yaml:"isolate,omitempty"`
+	NoDedup   bool                   `yaml:"nodedup,omitempty"`
+	Disabled  bool                   `yaml:"disable,omitempty"`
+	JSON      bool                   `yaml:"json,omitempty"`
+	Modifiers map[string]interface{} `yaml:"modifiers,omitempty"`
+}
+
+type CookFile []ModifyCommand
+
+func (c *ModifyCommand) Validate() error {
+	validateLogger := modifyCommandLogger.WithPrefix("Validate").WithField("commandName", c.Name)
+	validateLogger.Debug("Validating command")
+
+	// For JSON mode, regex patterns are not required
+	if !c.JSON {
+		if c.Regex == "" && len(c.Regexes) == 0 {
+			validateLogger.Error("Validation failed: Regex pattern is required for non-JSON mode")
+			return fmt.Errorf("pattern is required for non-JSON mode")
+		}
+	}
+
+	if c.Lua == "" {
+		validateLogger.Error("Validation failed: Lua expression is required")
+		return fmt.Errorf("lua expression is required")
+	}
+	if len(c.Files) == 0 {
+		validateLogger.Error("Validation failed: At least one file is required")
+		return fmt.Errorf("at least one file is required")
+	}
+	if c.LogLevel == "" {
+		validateLogger.Debug("LogLevel not specified, defaulting to INFO")
+		c.LogLevel = "INFO"
+	}
+	validateLogger.Debug("Command validated successfully")
+	return nil
+}
+
+// Ehh.. Not much better... Guess this wasn't the big deal
+var matchesMemoTable map[string]bool = make(map[string]bool)
+
+func Matches(path string, glob string) (bool, error) {
+	matchesLogger := modifyCommandLogger.WithPrefix("Matches").WithField("path", path).WithField("glob", glob)
+	matchesLogger.Debug("Checking if path matches glob")
+	key := fmt.Sprintf("%s:%s", path, glob)
+	if matches, ok := matchesMemoTable[key]; ok {
+		matchesLogger.Debug("Found match in memo table: %t", matches)
+		return matches, nil
+	}
+	matches, err := doublestar.Match(glob, path)
+	if err != nil {
+		matchesLogger.Error("Failed to match glob: %v", err)
+		return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
+	}
+	matchesMemoTable[key] = matches
+	matchesLogger.Debug("Match result: %t, storing in memo table", matches)
+	return matches, nil
+}
+
+func SplitPattern(pattern string) (string, string) {
+	splitPatternLogger := modifyCommandLogger.WithPrefix("SplitPattern").WithField("pattern", pattern)
+	splitPatternLogger.Debug("Splitting pattern")
+	splitPatternLogger.Trace("Original pattern: %q", pattern)
+	static, pattern := doublestar.SplitPattern(pattern)
+
+	cwd, err := os.Getwd()
+	if err != nil {
+		splitPatternLogger.Error("Error getting current working directory: %v", err)
+		return "", ""
+	}
+	splitPatternLogger.Trace("Current working directory: %q", cwd)
+	if static == "" {
+		splitPatternLogger.Debug("Static part is empty, defaulting to current working directory")
+		static = cwd
+	}
+	if !filepath.IsAbs(static) {
+		splitPatternLogger.Debug("Static part is not absolute, joining with current working directory")
+		static = filepath.Join(cwd, static)
+		static = filepath.Clean(static)
+		splitPatternLogger.Trace("Static path after joining and cleaning: %q", static)
+	}
+	static = strings.ReplaceAll(static, "\\", "/")
+	splitPatternLogger.Trace("Final static path: %q, Remaining pattern: %q", static, pattern)
+	return static, pattern
+}
+
+type FileCommandAssociation struct {
+	File            string
+	IsolateCommands []ModifyCommand
+	Commands        []ModifyCommand
+}
+
+func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
+	associateFilesLogger := modifyCommandLogger.WithPrefix("AssociateFilesWithCommands")
+	associateFilesLogger.Debug("Associating files with commands")
+	associateFilesLogger.Trace("Input files: %v", files)
+	associateFilesLogger.Trace("Input commands: %v", commands)
+	associationCount := 0
+	fileCommands := make(map[string]FileCommandAssociation)
+
+	for _, file := range files {
+		file = strings.ReplaceAll(file, "\\", "/")
+		associateFilesLogger.Debug("Processing file: %q", file)
+		fileCommands[file] = FileCommandAssociation{
+			File:            file,
+			IsolateCommands: []ModifyCommand{},
+			Commands:        []ModifyCommand{},
+		}
+		for _, command := range commands {
+			associateFilesLogger.Debug("Checking command %q for file %q", command.Name, file)
+			for _, glob := range command.Files {
+				glob = strings.ReplaceAll(glob, "\\", "/")
+				static, pattern := SplitPattern(glob)
+				associateFilesLogger.Trace("Glob parts for %q → static=%q pattern=%q", glob, static, pattern)
+
+				// Build absolute path for the current file to compare with static
+				cwd, err := os.Getwd()
+				if err != nil {
+					associateFilesLogger.Warning("Failed to get CWD when matching %q for file %q: %v", glob, file, err)
+					continue
+				}
+				var absFile string
+				if filepath.IsAbs(file) {
+					absFile = filepath.Clean(file)
+				} else {
+					absFile = filepath.Clean(filepath.Join(cwd, file))
+				}
+				absFile = strings.ReplaceAll(absFile, "\\", "/")
+				associateFilesLogger.Trace("Absolute file path resolved for matching: %q", absFile)
+
+				// Only match if the file is under the static root
+				if !(strings.HasPrefix(absFile, static+"/") || absFile == static) {
+					associateFilesLogger.Trace("Skipping glob %q for file %q because file is outside static root %q", glob, file, static)
+					continue
+				}
+
+				patternFile := strings.TrimPrefix(absFile, static+`/`)
+				associateFilesLogger.Trace("Pattern-relative path used for match: %q", patternFile)
+				matches, err := Matches(patternFile, pattern)
+				if err != nil {
+					associateFilesLogger.Warning("Failed to match glob %q with file %q: %v", glob, file, err)
+					continue
+				}
+				if matches {
+					associateFilesLogger.Debug("File %q matches glob %q. Associating with command %q", file, glob, command.Name)
+					association := fileCommands[file]
+
+					if command.Isolate {
+						associateFilesLogger.Debug("Command %q is an isolate command, adding to isolate list", command.Name)
+						association.IsolateCommands = append(association.IsolateCommands, command)
+					} else {
+						associateFilesLogger.Debug("Command %q is a regular command, adding to regular list", command.Name)
+						association.Commands = append(association.Commands, command)
+					}
+					fileCommands[file] = association
+					associationCount++
+				} else {
+					associateFilesLogger.Trace("File %q did not match glob %q (pattern=%q, rel=%q)", file, glob, pattern, patternFile)
+				}
+			}
+		}
+		currentFileCommands := fileCommands[file]
+		associateFilesLogger.Debug("Finished processing file %q. Found %d regular commands and %d isolate commands", file, len(currentFileCommands.Commands), len(currentFileCommands.IsolateCommands))
+		associateFilesLogger.Trace("Commands for file %q: %v", file, currentFileCommands.Commands)
+		associateFilesLogger.Trace("Isolate commands for file %q: %v", file, currentFileCommands.IsolateCommands)
+	}
+	associateFilesLogger.Info("Completed association. Found %d total associations for %d files and %d commands", associationCount, len(files), len(commands))
+	return fileCommands, nil
+}
+
+func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
+	aggregateGlobsLogger := modifyCommandLogger.WithPrefix("AggregateGlobs")
+	aggregateGlobsLogger.Debug("Aggregating glob patterns from commands")
+	aggregateGlobsLogger.Trace("Input commands for aggregation: %v", commands)
+	globs := make(map[string]struct{})
+	for _, command := range commands {
+		aggregateGlobsLogger.Debug("Processing command %q for glob patterns", command.Name)
+		for _, glob := range command.Files {
+			resolvedGlob := strings.Replace(glob, "~", os.Getenv("HOME"), 1)
+			resolvedGlob = strings.ReplaceAll(resolvedGlob, "\\", "/")
+			aggregateGlobsLogger.Trace("Adding glob: %q (resolved to %q)", glob, resolvedGlob)
+			globs[resolvedGlob] = struct{}{}
+		}
+	}
+	aggregateGlobsLogger.Debug("Finished aggregating globs. Found %d unique glob patterns", len(globs))
+	aggregateGlobsLogger.Trace("Aggregated unique globs: %v", globs)
+	return globs
+}
+
+func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
+	expandGlobsLogger := modifyCommandLogger.WithPrefix("ExpandGLobs")
+	expandGlobsLogger.Debug("Expanding glob patterns to actual files")
+	expandGlobsLogger.Trace("Input patterns for expansion: %v", patterns)
+	var files []string
+	filesMap := make(map[string]bool)
+
+	cwd, err := os.Getwd()
+	if err != nil {
+		expandGlobsLogger.Error("Failed to get current working directory: %v", err)
+		return nil, fmt.Errorf("failed to get current working directory: %w", err)
+	}
+	expandGlobsLogger.Debug("Current working directory: %q", cwd)
+
+	for pattern := range patterns {
+		expandGlobsLogger.Debug("Processing glob pattern: %q", pattern)
+		static, pattern := SplitPattern(pattern)
+		matches, err := doublestar.Glob(os.DirFS(static), pattern)
+		if err != nil {
+			expandGlobsLogger.Warning("Error expanding glob %q in %q: %v", pattern, static, err)
+			continue
+		}
+		expandGlobsLogger.Debug("Found %d matches for pattern %q", len(matches), pattern)
+		expandGlobsLogger.Trace("Raw matches for pattern %q: %v", pattern, matches)
+		for _, m := range matches {
+			m = filepath.Join(static, m)
+			info, err := os.Stat(m)
+			if err != nil {
+				expandGlobsLogger.Warning("Error getting file info for %q: %v", m, err)
+				continue
+			}
+			if !info.IsDir() && !filesMap[m] {
+				expandGlobsLogger.Trace("Adding unique file to list: %q", m)
+				filesMap[m], files = true, append(files, m)
+			}
+		}
+	}
+
+	if len(files) > 0 {
+		expandGlobsLogger.Debug("Finished expanding globs. Found %d unique files to process", len(files))
+		expandGlobsLogger.Trace("Unique files to process: %v", files)
+	} else {
+		expandGlobsLogger.Warning("No files found after expanding glob patterns.")
+	}
+	return files, nil
+}
+
+func LoadCommands(args []string) ([]ModifyCommand, error) {
+	loadCommandsLogger := modifyCommandLogger.WithPrefix("LoadCommands")
+	loadCommandsLogger.Debug("Loading commands from arguments (cook files or direct patterns)")
+	loadCommandsLogger.Trace("Input arguments: %v", args)
+	commands := []ModifyCommand{}
+
+	for _, arg := range args {
+		loadCommandsLogger.Debug("Processing argument for commands: %q", arg)
+		newCommands, err := LoadCommandsFromCookFiles(arg)
+		if err != nil {
+			loadCommandsLogger.Error("Failed to load commands from argument %q: %v", arg, err)
+			return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
+		}
+		loadCommandsLogger.Debug("Successfully loaded %d commands from %q", len(newCommands), arg)
+		for _, cmd := range newCommands {
+			if cmd.Disabled {
+				loadCommandsLogger.Debug("Skipping disabled command: %q", cmd.Name)
+				continue
+			}
+			commands = append(commands, cmd)
+			loadCommandsLogger.Trace("Added command %q. Current total commands: %d", cmd.Name, len(commands))
+		}
+	}
+
+	loadCommandsLogger.Info("Finished loading commands. Total %d commands loaded", len(commands))
+	return commands, nil
+}
+
+func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
+	loadCookFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFiles").WithField("pattern", pattern)
+	loadCookFilesLogger.Debug("Loading commands from cook files based on pattern")
+	loadCookFilesLogger.Trace("Input pattern: %q", pattern)
+	static, pattern := SplitPattern(pattern)
+	commands := []ModifyCommand{}
+	cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
+	if err != nil {
+		loadCookFilesLogger.Error("Failed to glob cook files for pattern %q: %v", pattern, err)
+		return nil, fmt.Errorf("failed to glob cook files: %w", err)
+	}
+	loadCookFilesLogger.Debug("Found %d cook files for pattern %q", len(cookFiles), pattern)
+	loadCookFilesLogger.Trace("Cook files found: %v", cookFiles)
+
+	for _, cookFile := range cookFiles {
+		cookFile = filepath.Join(static, cookFile)
+		cookFile = filepath.Clean(cookFile)
+		cookFile = strings.ReplaceAll(cookFile, "\\", "/")
+		loadCookFilesLogger.Debug("Loading commands from individual cook file: %q", cookFile)
+
+		cookFileData, err := os.ReadFile(cookFile)
+		if err != nil {
+			loadCookFilesLogger.Error("Failed to read cook file %q: %v", cookFile, err)
+			return nil, fmt.Errorf("failed to read cook file: %w", err)
+		}
+		loadCookFilesLogger.Trace("Read %d bytes from cook file %q", len(cookFileData), cookFile)
+		newCommands, err := LoadCommandsFromCookFile(cookFileData)
+		if err != nil {
+			loadCookFilesLogger.Error("Failed to load commands from cook file data for %q: %v", cookFile, err)
+			return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
+		}
+		commands = append(commands, newCommands...)
+		loadCookFilesLogger.Debug("Added %d commands from cook file %q. Total commands now: %d", len(newCommands), cookFile, len(commands))
+	}
+
+	loadCookFilesLogger.Debug("Finished loading commands from cook files. Total %d commands", len(commands))
+	return commands, nil
+}
+
+func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
+	loadCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFile")
+	loadCommandLogger.Debug("Unmarshaling commands from cook file data")
+	loadCommandLogger.Trace("Cook file data length: %d", len(cookFileData))
+	commands := []ModifyCommand{}
+	err := yaml.Unmarshal(cookFileData, &commands)
+	if err != nil {
+		loadCommandLogger.Error("Failed to unmarshal cook file data: %v", err)
+		return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
+	}
+	loadCommandLogger.Debug("Successfully unmarshaled %d commands", len(commands))
+	loadCommandLogger.Trace("Unmarshaled commands: %v", commands)
+	return commands, nil
+}
+
+// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
+func CountGlobsBeforeDedup(commands []ModifyCommand) int {
+	countGlobsLogger := modifyCommandLogger.WithPrefix("CountGlobsBeforeDedup")
+	countGlobsLogger.Debug("Counting glob patterns before deduplication")
+	count := 0
+	for _, cmd := range commands {
+		countGlobsLogger.Trace("Processing command %q, adding %d globs", cmd.Name, len(cmd.Files))
+		count += len(cmd.Files)
+	}
+	countGlobsLogger.Debug("Total glob patterns before deduplication: %d", count)
+	return count
+}
+
+func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
+	filterCommandsLogger := modifyCommandLogger.WithPrefix("FilterCommands").WithField("filter", filter)
+	filterCommandsLogger.Debug("Filtering commands")
+	filterCommandsLogger.Trace("Input commands: %v", commands)
+	filteredCommands := []ModifyCommand{}
+	filters := strings.Split(filter, ",")
+	filterCommandsLogger.Trace("Split filters: %v", filters)
+	for _, cmd := range commands {
+		filterCommandsLogger.Debug("Checking command %q against filters", cmd.Name)
+		for _, f := range filters {
+			if strings.Contains(cmd.Name, f) {
+				filterCommandsLogger.Debug("Command %q matches filter %q, adding to filtered list", cmd.Name, f)
+				filteredCommands = append(filteredCommands, cmd)
+				break // Command matches, no need to check other filters
+			}
+		}
+	}
+	filterCommandsLogger.Debug("Finished filtering commands. Found %d filtered commands", len(filteredCommands))
+	filterCommandsLogger.Trace("Filtered commands: %v", filteredCommands)
+	return filteredCommands
+}

utils/replacecommand.go

@@ -0,0 +1,79 @@
+package utils
+
+import (
+	"fmt"
+	"sort"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+)
+
+// replaceCommandLogger is a scoped logger for the utils/replacecommand package.
+var replaceCommandLogger = logger.Default.WithPrefix("utils/replacecommand")
+
+type ReplaceCommand struct {
+	From int
+	To   int
+	With string
+}
+
+func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
+	executeModificationsLogger := replaceCommandLogger.WithPrefix("ExecuteModifications")
+	executeModificationsLogger.Debug("Executing a batch of text modifications")
+	executeModificationsLogger.Trace("Number of modifications: %d, Original file data length: %d", len(modifications), len(fileData))
+	var err error
+
+	sort.Slice(modifications, func(i, j int) bool {
+		return modifications[i].From > modifications[j].From
+	})
+	executeModificationsLogger.Debug("Modifications sorted in reverse order for safe replacement")
+	executeModificationsLogger.Trace("Sorted modifications: %v", modifications)
+
+	executed := 0
+	for idx, modification := range modifications {
+		executeModificationsLogger.Debug("Applying modification %d/%d", idx+1, len(modifications))
+		executeModificationsLogger.Trace("Current modification details: From=%d, To=%d, With=%q", modification.From, modification.To, modification.With)
+		fileData, err = modification.Execute(fileData)
+		if err != nil {
+			executeModificationsLogger.Error("Failed to execute replacement for modification %+v: %v", modification, err)
+			continue
+		}
+		executed++
+		executeModificationsLogger.Trace("File data length after modification: %d", len(fileData))
+	}
+	executeModificationsLogger.Info("Successfully applied %d text replacements", executed)
+	return fileData, executed
+}
+
+func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
+	executeLogger := replaceCommandLogger.WithPrefix("Execute").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With))
+	executeLogger.Debug("Attempting to execute single replacement")
+	err := m.Validate(len(fileDataStr))
+	if err != nil {
+		executeLogger.Error("Failed to validate modification: %v", err)
+		return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
+	}
+
+	executeLogger.Trace("Applying replacement: fileDataStr[:%d] + %q + fileDataStr[%d:]", m.From, m.With, m.To)
+	result := fileDataStr[:m.From] + m.With + fileDataStr[m.To:]
+	executeLogger.Trace("Replacement executed. Result length: %d", len(result))
+	return result, nil
+}
+
+func (m *ReplaceCommand) Validate(maxsize int) error {
+	validateLogger := replaceCommandLogger.WithPrefix("Validate").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With)).WithField("maxSize", maxsize)
+	validateLogger.Debug("Validating replacement command against max size")
+	if m.To < m.From {
+		validateLogger.Error("Validation failed: 'To' (%d) is less than 'From' (%d)", m.To, m.From)
+		return fmt.Errorf("command to is less than from: %v", m)
+	}
+	if m.From > maxsize || m.To > maxsize {
+		validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is greater than max size (%d)", m.From, m.To, maxsize)
+		return fmt.Errorf("command from or to is greater than replacement length: %v", m)
+	}
+	if m.From < 0 || m.To < 0 {
+		validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is less than 0", m.From, m.To)
+		return fmt.Errorf("command from or to is less than 0: %v", m)
+	}
+	validateLogger.Debug("Modification command validated successfully")
+	return nil
+}

utils/replacecommand_test.go

@@ -0,0 +1,504 @@
+package utils
+
+import (
+	"testing"
+
+	"github.com/stretchr/testify/assert"
+)
+
+func TestReplaceCommandExecute(t *testing.T) {
+	tests := []struct {
+		name        string
+		input       string
+		command     ReplaceCommand
+		expected    string
+		shouldError bool
+	}{
+		{
+			name:        "Simple replacement",
+			input:       "This is a test string",
+			command:     ReplaceCommand{From: 5, To: 7, With: "was"},
+			expected:    "This was a test string",
+			shouldError: false,
+		},
+		{
+			name:        "Replace at beginning",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 0, To: 5, With: "Hi"},
+			expected:    "Hi world",
+			shouldError: false,
+		},
+		{
+			name:        "Replace at end",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 6, To: 11, With: "everyone"},
+			expected:    "Hello everyone",
+			shouldError: false,
+		},
+		{
+			name:        "Replace entire string",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
+			expected:    "Goodbye!",
+			shouldError: false,
+		},
+		{
+			name:        "Error: From > To",
+			input:       "Test string",
+			command:     ReplaceCommand{From: 7, To: 5, With: "fail"},
+			expected:    "Test string",
+			shouldError: true,
+		},
+		{
+			name:        "Error: From > string length",
+			input:       "Test",
+			command:     ReplaceCommand{From: 10, To: 12, With: "fail"},
+			expected:    "Test",
+			shouldError: true,
+		},
+		{
+			name:        "Error: To > string length",
+			input:       "Test",
+			command:     ReplaceCommand{From: 2, To: 10, With: "fail"},
+			expected:    "Test",
+			shouldError: true,
+		},
+	}
+
+	for _, tc := range tests {
+		t.Run(tc.name, func(t *testing.T) {
+			result, err := tc.command.Execute(tc.input)
+
+			if tc.shouldError {
+				if err == nil {
+					t.Errorf("Expected an error for command %+v but got none", tc.command)
+				}
+			} else {
+				if err != nil {
+					t.Errorf("Unexpected error: %v", err)
+				}
+				if result != tc.expected {
+					t.Errorf("Expected %q, got %q", tc.expected, result)
+				}
+			}
+		})
+	}
+}
+
+func TestExecuteModifications(t *testing.T) {
+	tests := []struct {
+		name          string
+		input         string
+		modifications []ReplaceCommand
+		expected      string
+		expectedCount int
+	}{
+		{
+			name:  "Single modification",
+			input: "Hello world",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 5, With: "Hi"},
+			},
+			expected:      "Hi world",
+			expectedCount: 1,
+		},
+		{
+			name:  "Multiple modifications",
+			input: "This is a test string",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 4, With: "That"},
+				{From: 8, To: 14, With: "sample"},
+			},
+			expected:      "That is sample string",
+			expectedCount: 2,
+		},
+		{
+			name:  "Overlapping modifications",
+			input: "ABCDEF",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 3, With: "123"}, // ABC -> 123
+				{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
+			},
+			// The actual behavior with the current implementation
+			expected:      "123yzF",
+			expectedCount: 2,
+		},
+		{
+			name:  "Sequential modifications",
+			input: "Hello world",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 5, With: "Hi"},
+				{From: 5, To: 6, With: ""}, // Remove the space
+				{From: 6, To: 11, With: "everyone"},
+			},
+			expected:      "Hieveryone",
+			expectedCount: 3,
+		},
+	}
+
+	for _, tc := range tests {
+		t.Run(tc.name, func(t *testing.T) {
+			// Make a copy of the modifications to avoid modifying the test case
+			mods := make([]ReplaceCommand, len(tc.modifications))
+			copy(mods, tc.modifications)
+
+			result, count := ExecuteModifications(mods, tc.input)
+
+			if count != tc.expectedCount {
+				t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
+			}
+
+			if result != tc.expected {
+				t.Errorf("Expected %q, got %q", tc.expected, result)
+			}
+		})
+	}
+}
+
+func TestReverseOrderExecution(t *testing.T) {
+	// This test verifies the current behavior of modification application
+	input := "Original text with multiple sections"
+
+	// Modifications in specific positions
+	modifications := []ReplaceCommand{
+		{From: 0, To: 8, With: "Modified"},  // Original -> Modified
+		{From: 9, To: 13, With: "document"}, // text -> document
+		{From: 14, To: 22, With: "without"}, // with -> without
+		{From: 23, To: 31, With: "any"},     // multiple -> any
+	}
+
+	// The actual current behavior of our implementation
+	expected := "Modified document withouttanytions"
+
+	result, count := ExecuteModifications(modifications, input)
+
+	if count != 4 {
+		t.Errorf("Expected 4 modifications, got %d", count)
+	}
+
+	if result != expected {
+		t.Errorf("Expected %q, got %q", expected, result)
+	}
+}
+
+// Replace text in the middle of a string with new content
+func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello replaced, how are you?", result)
+}
+
+// Replace with empty string (deletion)
+func TestReplaceCommandExecute_DeletesText(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello , how are you?", result)
+}
+
+// Replace with longer string than original segment
+func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "longerreplacement",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello longerreplacement, how are you?", result)
+}
+
+// From and To values are the same (zero-length replacement)
+func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 5,
+		To:   5,
+		With: "inserted",
+	}
+
+	fileContent := "Hello world"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Helloinserted world", result)
+}
+
+// From value is greater than To value
+func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 10,
+		To:   5,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world, how are you?", result)
+}
+
+// From or To values exceed string length
+func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 5,
+		To:   50, // Exceeds the length of the fileContent
+		With: "replaced",
+	}
+
+	fileContent := "Hello world"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world", result)
+}
+
+// From or To values are negative
+func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: -1,
+		To:   10,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world, how are you?", result)
+}
+
+// Modifications are applied in reverse order (from highest to lowest 'From' value)
+func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 4, With: "That"},
+		{From: 10, To: 14, With: "sample"},
+		{From: 26, To: 38, With: "modifications"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "That is a sample string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// One or more modifications fail but others succeed
+func TestExecuteModificationsWithPartialFailures(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	// Create a custom ReplaceCommand implementation that will fail
+	failingCommand := ReplaceCommand{
+		From: 15,
+		To:   10, // Invalid range (To < From) to cause failure
+		With: "will fail",
+	}
+
+	// Valid commands
+	validCommand1 := ReplaceCommand{
+		From: 0,
+		To:   4,
+		With: "That",
+	}
+
+	validCommand2 := ReplaceCommand{
+		From: 26,
+		To:   38,
+		With: "modifications",
+	}
+
+	modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "That is a test string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	// Only 2 out of 3 modifications should succeed
+	if executed != 2 {
+		t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
+	}
+}
+
+// All valid modifications are executed and the modified string is returned
+func TestExecuteModificationsAllValid(t *testing.T) {
+	// Setup test data
+	fileData := "Hello world, this is a test"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 5, With: "Hi"},
+		{From: 18, To: 20, With: "was"},
+		{From: 21, To: 27, With: "an example"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "Hi world, this was an example"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// The count of successfully executed modifications is returned
+func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
+	// Setup test data
+	fileData := "Initial text for testing"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 7, With: "Final"},
+		{From: 12, To: 16, With: "example"},
+		{From: 17, To: 24, With: "process"},
+	}
+
+	// Execute the function
+	_, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify the count of executed modifications
+	expectedExecuted := 3
+	if executed != expectedExecuted {
+		t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
+	}
+}
+
+// Empty modifications list returns the original string with zero executed count
+func TestExecuteModificationsWithEmptyList(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	if result != fileData {
+		t.Errorf("Expected result to be %q, but got %q", fileData, result)
+	}
+
+	if executed != 0 {
+		t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
+	}
+}
+
+// Modifications with identical 'From' values
+func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{
+		{From: 10, To: 14, With: "sample"},
+		{From: 10, To: 14, With: "example"},
+		{From: 26, To: 38, With: "modifications"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	// Yes, it's mangled, yes, it's intentional
+	// Every subsequent command works with the modified contents of the previous command
+	// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
+	// So we prepend "example" and end up with "examplele"
+	// Whether sample or example goes first here is irrelevant to us
+	// But it just so happens that sample goes first, so we end up with "examplele"
+	expectedResult := "This is a examplele string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// Modifications that would affect each other if not sorted properly
+func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
+	// Setup test data
+	fileData := "The quick brown fox jumps over the lazy dog"
+
+	modifications := []ReplaceCommand{
+		{From: 4, To: 9, With: "slow"},
+		{From: 10, To: 15, With: "red"},
+		{From: 16, To: 19, With: "cat"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "The slow red cat jumps over the lazy dog"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}