Rename pattern to regex

Minor fixes and tweaks
Fix up the tests and some minor bugs
2025-03-28 01:08:48 +01:00 · 2025-03-28 01:03:27 +01:00 · 2025-03-28 00:51:26 +01:00 · 2025-03-28 00:40:53 +01:00 · 2025-03-28 00:28:51 +01:00 · 2025-03-28 00:23:42 +01:00
37 changed files with 7052 additions and 7053 deletions
--- a/.gitignore
+++ b/.gitignore
@@ -1 +1,2 @@
 *.exe
 .qodo
--- a/.vscode/launch.json
+++ b/.vscode/launch.json
@@ -5,16 +5,46 @@
 	"version": "0.2.0",
 	"configurations": [
 		{
-			"name": "Launch Package",
+			"name": "Launch Package (Barotrauma)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
 				"loglevel",
 				"trace",
 				"(?-s)LightComponent!anyrange=\"(!num)\"",
 				"*4",
 				"**/Outpost*.xml"
 			]
 		},
 		{
 			"name": "Launch Package (Barotrauma cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"cookassistant.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Workspace)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"args": [
-				"-mode=json",
+				"-loglevel",
-				"$..name",
+				"trace",
-				"v='pero'",
+				"(?-s)LightComponent!anyrange=\"(!num)\"",
-				"test.json"
+				"*4",
 				"**/Outpost*.xml"
 			]
 		}
 	]
--- a/TalentsMechanic.xml
+++ b/TalentsMechanic.xml
@@ -1,651 +0,0 @@
 <?xml version="1.0" encoding="utf-8"?>
 <Talents>
  <Talent identifier="powerarmor">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.powerarmor">
      <Replace tag="[bonusmovement]" value="25" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHasItem tags="deepdivinglarge" />
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
      </Abilities>
    </AbilityGroupInterval>
    <AddedRecipe itemidentifier="exosuit"/>
  </Talent>
  <Talent identifier="foolhardy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="foolhardy" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="berserker">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="berserker" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="mudraptorwrestler">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.mudraptorwrestler">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattypeself">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData weapontype="NoWeapon,Melee" />
        <AbilityConditionCharacter>
          <Conditional group="eq mudraptor" />
        </AbilityConditionCharacter>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="heavylifting">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.heavylifting">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHoldingItem tags="alienartifact,crate"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="iamthatguy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.iamthatguy">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.skillbonus">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
      <Abilities>
        <CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="heavywrench"/>
  </Talent>
  <Talent identifier="robotics">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.robotics"/>
    <Description tag="talentdescription.roboticsreminder">
      <Replace tag="[amount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="defensebotspawner"/>
    <AddedRecipe itemidentifier="defensebotammobox"/>
  </Talent>
  <Talent identifier="ironstorm">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ironstorm">
      <Replace tag="[chance]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="scrapcannon"/>
  </Talent>
  <Talent identifier="residualwaste">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.residualwaste">
      <Replace tag="[chance]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.2"/>
        <!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
        <AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="massproduction">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.massproduction">
      <Replace tag="[chance]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityRemoveRandomIngredient>
          <AbilityConditionItem category="Material"/>
        </CharacterAbilityRemoveRandomIngredient>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="toolmaintenance">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.toolmaintenance">
      <Replace tag="[amount]" value="1" color="gui.green"/>
    </Description>
    <!-- Give once when unlocking the talent -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupEffect>
    <!-- Give every 60 seconds for late comers -->
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="miner">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
    <Description tag="talentdescription.miner">
      <Replace tag="[probability]" value="320" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.gainoredetachspeed">
      <Replace tag="[amount]" value="1600" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomchance="12.8"/>
        <AbilityConditionItem tags="ore"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="retrofit">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.retrofit" />
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ironman">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="ironhelmet"/>
    <AddedRecipe itemidentifier="makeshiftarmor"/>
  </Talent>
  <Talent identifier="oiledmachinery">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.oiledmachinery">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="pumpndump">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.pumpndump">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <conditions>
        <AbilityConditionItem tags="pump"/>
      </conditions>
      <Abilities>
        <CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ballastdenizen">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ballastdenizen">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="engineengineer">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.engineengineer">
      <Replace tag="[amount]" value="2.5" color="gui.green"/>
      <Replace tag="[max]" value="5" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="1" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="2" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="3" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="5" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="6" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="7" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel minlevel="8" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="multifunctional">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.multifunctional">
      <Replace tag="[powerincrease]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="wrenchitem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="crowbaritem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="salvagecrew">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.bonusxponmission">
      <Replace tag="[xpbonus]" value="30" color="gui.green"/>
      <Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.salvagecrew">
      <Replace tag="[swimbonus]" value="50" color="gui.green"/>
      <Replace tag="[resistanceamount]" value="10" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
      <Conditions>
        <AbilityConditionMission missiontype="Salvage"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="1.3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionInSubmarine submarinetype="Wreck" />
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="This" disabledeltatime="true">
              <Affliction identifier="salvagecrew" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.machinemaniac">
      <Replace tag="[bonus]" value="80" color="gui.green"/>
      <Replace tag="[amount]" value="3" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.30">
      <Replace tag="[requirement]" value="12" color="gui.green"/>
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
      <Replace tag="[xpamount]" value="500" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.50">
      <Replace tag="[requirement]" value="20" color="gui.green"/>
      <Replace tag="[level]" value="1" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.100">
      <Replace tag="[requirement]" value="40" color="gui.green"/>
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <!-- Give the player stats that tracks if the rewards should be given -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveExperience amount="2000"/>
        <CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="tinkerer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.increasemaxrepairmechanical">
      <Replace tag="[percentage]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="modularrepairs">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.freeupgrade">
      <Replace tag="[level]" value="1" color="gui.green"/>
      <Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="repairpack"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="hullfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="25" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="fixfoamgrenade"/>
    <AddedRecipe itemidentifier="handheldstatusmonitor"/>
  </Talent>
  <Talent identifier="letitdrain">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.letitdrain"/>
    <Description tag="talentdescription.letitdrainreminder">
      <Replace tag="[itemcount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="portablepump"/>
  </Talent>
  <Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="scrapsavant">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
    <Description tag="talentdescription.doublescrapoutput" />
    <Description tag="talentdescription.findadditionalscrap">
      <Replace tag="[probability]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionItem tags="scrap"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
      <Conditions>
        <AbilityConditionItemInSubmarine submarinetype="Wreck"/>
        <AbilityConditionItem tags="container"/>
      </Conditions>
      <Abilities>
        <CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
          <StatusEffects>
            <StatusEffect type="OnAbility" target="UseTarget" >
              <SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilitySpawnItemsToContainer>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="safetyfirst">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="safetyharness"/>
  </Talent>
 </Talents>
--- a/cmd/log_format_test/main.go
+++ b/cmd/log_format_test/main.go
@@ -0,0 +1,27 @@
 package main
 import (
 	"modify/logger"
 	"time"
 )
 func main() {
 	// Initialize logger with DEBUG level
 	logger.Init(logger.LevelDebug)
 	// Test different log levels
 	logger.Info("This is an info message")
 	logger.Debug("This is a debug message")
 	logger.Warning("This is a warning message")
 	logger.Error("This is an error message")
 	logger.Trace("This is a trace message (not visible at DEBUG level)")
 	// Test with a goroutine
 	logger.SafeGo(func() {
 		time.Sleep(10 * time.Millisecond)
 		logger.Info("Message from goroutine")
 	})
 	// Wait for goroutine to complete
 	time.Sleep(20 * time.Millisecond)
 }
--- a/glob_test.go
+++ b/glob_test.go
@@ -1,6 +1,7 @@
 package main
 import (
 	"modify/utils"
 	"os"
 	"path/filepath"
 	"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
-			files, err := expandFilePatterns(tc.patterns)
+			// Convert string patterns to map[string]struct{} for ExpandGLobs
 			patternMap := make(map[string]struct{})
 			for _, pattern := range tc.patterns {
 				patternMap[pattern] = struct{}{}
 			}
 			files, err := utils.ExpandGLobs(patternMap)
 			if err != nil {
-				t.Fatalf("expandFilePatterns failed: %v", err)
+				t.Fatalf("ExpandGLobs failed: %v", err)
 			}
 			if len(files) != tc.expected {
--- a/go.mod
+++ b/go.mod
@@ -3,16 +3,36 @@ module modify
 go 1.24.1
 require (
 	github.com/PaesslerAG/jsonpath v0.1.1
 	github.com/antchfx/xmlquery v1.4.4
 	github.com/bmatcuk/doublestar/v4 v4.8.1
 	github.com/stretchr/testify v1.10.0
 	github.com/yuin/gopher-lua v1.1.1
 	gopkg.in/yaml.v3 v3.0.1
 )
 require (
-	github.com/PaesslerAG/gval v1.0.0 // indirect
+	dario.cat/mergo v1.0.0 // indirect
-	github.com/antchfx/xpath v1.3.3 // indirect
+	github.com/Microsoft/go-winio v0.6.2 // indirect
-	github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da // indirect
+	github.com/ProtonMail/go-crypto v1.1.5 // indirect
-	golang.org/x/net v0.33.0 // indirect
+	github.com/cloudflare/circl v1.6.0 // indirect
-	golang.org/x/text v0.21.0 // indirect
+	github.com/cyphar/filepath-securejoin v0.4.1 // indirect
 	github.com/davecgh/go-spew v1.1.1 // indirect
 	github.com/emirpasic/gods v1.18.1 // indirect
 	github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
 	github.com/go-git/go-billy/v5 v5.6.2 // indirect
 	github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect
 	github.com/kevinburke/ssh_config v1.2.0 // indirect
 	github.com/pjbgf/sha1cd v0.3.2 // indirect
 	github.com/pmezard/go-difflib v1.0.0 // indirect
 	github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect
 	github.com/skeema/knownhosts v1.3.1 // indirect
 	github.com/xanzy/ssh-agent v0.3.3 // indirect
 	golang.org/x/crypto v0.35.0 // indirect
 	golang.org/x/sys v0.30.0 // indirect
 	gopkg.in/warnings.v0 v0.1.2 // indirect
 )
 require (
 	github.com/go-git/go-git/v5 v5.14.0
 	github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect
 	golang.org/x/net v0.35.0 // indirect
 )
--- a/go.sum
+++ b/go.sum
@@ -1,82 +1,106 @@
-github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
+dario.cat/mergo v1.0.0 h1:AGCNq9Evsj31mOgNPcLyXc+4PNABt905YmuqPYYpBWk=
-github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
+dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk=
-github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
+github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY=
-github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
+github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY=
-github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
+github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU=
-github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
+github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4=
-github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
+github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE=
-github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
+github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8=
-github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
+github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4=
 github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio=
 github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs=
 github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
 github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
-github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da h1:oI5xCqsCo564l8iNU+DwB5epxmsaqB+rhGL0m5jtYqE=
+github.com/cloudflare/circl v1.6.0 h1:cr5JKic4HI+LkINy2lg3W2jF8sHCVTBncJr5gIIq7qk=
-github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
+github.com/cloudflare/circl v1.6.0/go.mod h1:uddAzsPgqdMAYatqJ0lsjX1oECcQLIlRpzZh3pJrofs=
-github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
+github.com/cyphar/filepath-securejoin v0.4.1 h1:JyxxyPEaktOD+GAnqIqTf9A8tHyAG22rowi7HkoSU1s=
-github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
+github.com/cyphar/filepath-securejoin v0.4.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI=
 github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
 github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
 github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
 github.com/elazarl/goproxy v1.7.2 h1:Y2o6urb7Eule09PjlhQRGNsqRfPmYI3KKQLFpCAV3+o=
 github.com/elazarl/goproxy v1.7.2/go.mod h1:82vkLNir0ALaW14Rc399OTTjyNREgmdL2cVoIbS6XaE=
 github.com/emirpasic/gods v1.18.1 h1:FXtiHYKDGKCW2KzwZKx0iC0PQmdlorYgdFG9jPXJ1Bc=
 github.com/emirpasic/gods v1.18.1/go.mod h1:8tpGGwCnJ5H4r6BWwaV6OrWmMoPhUl5jm/FMNAnJvWQ=
 github.com/gliderlabs/ssh v0.3.8 h1:a4YXD1V7xMF9g5nTkdfnja3Sxy1PVDCj1Zg4Wb8vY6c=
 github.com/gliderlabs/ssh v0.3.8/go.mod h1:xYoytBv1sV0aL3CavoDuJIQNURXkkfPA/wxQ1pL1fAU=
 github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI=
 github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic=
 github.com/go-git/go-billy/v5 v5.6.2 h1:6Q86EsPXMa7c3YZ3aLAQsMA0VlWmy43r6FHqa/UNbRM=
 github.com/go-git/go-billy/v5 v5.6.2/go.mod h1:rcFC2rAsp/erv7CMz9GczHcuD0D32fWzH+MJAU+jaUU=
 github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4=
 github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
 github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60=
 github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k=
 github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ=
 github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw=
 github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8=
 github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU=
 github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A=
 github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99/go.mod h1:1lJo3i6rXxKeerYnT8Nvf0QmHCRC1n8sfWVwXF2Frvo=
 github.com/kevinburke/ssh_config v1.2.0 h1:x584FjTGwHzMwvHx18PXxbBVzfnxogHaAReU4gf13a4=
 github.com/kevinburke/ssh_config v1.2.0/go.mod h1:CT57kijsi8u/K/BOFA39wgDQJ9CxiF4nAY/ojJ6r6mM=
 github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
 github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
 github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
 github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
 github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
 github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
 github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
 github.com/onsi/gomega v1.34.1 h1:EUMJIKUjM8sKjYbtxQI9A4z2o+rruxnzNvpknOXie6k=
 github.com/onsi/gomega v1.34.1/go.mod h1:kU1QgUvBDLXBJq618Xvm2LUX6rSAfRaFRTcdOeDLwwY=
 github.com/pjbgf/sha1cd v0.3.2 h1:a9wb0bp1oC2TGwStyn0Umc/IGKQnEgF0vVaZ8QF8eo4=
 github.com/pjbgf/sha1cd v0.3.2/go.mod h1:zQWigSxVmsHEZow5qaLtPYxpcKMMQpa09ixqBxuCS6A=
 github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
 github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
 github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
 github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
 github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
 github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
 github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 h1:n661drycOFuPLCN3Uc8sB6B/s6Z4t2xvBgU1htSHuq8=
 github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3/go.mod h1:A0bzQcvG0E7Rwjx0REVgAGH58e96+X0MeOfepqsbeW4=
 github.com/sirupsen/logrus v1.7.0/go.mod h1:yWOB1SBYBC5VeMP7gHvWumXLIWorT60ONWic61uBYv0=
 github.com/skeema/knownhosts v1.3.1 h1:X2osQ+RAjK76shCbvhHHHVl3ZlgDm8apHEHFqRjnBY8=
 github.com/skeema/knownhosts v1.3.1/go.mod h1:r7KTdC8l4uxWRyK2TpQZ/1o5HaSzh06ePQNxPwTcfiY=
 github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
 github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
 github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
 github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
 github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
 github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM=
 github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw=
 github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
 github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
-golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
+golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
-golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
+golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs=
-golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
+golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ=
-golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
+golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8=
-golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
+golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY=
-golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
+golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
-golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
+golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
-golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
+golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
-golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
+golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
 golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
 golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
 golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
 golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
 golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
 golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
 golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
 golang.org/x/net v0.33.0 h1:74SYHlV8BIgHIFC/LrYkOGIwL19eTYXQ5wc6TBuO36I=
 golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
 golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
 golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc=
-golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
-golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
+golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU=
-golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
+golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s=
-golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
+golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
-golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
+golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
-golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
+golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
 golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
 golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
 golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
 golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
 golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
 golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo=
 golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
 golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
-golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
+gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
-golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
+gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
-golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
+gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
-golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
+gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
-golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
+gopkg.in/warnings.v0 v0.1.2 h1:wFXVbFY8DY5/xOe1ECiWdKCzZlxgshcYVNkBHstARME=
-golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
+gopkg.in/warnings.v0 v0.1.2/go.mod h1:jksf8JmL6Qr/oQM2OXTHunEvvTAsrWBLb6OOjuVWRNI=
 gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
 gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
 gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
 gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
--- a/logger/logger.go
+++ b/logger/logger.go
@@ -0,0 +1,465 @@
 package logger
 import (
 	"bytes"
 	"fmt"
 	"io"
 	"log"
 	"os"
 	"path/filepath"
 	"runtime"
 	"strconv"
 	"strings"
 	"sync"
 	"time"
 )
 // LogLevel defines the severity of log messages
 type LogLevel int
 const (
 	// LevelError is for critical errors that should always be displayed
 	LevelError LogLevel = iota
 	// LevelWarning is for important warnings
 	LevelWarning
 	// LevelInfo is for informational messages
 	LevelInfo
 	// LevelDebug is for detailed debugging information
 	LevelDebug
 	// LevelTrace is for very detailed tracing information
 	LevelTrace
 	// LevelLua is specifically for output from Lua scripts
 	LevelLua
 )
 var levelNames = map[LogLevel]string{
 	LevelError:   "ERROR",
 	LevelWarning: "WARNING",
 	LevelInfo:    "INFO",
 	LevelDebug:   "DEBUG",
 	LevelTrace:   "TRACE",
 	LevelLua:     "LUA",
 }
 var levelColors = map[LogLevel]string{
 	LevelError:   "\033[1;31m", // Bold Red
 	LevelWarning: "\033[1;33m", // Bold Yellow
 	LevelInfo:    "\033[1;32m", // Bold Green
 	LevelDebug:   "\033[1;36m", // Bold Cyan
 	LevelTrace:   "\033[1;35m", // Bold Magenta
 	LevelLua:     "\033[1;34m", // Bold Blue
 }
 // ResetColor is the ANSI code to reset text color
 const ResetColor = "\033[0m"
 // Logger is our custom logger with level support
 type Logger struct {
 	mu            sync.Mutex
 	out           io.Writer
 	currentLevel  LogLevel
 	prefix        string
 	flag          int
 	useColors     bool
 	callerOffset  int
 	defaultFields map[string]interface{}
 	showGoroutine bool
 }
 var (
 	// DefaultLogger is the global logger instance
 	DefaultLogger *Logger
 	// defaultLogLevel is the default log level if not specified
 	defaultLogLevel = LevelInfo
 	// Global mutex for DefaultLogger initialization
 	initMutex sync.Mutex
 )
 // ParseLevel converts a string log level to LogLevel
 func ParseLevel(levelStr string) LogLevel {
 	switch strings.ToUpper(levelStr) {
 	case "ERROR":
 		return LevelError
 	case "WARNING", "WARN":
 		return LevelWarning
 	case "INFO":
 		return LevelInfo
 	case "DEBUG":
 		return LevelDebug
 	case "TRACE":
 		return LevelTrace
 	case "LUA":
 		return LevelLua
 	default:
 		return defaultLogLevel
 	}
 }
 // String returns the string representation of the log level
 func (l LogLevel) String() string {
 	if name, ok := levelNames[l]; ok {
 		return name
 	}
 	return fmt.Sprintf("Level(%d)", l)
 }
 // New creates a new Logger instance
 func New(out io.Writer, prefix string, flag int) *Logger {
 	return &Logger{
 		out:           out,
 		currentLevel:  defaultLogLevel,
 		prefix:        prefix,
 		flag:          flag,
 		useColors:     true,
 		callerOffset:  0,
 		defaultFields: make(map[string]interface{}),
 		showGoroutine: true,
 	}
 }
 // Init initializes the DefaultLogger
 func Init(level LogLevel) {
 	initMutex.Lock()
 	defer initMutex.Unlock()
 	if DefaultLogger == nil {
 		DefaultLogger = New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
 	}
 	DefaultLogger.SetLevel(level)
 }
 // SetLevel sets the current log level
 func (l *Logger) SetLevel(level LogLevel) {
 	l.mu.Lock()
 	defer l.mu.Unlock()
 	l.currentLevel = level
 }
 // GetLevel returns the current log level
 func (l *Logger) GetLevel() LogLevel {
 	l.mu.Lock()
 	defer l.mu.Unlock()
 	return l.currentLevel
 }
 // SetCallerOffset sets the caller offset for correct file and line reporting
 func (l *Logger) SetCallerOffset(offset int) {
 	l.mu.Lock()
 	defer l.mu.Unlock()
 	l.callerOffset = offset
 }
 // SetShowGoroutine sets whether to include goroutine ID in log messages
 func (l *Logger) SetShowGoroutine(show bool) {
 	l.mu.Lock()
 	defer l.mu.Unlock()
 	l.showGoroutine = show
 }
 // ShowGoroutine returns whether goroutine ID is included in log messages
 func (l *Logger) ShowGoroutine() bool {
 	l.mu.Lock()
 	defer l.mu.Unlock()
 	return l.showGoroutine
 }
 // WithField adds a field to the logger's context
 func (l *Logger) WithField(key string, value interface{}) *Logger {
 	newLogger := &Logger{
 		out:           l.out,
 		currentLevel:  l.currentLevel,
 		prefix:        l.prefix,
 		flag:          l.flag,
 		useColors:     l.useColors,
 		callerOffset:  l.callerOffset,
 		defaultFields: make(map[string]interface{}),
 		showGoroutine: l.showGoroutine,
 	}
 	// Copy existing fields
 	for k, v := range l.defaultFields {
 		newLogger.defaultFields[k] = v
 	}
 	// Add new field
 	newLogger.defaultFields[key] = value
 	return newLogger
 }
 // WithFields adds multiple fields to the logger's context
 func (l *Logger) WithFields(fields map[string]interface{}) *Logger {
 	newLogger := &Logger{
 		out:           l.out,
 		currentLevel:  l.currentLevel,
 		prefix:        l.prefix,
 		flag:          l.flag,
 		useColors:     l.useColors,
 		callerOffset:  l.callerOffset,
 		defaultFields: make(map[string]interface{}),
 		showGoroutine: l.showGoroutine,
 	}
 	// Copy existing fields
 	for k, v := range l.defaultFields {
 		newLogger.defaultFields[k] = v
 	}
 	// Add new fields
 	for k, v := range fields {
 		newLogger.defaultFields[k] = v
 	}
 	return newLogger
 }
 // GetGoroutineID extracts the goroutine ID from the runtime stack
 func GetGoroutineID() string {
 	buf := make([]byte, 64)
 	n := runtime.Stack(buf, false)
 	// Format of first line is "goroutine N [state]:"
 	// We only need the N part
 	buf = buf[:n]
 	idField := bytes.Fields(bytes.Split(buf, []byte{':'})[0])[1]
 	return string(idField)
 }
 // formatMessage formats a log message with level, time, file, and line information
 func (l *Logger) formatMessage(level LogLevel, format string, args ...interface{}) string {
 	var msg string
 	if len(args) > 0 {
 		msg = fmt.Sprintf(format, args...)
 	} else {
 		msg = format
 	}
 	// Format default fields if any
 	var fields string
 	if len(l.defaultFields) > 0 {
 		var pairs []string
 		for k, v := range l.defaultFields {
 			pairs = append(pairs, fmt.Sprintf("%s=%v", k, v))
 		}
 		fields = " " + strings.Join(pairs, " ")
 	}
 	var levelColor, resetColor string
 	if l.useColors {
 		levelColor = levelColors[level]
 		resetColor = ResetColor
 	}
 	var caller string
 	if l.flag&log.Lshortfile != 0 || l.flag&log.Llongfile != 0 {
 		// Find the actual caller by scanning up the stack
 		// until we find a function outside the logger package
 		var file string
 		var line int
 		var ok bool
 		// Start at a reasonable depth and scan up to 10 frames
 		for depth := 4; depth < 15; depth++ {
 			_, file, line, ok = runtime.Caller(depth)
 			if !ok {
 				break
 			}
 			// If the caller is not in the logger package, we found our caller
 			if !strings.Contains(file, "logger/logger.go") {
 				break
 			}
 		}
 		if !ok {
 			file = "???"
 			line = 0
 		}
 		if l.flag&log.Lshortfile != 0 {
 			file = filepath.Base(file)
 		}
 		caller = fmt.Sprintf("%-25s ", file+":"+strconv.Itoa(line))
 	}
 	// Format the timestamp with fixed width
 	var timeStr string
 	if l.flag&(log.Ldate|log.Ltime|log.Lmicroseconds) != 0 {
 		t := time.Now()
 		if l.flag&log.Ldate != 0 {
 			timeStr += fmt.Sprintf("%04d/%02d/%02d ", t.Year(), t.Month(), t.Day())
 		}
 		if l.flag&(log.Ltime|log.Lmicroseconds) != 0 {
 			timeStr += fmt.Sprintf("%02d:%02d:%02d", t.Hour(), t.Minute(), t.Second())
 			if l.flag&log.Lmicroseconds != 0 {
 				timeStr += fmt.Sprintf(".%06d", t.Nanosecond()/1000)
 			}
 		}
 		timeStr = fmt.Sprintf("%-15s ", timeStr)
 	}
 	// Add goroutine ID if enabled, with fixed width
 	var goroutineStr string
 	if l.showGoroutine {
 		goroutineID := GetGoroutineID()
 		goroutineStr = fmt.Sprintf("[g:%-4s] ", goroutineID)
 	}
 	// Create a colored level indicator with both brackets colored
 	levelStr := fmt.Sprintf("%s[%s]%s", levelColor, levelNames[level], levelColor)
 	// Add a space after the level and before the reset color
 	levelColumn := fmt.Sprintf("%s %s", levelStr, resetColor)
 	return fmt.Sprintf("%s%s%s%s%s%s%s\n",
 		l.prefix, timeStr, caller, goroutineStr, levelColumn, msg, fields)
 }
 // log logs a message at the specified level
 func (l *Logger) log(level LogLevel, format string, args ...interface{}) {
 	// Always show LUA level logs regardless of the current log level
 	if level != LevelLua && level > l.currentLevel {
 		return
 	}
 	l.mu.Lock()
 	defer l.mu.Unlock()
 	msg := l.formatMessage(level, format, args...)
 	fmt.Fprint(l.out, msg)
 }
 // Error logs an error message
 func (l *Logger) Error(format string, args ...interface{}) {
 	l.log(LevelError, format, args...)
 }
 // Warning logs a warning message
 func (l *Logger) Warning(format string, args ...interface{}) {
 	l.log(LevelWarning, format, args...)
 }
 // Info logs an informational message
 func (l *Logger) Info(format string, args ...interface{}) {
 	l.log(LevelInfo, format, args...)
 }
 // Debug logs a debug message
 func (l *Logger) Debug(format string, args ...interface{}) {
 	l.log(LevelDebug, format, args...)
 }
 // Trace logs a trace message
 func (l *Logger) Trace(format string, args ...interface{}) {
 	l.log(LevelTrace, format, args...)
 }
 // Lua logs a Lua message
 func (l *Logger) Lua(format string, args ...interface{}) {
 	l.log(LevelLua, format, args...)
 }
 // Global log functions that use DefaultLogger
 // Error logs an error message using the default logger
 func Error(format string, args ...interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.Error(format, args...)
 }
 // Warning logs a warning message using the default logger
 func Warning(format string, args ...interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.Warning(format, args...)
 }
 // Info logs an informational message using the default logger
 func Info(format string, args ...interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.Info(format, args...)
 }
 // Debug logs a debug message using the default logger
 func Debug(format string, args ...interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.Debug(format, args...)
 }
 // Trace logs a trace message using the default logger
 func Trace(format string, args ...interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.Trace(format, args...)
 }
 // Lua logs a Lua message using the default logger
 func Lua(format string, args ...interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.Lua(format, args...)
 }
 // LogPanic logs a panic error and its stack trace
 func LogPanic(r interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	stack := make([]byte, 4096)
 	n := runtime.Stack(stack, false)
 	DefaultLogger.Error("PANIC: %v\n%s", r, stack[:n])
 }
 // SetLevel sets the log level for the default logger
 func SetLevel(level LogLevel) {
 	if DefaultLogger == nil {
 		Init(level)
 		return
 	}
 	DefaultLogger.SetLevel(level)
 }
 // GetLevel gets the log level for the default logger
 func GetLevel() LogLevel {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	return DefaultLogger.GetLevel()
 }
 // WithField returns a new logger with the field added to the default logger's context
 func WithField(key string, value interface{}) *Logger {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	return DefaultLogger.WithField(key, value)
 }
 // WithFields returns a new logger with the fields added to the default logger's context
 func WithFields(fields map[string]interface{}) *Logger {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	return DefaultLogger.WithFields(fields)
 }
 // SetShowGoroutine enables or disables goroutine ID display in the default logger
 func SetShowGoroutine(show bool) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.SetShowGoroutine(show)
 }
 // ShowGoroutine returns whether goroutine ID is included in default logger's messages
 func ShowGoroutine() bool {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	return DefaultLogger.ShowGoroutine()
 }
--- a/logger/panic_handler.go
+++ b/logger/panic_handler.go
@@ -0,0 +1,49 @@
 package logger
 import (
 	"fmt"
 	"runtime/debug"
 )
 // PanicHandler handles a panic and logs it
 func PanicHandler() {
 	if r := recover(); r != nil {
 		goroutineID := GetGoroutineID()
 		stackTrace := debug.Stack()
 		Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
 	}
 }
 // SafeGo launches a goroutine with panic recovery
 // Usage: logger.SafeGo(func() { ... your code ... })
 func SafeGo(f func()) {
 	go func() {
 		defer PanicHandler()
 		f()
 	}()
 }
 // SafeGoWithArgs launches a goroutine with panic recovery and passes arguments
 // Usage: logger.SafeGoWithArgs(func(arg1, arg2 interface{}) { ... }, "value1", 42)
 func SafeGoWithArgs(f func(...interface{}), args ...interface{}) {
 	go func() {
 		defer PanicHandler()
 		f(args...)
 	}()
 }
 // SafeExec executes a function with panic recovery
 // Useful for code that should not panic
 func SafeExec(f func()) (err error) {
 	defer func() {
 		if r := recover(); r != nil {
 			goroutineID := GetGoroutineID()
 			stackTrace := debug.Stack()
 			Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
 			err = fmt.Errorf("panic recovered: %v", r)
 		}
 	}()
 	f()
 	return nil
 }
--- a/main.go
+++ b/main.go
@@ -3,50 +3,47 @@ package main
 import (
 	"flag"
 	"fmt"
 	"log"
 	"os"
 	"sync"
-
+	"time"
 	"github.com/bmatcuk/doublestar/v4"
 	"modify/processor"
 	"modify/utils"
 	"github.com/go-git/go-git/v5"
 	"modify/logger"
 )
 type GlobalStats struct {
-	TotalMatches       int
+	TotalMatches            int
-	TotalModifications int
+	TotalModifications      int
-	ProcessedFiles     int
+	ProcessedFiles          int
-	FailedFiles        int
+	FailedFiles             int
 	ModificationsPerCommand map[string]int
 }
 var stats GlobalStats
 var logger *log.Logger
 var (
-	jsonFlag = flag.Bool("json", false, "Process JSON files")
+	repo     *git.Repository
-	xmlFlag  = flag.Bool("xml", false, "Process XML files")
+	worktree *git.Worktree
 	stats    GlobalStats = GlobalStats{
 		ModificationsPerCommand: make(map[string]int),
 	}
 )
 func init() {
 	log.SetFlags(log.Lmicroseconds | log.Lshortfile)
 	logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
 	stats = GlobalStats{}
 }
 func main() {
 	flag.Usage = func() {
 		fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nOptions:\n")
-		fmt.Fprintf(os.Stderr, "  -mode string\n")
+		fmt.Fprintf(os.Stderr, "  -git\n")
-		fmt.Fprintf(os.Stderr, "        Processing mode: regex, xml, json (default \"regex\")\n")
+		fmt.Fprintf(os.Stderr, "        Use git to manage files\n")
 		fmt.Fprintf(os.Stderr, "  -reset\n")
 		fmt.Fprintf(os.Stderr, "        Reset files to their original state\n")
 		fmt.Fprintf(os.Stderr, "  -loglevel string\n")
 		fmt.Fprintf(os.Stderr, "        Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
 		fmt.Fprintf(os.Stderr, "\nExamples:\n")
 		fmt.Fprintf(os.Stderr, "  Regex mode (default):\n")
 		fmt.Fprintf(os.Stderr, "    %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "  XML mode:\n")
 		fmt.Fprintf(os.Stderr, "    %s -mode=xml -xpath=\"//value\" \"*1.5\" data.xml\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "  JSON mode:\n")
 		fmt.Fprintf(os.Stderr, "    %s -mode=json -jsonpath=\"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
 		fmt.Fprintf(os.Stderr, "      s1, s2, etc. are used to refer to capture groups as strings.\n")
 		fmt.Fprintf(os.Stderr, "      Helper functions: num(str) converts string to number, str(num) converts number to string\n")
@@ -55,106 +52,167 @@ func main() {
 		fmt.Fprintf(os.Stderr, "      You can use any valid Lua code, including if statements, loops, etc.\n")
 		fmt.Fprintf(os.Stderr, "      Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
 	}
 	flag.Parse()
 	args := flag.Args()
-	if len(args) < 3 {
+	level := logger.ParseLevel(*utils.LogLevel)
-		log.Printf("At least %d arguments are required", 3)
+	logger.Init(level)
 	logger.Info("Initializing with log level: %s", level.String())
 	// The plan is:
 	// Load all commands
 	commands, err := utils.LoadCommands(args)
 	if err != nil {
 		logger.Error("Failed to load commands: %v", err)
 		flag.Usage()
 		return
 	}
-	// Get the appropriate pattern and expression based on mode
+	// Then aggregate all the globs and deduplicate them
-	var pattern, luaExpr string
+	globs := utils.AggregateGlobs(commands)
-	var filePatterns []string
+	logger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
-	pattern = args[0]
+	// Resolve all the files for all the globs
-	luaExpr = args[1]
+	logger.Info("Found %d unique file patterns", len(globs))
-	filePatterns = args[2:]
+	files, err := utils.ExpandGLobs(globs)
 	// Prepare the Lua expression
 	originalLuaExpr := luaExpr
 	luaExpr = processor.BuildLuaScript(luaExpr)
 	if originalLuaExpr != luaExpr {
 		logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
 	}
 	// Expand file patterns with glob support
 	files, err := expandFilePatterns(filePatterns)
 	if err != nil {
-		fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
+		logger.Error("Failed to expand file patterns: %v", err)
 		return
 	}
 	logger.Info("Found %d files to process", len(files))
 	// Somehow connect files to commands via globs..
 	// For each file check every glob of every command
 	// Maybe memoize this part
 	// That way we know what commands affect what files
 	associations, err := utils.AssociateFilesWithCommands(files, commands)
 	if err != nil {
 		logger.Error("Failed to associate files with commands: %v", err)
 		return
 	}
-	if len(files) == 0 {
+	// TODO: Utilize parallel workers for this
-		fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
+	// Then for each file run all commands associated with the file
-		return
+	workers := make(chan struct{}, *utils.ParallelFiles)
-	}
+	wg := sync.WaitGroup{}
-	// Create the processor based on mode
+	// Add performance tracking
-	var proc processor.Processor
+	startTime := time.Now()
-	switch {
+	var fileMutex sync.Mutex
 	case *xmlFlag:
 		proc = &processor.XMLProcessor{}
 		logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
 			pattern, luaExpr, len(files))
 	case *jsonFlag:
 		proc = &processor.JSONProcessor{}
 		logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
 			pattern, luaExpr, len(files))
 	default:
 		proc = &processor.RegexProcessor{}
 		logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
 			pattern, luaExpr, len(files))
 	}
-	var wg sync.WaitGroup
+	for file, commands := range associations {
-	// Process each file
+		workers <- struct{}{}
 	for _, file := range files {
 		wg.Add(1)
-		go func(file string) {
+		logger.SafeGoWithArgs(func(args ...interface{}) {
 			defer func() { <-workers }()
 			defer wg.Done()
 			logger.Printf("Processing file: %s", file)
-			modCount, matchCount, err := proc.Process(file, pattern, luaExpr)
+			// Track per-file processing time
 			fileStartTime := time.Now()
 			fileData, err := os.ReadFile(file)
 			if err != nil {
-				fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
+				logger.Error("Failed to read file %q: %v", file, err)
-				stats.FailedFiles++
+				return
 			} else {
 				logger.Printf("Successfully processed file: %s", file)
 				stats.ProcessedFiles++
 				stats.TotalMatches += matchCount
 				stats.TotalModifications += modCount
 			}
-		}(file)
+			logger.Trace("Loaded %d bytes of data for file %q", len(fileData), file)
 			fileDataStr := string(fileData)
 			// Aggregate all the modifications and execute them
 			modifications := []utils.ReplaceCommand{}
 			for _, command := range commands {
 				logger.Info("Processing file %q with command %q", file, command.Regex)
 				commands, err := processor.ProcessRegex(fileDataStr, command)
 				if err != nil {
 					logger.Error("Failed to process file %q with command %q: %v", file, command.Regex, err)
 					return
 				}
 				modifications = append(modifications, commands...)
 				// It is not guranteed that all the commands will be executed...
 				// TODO: Make this better
 				// We'd have to pass the map to executemodifications or something...
 				stats.ModificationsPerCommand[command.Name] += len(commands)
 			}
 			if len(modifications) == 0 {
 				logger.Info("No modifications found for file %q", file)
 				return
 			}
 			// Sort commands in reverse order for safe replacements
 			fileDataStr, count := utils.ExecuteModifications(modifications, fileDataStr)
 			fileMutex.Lock()
 			stats.ProcessedFiles++
 			stats.TotalModifications += count
 			fileMutex.Unlock()
 			logger.Info("Executed %d modifications for file %q", count, file)
 			err = os.WriteFile(file, []byte(fileDataStr), 0644)
 			if err != nil {
 				logger.Error("Failed to write file %q: %v", file, err)
 				return
 			}
 			logger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
 		}, file, commands)
 	}
 	wg.Wait()
 	processingTime := time.Since(startTime)
 	logger.Info("Processing completed in %v", processingTime)
 	if stats.ProcessedFiles > 0 {
 		logger.Info("Average time per file: %v", processingTime/time.Duration(stats.ProcessedFiles))
 	}
 	// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
 	// Do that with logger.WithField("loglevel", level.String())
 	// Since each command also has its own log level
 	// TODO: Maybe even figure out how to run individual commands...?
 	// TODO: What to do with git? Figure it out ....
 	// if *gitFlag {
 	// 	logger.Info("Git integration enabled, setting up git repository")
 	// 	err := setupGit()
 	// 	if err != nil {
 	// 		logger.Error("Failed to setup git: %v", err)
 	// 		fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
 	// 		return
 	// 	}
 	// }
 	// logger.Debug("Expanding file patterns")
 	// files, err := expandFilePatterns(filePatterns)
 	// if err != nil {
 	// 	logger.Error("Failed to expand file patterns: %v", err)
 	// 	fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
 	// 	return
 	// }
 	// if *gitFlag {
 	// 	logger.Info("Cleaning up git files before processing")
 	// 	err := cleanupGitFiles(files)
 	// 	if err != nil {
 	// 		logger.Error("Failed to cleanup git files: %v", err)
 	// 		fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
 	// 		return
 	// 	}
 	// }
 	// if *resetFlag {
 	// 	logger.Info("Files reset to their original state, nothing more to do")
 	// 	log.Printf("Files reset to their original state, nothing more to do")
 	// 	return
 	// }
 	// Print summary
 	if stats.TotalModifications == 0 {
 		logger.Warning("No modifications were made in any files")
 		fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
 	} else {
 		logger.Info("Operation complete! Modified %d values in %d/%d files",
 			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
 		fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
 			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
 	}
 }
 func expandFilePatterns(patterns []string) ([]string, error) {
 	var files []string
 	filesMap := make(map[string]bool)
 	for _, pattern := range patterns {
 		matches, _ := doublestar.Glob(os.DirFS("."), pattern)
 		for _, m := range matches {
 			if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
 				filesMap[m], files = true, append(files, m)
 			}
 		}
 	}
 	if len(files) > 0 {
 		logger.Printf("Found %d files to process", len(files))
 	}
 	return files, nil
 }
--- a/processor/json.go
+++ b/processor/json.go
@@ -1,217 +0,0 @@
 package processor
 import (
 	"encoding/json"
 	"fmt"
 	"log"
 	"modify/processor/jsonpath"
 	"os"
 	"path/filepath"
 	lua "github.com/yuin/gopher-lua"
 )
 // JSONProcessor implements the Processor interface for JSON documents
 type JSONProcessor struct{}
 // Process implements the Processor interface for JSONProcessor
 func (p *JSONProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
 	// Read file content
 	cwd, err := os.Getwd()
 	if err != nil {
 		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
 	}
 	fullPath := filepath.Join(cwd, filename)
 	content, err := os.ReadFile(fullPath)
 	if err != nil {
 		return 0, 0, fmt.Errorf("error reading file: %v", err)
 	}
 	fileContent := string(content)
 	// Process the content
 	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
 	if err != nil {
 		return 0, 0, err
 	}
 	// If we made modifications, save the file
 	if modCount > 0 {
 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
 		if err != nil {
 			return 0, 0, fmt.Errorf("error writing file: %v", err)
 		}
 	}
 	return modCount, matchCount, nil
 }
 // ProcessContent implements the Processor interface for JSONProcessor
 func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
 	// Parse JSON document
 	var jsonData interface{}
 	err := json.Unmarshal([]byte(content), &jsonData)
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
 	}
 	// Find nodes matching the JSONPath pattern
 	nodes, err := jsonpath.Get(jsonData, pattern)
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
 	}
 	matchCount := len(nodes)
 	if matchCount == 0 {
 		return content, 0, 0, nil
 	}
 	modCount := 0
 	for _, node := range nodes {
 		log.Printf("Processing node at path: %s with value: %v", node.Path, node.Value)
 		// Initialize Lua
 		L, err := NewLuaState()
 		if err != nil {
 			return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		defer L.Close()
 		log.Println("Lua state initialized successfully.")
 		err = p.ToLua(L, node.Value)
 		if err != nil {
 			return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
 		}
 		log.Printf("Converted node value to Lua: %v", node.Value)
 		originalScript := luaExpr
 		fullScript := BuildLuaScript(luaExpr)
 		log.Printf("Original script: %q, Full script: %q", originalScript, fullScript)
 		// Execute Lua script
 		log.Printf("Executing Lua script: %q", fullScript)
 		if err := L.DoString(fullScript); err != nil {
 			return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
 		}
 		log.Println("Lua script executed successfully.")
 		// Get modified value
 		result, err := p.FromLua(L)
 		if err != nil {
 			return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
 		}
 		log.Printf("Retrieved modified value from Lua: %v", result)
 		modified := false
 		modified = L.GetGlobal("modified").String() == "true"
 		if !modified {
 			log.Printf("No changes made to node at path: %s", node.Path)
 			continue
 		}
 		// Apply the modification to the JSON data
 		err = p.updateJSONValue(jsonData, node.Path, result)
 		if err != nil {
 			return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
 		}
 		log.Printf("Updated JSON at path: %s with new value: %v", node.Path, result)
 		modCount++
 	}
 	// Convert the modified JSON back to a string with same formatting
 	var jsonBytes []byte
 	jsonBytes, err = json.MarshalIndent(jsonData, "", "  ")
 	if err != nil {
 		return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
 	}
 	return string(jsonBytes), modCount, matchCount, nil
 }
 // / 	Selects from the root node
 // // 	Selects nodes in the document from the current node that match the selection no matter where they are
 // . 	Selects the current node
 // @ 	Selects attributes
 // /bookstore/* 	Selects all the child element nodes of the bookstore element
 // //* 	Selects all elements in the document
 // /bookstore/book[1] 	Selects the first book element that is the child of the bookstore element.
 // /bookstore/book[last()] 	Selects the last book element that is the child of the bookstore element
 // /bookstore/book[last()-1] 	Selects the last but one book element that is the child of the bookstore element
 // /bookstore/book[position()<3] 	Selects the first two book elements that are children of the bookstore element
 // //title[@lang] 	Selects all the title elements that have an attribute named lang
 // //title[@lang='en'] 	Selects all the title elements that have a "lang" attribute with a value of "en"
 // /bookstore/book[price>35.00] 	Selects all the book elements of the bookstore element that have a price element with a value greater than 35.00
 // /bookstore/book[price>35.00]/title 	Selects all the title elements of the book elements of the bookstore element that have a price element with a value greater than 35.00
 // updateJSONValue updates a value in the JSON structure based on its JSONPath
 func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
 	// Special handling for root node
 	if path == "$" {
 		// For the root node, we'll copy the value to the jsonData reference
 		// This is a special case since we can't directly replace the interface{} variable
 		// We need to handle different types of root elements
 		switch rootValue := newValue.(type) {
 		case map[string]interface{}:
 			// For objects, we need to copy over all keys
 			rootMap, ok := jsonData.(map[string]interface{})
 			if !ok {
 				// If the original wasn't a map, completely replace it with the new map
 				// This is handled by the jsonpath.Set function
 				return jsonpath.Set(jsonData, path, newValue)
 			}
 			// Clear the original map
 			for k := range rootMap {
 				delete(rootMap, k)
 			}
 			// Copy all keys from the new map
 			for k, v := range rootValue {
 				rootMap[k] = v
 			}
 			return nil
 		case []interface{}:
 			// For arrays, we need to handle similarly
 			rootArray, ok := jsonData.([]interface{})
 			if !ok {
 				// If the original wasn't an array, use jsonpath.Set
 				return jsonpath.Set(jsonData, path, newValue)
 			}
 			// Clear and recreate the array
 			*&rootArray = rootValue
 			return nil
 		default:
 			// For other types, use jsonpath.Set
 			return jsonpath.Set(jsonData, path, newValue)
 		}
 	}
 	// For non-root paths, use the regular Set method
 	err := jsonpath.Set(jsonData, path, newValue)
 	if err != nil {
 		return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
 	}
 	return nil
 }
 // ToLua converts JSON values to Lua variables
 func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
 	table, err := ToLua(L, data)
 	if err != nil {
 		return err
 	}
 	L.SetGlobal("v", table)
 	return nil
 }
 // FromLua retrieves values from Lua
 func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	luaValue := L.GetGlobal("v")
 	return FromLua(L, luaValue)
 }
--- a/processor/json_test.go
+++ b/processor/json_test.go
--- a/processor/jsonpath/jsonpath.go
+++ b/processor/jsonpath/jsonpath.go
@@ -1,490 +0,0 @@
 package jsonpath
 import (
 	"fmt"
 	"strconv"
 )
 // JSONStep represents a single step in a JSONPath query
 type JSONStep struct {
 	Type  StepType
 	Key   string // For Child/RecursiveDescent
 	Index int    // For Index (use -1 for wildcard "*")
 }
 // JSONNode represents a value in the JSON data with its path
 type JSONNode struct {
 	Value interface{} // The value found at the path
 	Path  string      // The exact JSONPath where the value was found
 }
 // StepType defines the types of steps in a JSONPath
 type StepType int
 const (
 	RootStep             StepType = iota // $ - The root element
 	ChildStep                            // .key - Direct child access
 	RecursiveDescentStep                 // ..key - Recursive search for key
 	WildcardStep                         // .* - All children of an object
 	IndexStep                            // [n] - Array index access (or [*] for all elements)
 )
 // TraversalMode determines how the traversal behaves
 type TraversalMode int
 const (
 	CollectMode     TraversalMode = iota // Just collect matched nodes
 	ModifyFirstMode                      // Modify first matching node
 	ModifyAllMode                        // Modify all matching nodes
 )
 // ParseJSONPath parses a JSONPath string into a sequence of steps
 func ParseJSONPath(path string) ([]JSONStep, error) {
 	if len(path) == 0 || path[0] != '$' {
 		return nil, fmt.Errorf("path must start with $; received: %q", path)
 	}
 	steps := []JSONStep{}
 	i := 0
 	for i < len(path) {
 		switch path[i] {
 		case '$':
 			steps = append(steps, JSONStep{Type: RootStep})
 			i++
 		case '.':
 			i++
 			if i < len(path) && path[i] == '.' {
 				// Recursive descent
 				i++
 				key, nextPos := readKey(path, i)
 				steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
 				i = nextPos
 			} else {
 				// Child step or wildcard
 				key, nextPos := readKey(path, i)
 				if key == "*" {
 					steps = append(steps, JSONStep{Type: WildcardStep})
 				} else {
 					steps = append(steps, JSONStep{Type: ChildStep, Key: key})
 				}
 				i = nextPos
 			}
 		case '[':
 			// Index step
 			i++
 			indexStr, nextPos := readIndex(path, i)
 			if indexStr == "*" {
 				steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
 			} else {
 				index, err := strconv.Atoi(indexStr)
 				if err != nil {
 					return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
 				}
 				steps = append(steps, JSONStep{Type: IndexStep, Index: index})
 			}
 			i = nextPos + 1 // Skip closing ]
 		default:
 			return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
 		}
 	}
 	return steps, nil
 }
 // readKey extracts a key name from the path
 func readKey(path string, start int) (string, int) {
 	i := start
 	for ; i < len(path); i++ {
 		if path[i] == '.' || path[i] == '[' {
 			break
 		}
 	}
 	return path[start:i], i
 }
 // readIndex extracts an array index or wildcard from the path
 func readIndex(path string, start int) (string, int) {
 	i := start
 	for ; i < len(path); i++ {
 		if path[i] == ']' {
 			break
 		}
 	}
 	return path[start:i], i
 }
 // Get retrieves values with their paths from data at the specified JSONPath
 // Each returned JSONNode contains both the value and its exact path in the data structure
 func Get(data interface{}, path string) ([]JSONNode, error) {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	results := []JSONNode{}
 	err = traverseWithPaths(data, steps, &results, "$")
 	if err != nil {
 		return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
 	}
 	return results, nil
 }
 // Set updates the value at the specified JSONPath in the original data structure.
 // It only modifies the first matching node.
 func Set(data interface{}, path string, value interface{}) error {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	success := false
 	err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
 	if err != nil {
 		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
 	}
 	return nil
 }
 // SetAll updates all matching values at the specified JSONPath.
 func SetAll(data interface{}, path string, value interface{}) error {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	success := false
 	err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
 	if err != nil {
 		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
 	}
 	return nil
 }
 // setWithPath modifies values while tracking paths
 func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
 	if node == nil || *success && mode == ModifyFirstMode {
 		return nil
 	}
 	// Skip root step
 	actualSteps := steps
 	if len(steps) > 0 && steps[0].Type == RootStep {
 		actualSteps = steps[1:]
 	}
 	// If we have no steps left, we're setting the root value
 	if len(actualSteps) == 0 {
 		// For the root node, we need to handle it differently depending on what's passed in
 		// since we can't directly replace the interface{} variable
 		// We'll signal success and let the JSONProcessor handle updating the root
 		*success = true
 		return nil
 	}
 	// Process the first step
 	step := actualSteps[0]
 	remainingSteps := actualSteps[1:]
 	isLastStep := len(remainingSteps) == 0
 	switch step.Type {
 	case ChildStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
 		}
 		childPath := currentPath + "." + step.Key
 		if isLastStep {
 			// We've reached the target, set the value
 			m[step.Key] = value
 			*success = true
 			return nil
 		}
 		// Create intermediate nodes if necessary
 		child, exists := m[step.Key]
 		if !exists {
 			// Create missing intermediate node
 			if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
 				child = []interface{}{}
 			} else {
 				child = map[string]interface{}{}
 			}
 			m[step.Key] = child
 		}
 		err := setWithPath(child, remainingSteps, success, value, childPath, mode)
 		if err != nil {
 			return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 		}
 	case IndexStep:
 		arr, ok := node.([]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
 		}
 		// Handle wildcard index
 		if step.Index == -1 {
 			for i, item := range arr {
 				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				if isLastStep {
 					arr[i] = value
 					*success = true
 					if mode == ModifyFirstMode {
 						return nil
 					}
 				} else {
 					err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
 					if err != nil {
 						return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
 					}
 					if *success && mode == ModifyFirstMode {
 						return nil
 					}
 				}
 			}
 			return nil
 		}
 		// Handle specific index
 		if step.Index >= 0 && step.Index < len(arr) {
 			item := arr[step.Index]
 			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
 			if isLastStep {
 				arr[step.Index] = value
 				*success = true
 			} else {
 				err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
 				}
 			}
 		}
 	case RecursiveDescentStep:
 		// For recursive descent, first check direct match at this level
 		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
 			if val, exists := m[step.Key]; exists {
 				directPath := currentPath + "." + step.Key
 				if isLastStep {
 					m[step.Key] = value
 					*success = true
 					if mode == ModifyFirstMode {
 						return nil
 					}
 				} else {
 					err := setWithPath(val, remainingSteps, success, value, directPath, mode)
 					if err != nil {
 						return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
 					}
 					if *success && mode == ModifyFirstMode {
 						return nil
 					}
 				}
 			}
 		}
 		// Then continue recursion to all children
 		switch n := node.(type) {
 		case map[string]interface{}:
 			for k, v := range n {
 				childPath := currentPath + "." + k
 				// Skip keys we've already processed directly
 				if step.Key != "*" && k == step.Key {
 					continue
 				}
 				err := setWithPath(v, steps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		case []interface{}:
 			for i, v := range n {
 				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				err := setWithPath(v, steps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		}
 	case WildcardStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
 		}
 		for k, v := range m {
 			childPath := currentPath + "." + k
 			if isLastStep {
 				m[k] = value
 				*success = true
 				if mode == ModifyFirstMode {
 					return nil
 				}
 			} else {
 				err := setWithPath(v, remainingSteps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		}
 	}
 	return nil
 }
 // traverseWithPaths tracks both nodes and their paths during traversal
 func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
 	if len(steps) == 0 || node == nil {
 		return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
 	}
 	// Skip root step
 	actualSteps := steps
 	if steps[0].Type == RootStep {
 		if len(steps) == 1 {
 			*results = append(*results, JSONNode{Value: node, Path: currentPath})
 			return nil
 		}
 		actualSteps = steps[1:]
 	}
 	// Process the first step
 	step := actualSteps[0]
 	remainingSteps := actualSteps[1:]
 	isLastStep := len(remainingSteps) == 0
 	switch step.Type {
 	case ChildStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node is not a map; actual type: %T", node)
 		}
 		child, exists := m[step.Key]
 		if !exists {
 			return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
 		}
 		childPath := currentPath + "." + step.Key
 		if isLastStep {
 			*results = append(*results, JSONNode{Value: child, Path: childPath})
 		} else {
 			err := traverseWithPaths(child, remainingSteps, results, childPath)
 			if err != nil {
 				return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 			}
 		}
 	case IndexStep:
 		arr, ok := node.([]interface{})
 		if !ok {
 			return fmt.Errorf("node is not an array; actual type: %T", node)
 		}
 		// Handle wildcard index
 		if step.Index == -1 {
 			for i, item := range arr {
 				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				if isLastStep {
 					*results = append(*results, JSONNode{Value: item, Path: itemPath})
 				} else {
 					err := traverseWithPaths(item, remainingSteps, results, itemPath)
 					if err != nil {
 						return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
 					}
 				}
 			}
 			return nil
 		}
 		// Handle specific index
 		if step.Index >= 0 && step.Index < len(arr) {
 			item := arr[step.Index]
 			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
 			if isLastStep {
 				*results = append(*results, JSONNode{Value: item, Path: itemPath})
 			} else {
 				err := traverseWithPaths(item, remainingSteps, results, itemPath)
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
 				}
 			}
 		} else {
 			return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
 		}
 	case RecursiveDescentStep:
 		// For recursive descent, first check direct match at this level
 		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
 			if val, exists := m[step.Key]; exists {
 				directPath := currentPath + "." + step.Key
 				if isLastStep {
 					*results = append(*results, JSONNode{Value: val, Path: directPath})
 				} else {
 					err := traverseWithPaths(val, remainingSteps, results, directPath)
 					if err != nil {
 						return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
 					}
 				}
 			}
 		}
 		// For wildcard, collect this node
 		if step.Key == "*" && isLastStep {
 			*results = append(*results, JSONNode{Value: node, Path: currentPath})
 		}
 		// Then continue recursion to all children
 		switch n := node.(type) {
 		case map[string]interface{}:
 			for k, v := range n {
 				childPath := currentPath + "." + k
 				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		case []interface{}:
 			for i, v := range n {
 				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		}
 	case WildcardStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node is not a map; actual type: %T", node)
 		}
 		for k, v := range m {
 			childPath := currentPath + "." + k
 			if isLastStep {
 				*results = append(*results, JSONNode{Value: v, Path: childPath})
 			} else {
 				err := traverseWithPaths(v, remainingSteps, results, childPath)
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		}
 	}
 	return nil
 }
--- a/processor/jsonpath/jsonpath_get_set_test.go
+++ b/processor/jsonpath/jsonpath_get_set_test.go
@@ -1,577 +0,0 @@
 package jsonpath
 import (
 	"reflect"
 	"testing"
 )
 func TestGetWithPathsBasic(t *testing.T) {
 	tests := []struct {
 		name     string
 		data     map[string]interface{}
 		path     string
 		expected []JSONNode
 		error    bool
 	}{
 		{
 			name: "simple property",
 			data: map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 			path: "$.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.name"},
 			},
 		},
 		{
 			name: "nested property",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"age":  30,
 				},
 			},
 			path: "$.user.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.user.name"},
 			},
 		},
 		{
 			name: "array access",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[1].name",
 			expected: []JSONNode{
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "wildcard",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[*].name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.users[0].name"},
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "recursive descent",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"profile": map[string]interface{}{
 						"email": "john@example.com",
 					},
 				},
 				"admin": map[string]interface{}{
 					"email": "admin@example.com",
 				},
 			},
 			path: "$..email",
 			expected: []JSONNode{
 				{Value: "john@example.com", Path: "$.user.profile.email"},
 				{Value: "admin@example.com", Path: "$.admin.email"},
 			},
 		},
 		{
 			name: "nonexistent path",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 				},
 			},
 			path:     "$.user.email",
 			expected: []JSONNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(tt.data, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("GetWithPaths() returned error: %v", err)
 				}
 				return
 			}
 			// For nonexistent path, we expect empty slice
 			if tt.name == "nonexistent path" {
 				if len(result) > 0 {
 					t.Errorf("GetWithPaths() returned %v, expected empty result", result)
 				}
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For wildcard results, we need to check containment rather than exact order
 			if tt.name == "wildcard" || tt.name == "recursive descent" {
 				// For each expected item, check if it exists in the results by both value and path
 				for _, expected := range tt.expected {
 					found := false
 					for _, r := range result {
 						if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
 							found = true
 							break
 						}
 					}
 					if !found {
 						t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
 					}
 				}
 			} else {
 				// Otherwise check exact equality of both values and paths
 				for i, expected := range tt.expected {
 					if !reflect.DeepEqual(result[i].Value, expected.Value) {
 						t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
 					}
 					if result[i].Path != expected.Path {
 						t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestSet(t *testing.T) {
 	t.Run("simple property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 			"age":  30,
 		}
 		 err := Set(data, "$.name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		if data["name"] != "Jane" {
 			t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
 		}
 	})
 	t.Run("nested property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 		}
 		err := Set(data, "$.user.name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		user, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if user["name"] != "Jane" {
 			t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
 		}
 	})
 	t.Run("array element", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"name": "John", "age": 30},
 				map[string]interface{}{"name": "Jane", "age": 25},
 			},
 		}
 		err := Set(data, "$.users[0].name", "Bob")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		user0, ok := users[0].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if user0["name"] != "Bob" {
 			t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
 		}
 	})
 	t.Run("complex value", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 				"profile": map[string]interface{}{
 					"email": "john@example.com",
 				},
 			},
 		}
 		newProfile := map[string]interface{}{
 			"email": "john.doe@example.com",
 			"phone": "123-456-7890",
 		}
 		err := Set(data, "$.user.profile", newProfile)
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		profile, ok := userMap["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Profile is not a map")
 		}
 		if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
 			t.Errorf("Set() failed: expected profile to be updated with new values")
 		}
 	})
 	t.Run("create new property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		err := Set(data, "$.user.email", "john@example.com")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if email, exists := userMap["email"]; !exists || email != "john@example.com" {
 			t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
 		}
 	})
 	t.Run("create nested properties", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		err := Set(data, "$.user.contact.email", "john@example.com")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		contact, ok := userMap["contact"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Contact is not a map")
 		}
 		if email, exists := contact["email"]; !exists || email != "john@example.com" {
 			t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
 		}
 	})
 	t.Run("create array and element", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		// This should create an empty addresses array, but won't be able to set index 0
 		// since the array is empty
 		err := Set(data, "$.user.addresses[0].street", "123 Main St")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 	})
 	t.Run("multiple targets (should only update first)", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"active": true},
 				map[string]interface{}{"active": true},
 			},
 		}
 		err := Set(data, "$.users[*].active", false)
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		user0, ok := users[0].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User0 is not a map")
 		}
 		user1, ok := users[1].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User1 is not a map")
 		}
 		// Only the first one should be changed
 		if active, exists := user0["active"]; !exists || active != false {
 			t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
 		}
 		// The second one should remain unchanged
 		if active, exists := user1["active"]; !exists || active != true {
 			t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
 		}
 	})
 	t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 		}
 		err := Set(data, "$", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Data should be unchanged
 		if data["name"] != "John" {
 			t.Errorf("Data was modified when setting on root")
 		}
 	})
 }
 func TestSetAll(t *testing.T) {
 	t.Run("simple property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 			"age":  30,
 		}
 		err := SetAll(data, "$.name", "Jane")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		if data["name"] != "Jane" {
 			t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
 		}
 	})
 	t.Run("all array elements", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"active": true},
 				map[string]interface{}{"active": true},
 			},
 		}
 		err := SetAll(data, "$.users[*].active", false)
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		// Both elements should be updated
 		for i, user := range users {
 			userMap, ok := user.(map[string]interface{})
 			if !ok {
 				t.Fatalf("User%d is not a map", i)
 			}
 			if active, exists := userMap["active"]; !exists || active != false {
 				t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
 			}
 		}
 	})
 	t.Run("recursive descent", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"profile": map[string]interface{}{
 					"active": true,
 				},
 			},
 			"admin": map[string]interface{}{
 				"profile": map[string]interface{}{
 					"active": true,
 				},
 			},
 		}
 		err := SetAll(data, "$..active", false)
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Check user profile
 		userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Failed to access user.profile")
 		}
 		if active, exists := userProfile["active"]; !exists || active != false {
 			t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
 		}
 		// Check admin profile
 		adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Failed to access admin.profile")
 		}
 		if active, exists := adminProfile["active"]; !exists || active != false {
 			t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
 		}
 	})
 }
 func TestGetWithPathsExtended(t *testing.T) {
 	tests := []struct {
 		name     string
 		data     map[string]interface{}
 		path     string
 		expected []JSONNode
 	}{
 		{
 			name: "simple property",
 			data: map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 			path: "$.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.name"},
 			},
 		},
 		{
 			name: "nested property",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"age":  30,
 				},
 			},
 			path: "$.user.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.user.name"},
 			},
 		},
 		{
 			name: "array access",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[1].name",
 			expected: []JSONNode{
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "wildcard",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[*].name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.users[0].name"},
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "recursive descent",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"profile": map[string]interface{}{
 						"email": "john@example.com",
 					},
 				},
 				"admin": map[string]interface{}{
 					"email": "admin@example.com",
 				},
 			},
 			path: "$..email",
 			expected: []JSONNode{
 				{Value: "john@example.com", Path: "$.user.profile.email"},
 				{Value: "admin@example.com", Path: "$.admin.email"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(tt.data, tt.path)
 			if err != nil {
 				t.Errorf("GetWithPaths() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// Check if value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Check if path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
--- a/processor/jsonpath/jsonpath_test.go
+++ b/processor/jsonpath/jsonpath_test.go
@@ -1,318 +0,0 @@
 package jsonpath
 import (
 	"reflect"
 	"testing"
 )
 var testData = map[string]interface{}{
 	"store": map[string]interface{}{
 		"book": []interface{}{
 			map[string]interface{}{
 				"title": "The Fellowship of the Ring",
 				"price": 22.99,
 			},
 			map[string]interface{}{
 				"title": "The Two Towers",
 				"price": 23.45,
 			},
 		},
 		"bicycle": map[string]interface{}{
 			"color": "red",
 			"price": 199.95,
 		},
 	},
 }
 func TestParser(t *testing.T) {
 	tests := []struct {
 		path    string
 		steps   []JSONStep
 		wantErr bool
 	}{
 		{
 			path: "$.store.bicycle.color",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "bicycle"},
 				{Type: ChildStep, Key: "color"},
 			},
 		},
 		{
 			path: "$..price",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: RecursiveDescentStep, Key: "price"},
 			},
 		},
 		{
 			path: "$.store.book[*].title",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "book"},
 				{Type: IndexStep, Index: -1}, // Wildcard
 				{Type: ChildStep, Key: "title"},
 			},
 		},
 		{
 			path: "$.store.book[0]",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "book"},
 				{Type: IndexStep, Index: 0},
 			},
 		},
 		{
 			path:    "invalid.path",
 			wantErr: true,
 		},
 		{
 			path:    "$.store.book[abc]",
 			wantErr: true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.path, func(t *testing.T) {
 			steps, err := ParseJSONPath(tt.path)
 			if (err != nil) != tt.wantErr {
 				t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
 			}
 			if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
 				t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
 			}
 		})
 	}
 }
 func TestEvaluator(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []JSONNode
 		error    bool
 	}{
 		{
 			name: "simple_property_access",
 			path: "$.store.bicycle.color",
 			expected: []JSONNode{
 				{Value: "red", Path: "$.store.bicycle.color"},
 			},
 		},
 		{
 			name: "array_index_access",
 			path: "$.store.book[0].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 			},
 		},
 		{
 			name: "wildcard_array_access",
 			path: "$.store.book[*].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 				{Value: "The Two Towers", Path: "$.store.book[1].title"},
 			},
 		},
 		{
 			name: "recursive_price_search",
 			path: "$..price",
 			expected: []JSONNode{
 				{Value: 22.99, Path: "$.store.book[0].price"},
 				{Value: 23.45, Path: "$.store.book[1].price"},
 				{Value: 199.95, Path: "$.store.bicycle.price"},
 			},
 		},
 		{
 			name: "wildcard_recursive",
 			path: "$..*",
 			expected: []JSONNode{
 				// These will be compared by value only, paths will be validated separately
 				{Value: testData["store"].(map[string]interface{})["book"]},
 				{Value: testData["store"].(map[string]interface{})["bicycle"]},
 				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
 				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
 				{Value: "The Fellowship of the Ring"},
 				{Value: 22.99},
 				{Value: "The Two Towers"},
 				{Value: 23.45},
 				{Value: "red"},
 				{Value: 199.95},
 			},
 		},
 		{
 			name:     "invalid_index",
 			path:     "$.store.book[5]",
 			expected: []JSONNode{},
 			error:    true,
 		},
 		{
 			name:     "nonexistent_property",
 			path:     "$.store.nonexistent",
 			expected: []JSONNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			// Use GetWithPaths directly
 			result, err := Get(testData, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("Get() returned error: %v", err)
 				}
 				return
 			}
 			// Special handling for wildcard recursive test
 			if tt.name == "wildcard_recursive" {
 				// Skip length check for wildcard recursive since it might vary
 				// Just verify that each expected item is in the results
 				// Validate values match and paths are filled in
 				for _, e := range tt.expected {
 					found := false
 					for _, r := range result {
 						if reflect.DeepEqual(r.Value, e.Value) {
 							found = true
 							break
 						}
 					}
 					if !found {
 						t.Errorf("Expected value %v not found in results", e.Value)
 					}
 				}
 				return
 			}
 			if len(result) != len(tt.expected) {
 				t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
 			}
 			// Validate both values and paths
 			for i, e := range tt.expected {
 				if i < len(result) {
 					if !reflect.DeepEqual(result[i].Value, e.Value) {
 						t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
 					}
 					if result[i].Path != e.Path {
 						t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestEdgeCases(t *testing.T) {
 	t.Run("empty_data", func(t *testing.T) {
 		result, err := Get(nil, "$.a.b")
 		if err == nil {
 			t.Errorf("Expected error for empty data")
 			return
 		}
 		if len(result) > 0 {
 			t.Errorf("Expected empty result, got %v", result)
 		}
 	})
 	t.Run("empty_path", func(t *testing.T) {
 		_, err := ParseJSONPath("")
 		if err == nil {
 			t.Error("Expected error for empty path")
 		}
 	})
 	t.Run("numeric_keys", func(t *testing.T) {
 		data := map[string]interface{}{
 			"42": "answer",
 		}
 		result, err := Get(data, "$.42")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) == 0 || result[0].Value != "answer" {
 			t.Errorf("Expected 'answer', got %v", result)
 		}
 	})
 }
 func TestGetWithPaths(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []JSONNode
 	}{
 		{
 			name: "simple_property_access",
 			path: "$.store.bicycle.color",
 			expected: []JSONNode{
 				{Value: "red", Path: "$.store.bicycle.color"},
 			},
 		},
 		{
 			name: "array_index_access",
 			path: "$.store.book[0].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 			},
 		},
 		{
 			name: "wildcard_array_access",
 			path: "$.store.book[*].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 				{Value: "The Two Towers", Path: "$.store.book[1].title"},
 			},
 		},
 		{
 			name: "recursive_price_search",
 			path: "$..price",
 			expected: []JSONNode{
 				{Value: 22.99, Path: "$.store.book[0].price"},
 				{Value: 23.45, Path: "$.store.book[1].price"},
 				{Value: 199.95, Path: "$.store.bicycle.price"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(testData, tt.path)
 			if err != nil {
 				t.Errorf("Get() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// First verify the value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Then verify the path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
--- a/processor/processor.go
+++ b/processor/processor.go
@@ -5,87 +5,103 @@ import (
 	"strings"
 	lua "github.com/yuin/gopher-lua"
 	"modify/logger"
 )
-// Processor defines the interface for all file processors
+// Maybe we make this an interface again for the shits and giggles
-type Processor interface {
+// We will see, it could easily be...
 	// Process handles processing a file with the given pattern and Lua expression
 	Process(filename string, pattern string, luaExpr string) (int, int, error)
 	// ProcessContent handles processing a string content directly with the given pattern and Lua expression
 	// Returns the modified content, modification count, match count, and any error
 	ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
 	// ToLua converts processor-specific data to Lua variables
 	ToLua(L *lua.LState, data interface{}) error
 	// FromLua retrieves modified data from Lua
 	FromLua(L *lua.LState) (interface{}, error)
 }
 // ModificationRecord tracks a single value modification
 type ModificationRecord struct {
 	File      string
 	OldValue  string
 	NewValue  string
 	Operation string
 	Context   string
 }
 func NewLuaState() (*lua.LState, error) {
 	L := lua.NewState()
 	// defer L.Close()
 	// Load math library
 	logger.Debug("Loading Lua math library")
 	L.Push(L.GetGlobal("require"))
 	L.Push(lua.LString("math"))
 	if err := L.PCall(1, 1, nil); err != nil {
 		logger.Error("Failed to load Lua math library: %v", err)
 		return nil, fmt.Errorf("error loading Lua math library: %v", err)
 	}
 	// Initialize helper functions
 	logger.Debug("Initializing Lua helper functions")
 	if err := InitLuaHelpers(L); err != nil {
 		logger.Error("Failed to initialize Lua helper functions: %v", err)
 		return nil, err
 	}
 	return L, nil
 }
-// ToLua converts a struct or map to a Lua table recursively
+// func Process(filename string, pattern string, luaExpr string) (int, int, error) {
-func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
+// 	logger.Debug("Processing file %q with pattern %q", filename, pattern)
-	switch v := data.(type) {
+//
-	case map[string]interface{}:
+// 	// Read file content
-		luaTable := L.NewTable()
+// 	cwd, err := os.Getwd()
-		for key, value := range v {
+// 	if err != nil {
-			luaValue, err := ToLua(L, value)
+// 		logger.Error("Failed to get current working directory: %v", err)
-			if err != nil {
+// 		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
-				return nil, err
+// 	}
-			}
+//
-			luaTable.RawSetString(key, luaValue)
+// 	fullPath := filepath.Join(cwd, filename)
-		}
+// 	logger.Trace("Reading file from: %s", fullPath)
-		return luaTable, nil
+//
-	case []interface{}:
+// 	stat, err := os.Stat(fullPath)
-		luaTable := L.NewTable()
+// 	if err != nil {
-		for i, value := range v {
+// 		logger.Error("Failed to stat file %s: %v", fullPath, err)
-			luaValue, err := ToLua(L, value)
+// 		return 0, 0, fmt.Errorf("error getting file info: %v", err)
-			if err != nil {
+// 	}
-				return nil, err
+// 	logger.Debug("File size: %d bytes, modified: %s", stat.Size(), stat.ModTime().Format(time.RFC3339))
-			}
+//
-			luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
+// 	content, err := os.ReadFile(fullPath)
-		}
+// 	if err != nil {
-		return luaTable, nil
+// 		logger.Error("Failed to read file %s: %v", fullPath, err)
-	case string:
+// 		return 0, 0, fmt.Errorf("error reading file: %v", err)
-		return lua.LString(v), nil
+// 	}
-	case bool:
+//
-		return lua.LBool(v), nil
+// 	fileContent := string(content)
-	case float64:
+// 	logger.Trace("File read successfully: %d bytes, hash: %x", len(content), md5sum(content))
-		return lua.LNumber(v), nil
+//
-	case nil:
+// 	// Detect and log file type
-		return lua.LNil, nil
+// 	fileType := detectFileType(filename, fileContent)
-	default:
+// 	if fileType != "" {
-		return nil, fmt.Errorf("unsupported data type: %T", data)
+// 		logger.Debug("Detected file type: %s", fileType)
-	}
+// 	}
-}
+//
 // 	// Process the content
 // 	logger.Debug("Starting content processing")
 // 	modifiedContent, modCount, matchCount, err := ProcessContent(fileContent, pattern, luaExpr)
 // 	if err != nil {
 // 		logger.Error("Processing error: %v", err)
 // 		return 0, 0, err
 // 	}
 //
 // 	logger.Debug("Processing results: %d matches, %d modifications", matchCount, modCount)
 //
 // 	// If we made modifications, save the file
 // 	if modCount > 0 {
 // 		// Calculate changes summary
 // 		changePercent := float64(len(modifiedContent)) / float64(len(fileContent)) * 100
 // 		logger.Info("File size change: %d → %d bytes (%.1f%%)",
 // 			len(fileContent), len(modifiedContent), changePercent)
 //
 // 		logger.Debug("Writing modified content to %s", fullPath)
 // 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
 // 		if err != nil {
 // 			logger.Error("Failed to write to file %s: %v", fullPath, err)
 // 			return 0, 0, fmt.Errorf("error writing file: %v", err)
 // 		}
 // 		logger.Debug("File written successfully, new hash: %x", md5sum([]byte(modifiedContent)))
 // 	} else if matchCount > 0 {
 // 		logger.Debug("No content modifications needed for %d matches", matchCount)
 // 	} else {
 // 		logger.Debug("No matches found in file")
 // 	}
 //
 // 	return modCount, matchCount, nil
 // }
 // FromLua converts a Lua table to a struct or map recursively
 func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
@@ -127,25 +143,28 @@ func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
 }
 func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
 	logger.Trace("Checking if Lua table is an array")
 	L.SetGlobal("table_to_check", v)
 	// Use our predefined helper function from InitLuaHelpers
 	err := L.DoString(`is_array = isArray(table_to_check)`)
 	if err != nil {
 		logger.Error("Error determining if table is an array: %v", err)
 		return false, fmt.Errorf("error determining if table is array: %w", err)
 	}
 	// Check the result of our Lua function
 	isArray := L.GetGlobal("is_array")
 	// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
-	if !lua.LVIsFalse(isArray) {
+	result := !lua.LVIsFalse(isArray)
-		return true, nil
+	logger.Trace("Lua table is array: %v", result)
-	}
+	return result, nil
 	return false, nil
 }
 // InitLuaHelpers initializes common Lua helper functions
 func InitLuaHelpers(L *lua.LState) error {
 	logger.Debug("Loading Lua helper functions")
 	helperScript := `
 -- Custom Lua helpers for math operations
 function min(a, b) return math.min(a, b) end
@@ -158,6 +177,39 @@ function floor(x) return math.floor(x) end
 function ceil(x) return math.ceil(x) end
 function upper(s) return string.upper(s) end
 function lower(s) return string.lower(s) end
 function format(s, ...) return string.format(s, ...) end
 -- String split helper
 function strsplit(inputstr, sep)
  if sep == nil then
    sep = "%s"
  end
  local t = {}
  for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
    table.insert(t, str)
  end
  return t
 end
 ---@param table table
 ---@param depth number?
 function DumpTable(table, depth)
 	if depth == nil then
 		depth = 0
 	end
 	if (depth > 200) then
 		print("Error: Depth > 200 in dumpTable()")
 		return
 	end
 	for k, v in pairs(table) do
 		if (type(v) == "table") then
 			print(string.rep("  ", depth) .. k .. ":")
 			DumpTable(v, depth + 1)
 		else
 			print(string.rep("  ", depth) .. k .. ": ", v)
 		end
 	end
 end
 -- String to number conversion helper
 function num(str)
@@ -191,13 +243,15 @@ end
 modified = false
 `
 	if err := L.DoString(helperScript); err != nil {
 		logger.Error("Failed to load Lua helper functions: %v", err)
 		return fmt.Errorf("error loading helper functions: %v", err)
 	}
 	logger.Debug("Setting up Lua print function to Go")
 	L.SetGlobal("print", L.NewFunction(printToGo))
 	return nil
 }
 // Helper utility functions
 // LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	s = strings.ReplaceAll(s, "\n", "\\n")
@@ -230,6 +284,8 @@ func PrependLuaAssignment(luaExpr string) string {
 // BuildLuaScript prepares a Lua expression from shorthand notation
 func BuildLuaScript(luaExpr string) string {
 	logger.Debug("Building Lua script from expression: %s", luaExpr)
 	luaExpr = PrependLuaAssignment(luaExpr)
 	// This allows the user to specify whether or not they modified a value
@@ -249,18 +305,22 @@ func BuildLuaScript(luaExpr string) string {
 	return fullScript
 }
-// Max returns the maximum of two integers
+func printToGo(L *lua.LState) int {
-func Max(a, b int) int {
+	top := L.GetTop()
 	if a > b {
 		return a
 	}
 	return b
 }
-// Min returns the minimum of two integers
+	args := make([]interface{}, top)
-func Min(a, b int) int {
+	for i := 1; i <= top; i++ {
-	if a < b {
+		args[i-1] = L.Get(i)
 		return a
 	}
-	return b
+
 	// Format the message with proper spacing between arguments
 	var parts []string
 	for _, arg := range args {
 		parts = append(parts, fmt.Sprintf("%v", arg))
 	}
 	message := strings.Join(parts, " ")
 	// Use the LUA log level with a script tag
 	logger.Lua("%s", message)
 	return 0
 }
--- a/processor/regex.go
+++ b/processor/regex.go
@@ -2,133 +2,89 @@ package processor
 import (
 	"fmt"
 	"os"
 	"path/filepath"
 	"regexp"
 	"strconv"
 	"strings"
 	"time"
 	lua "github.com/yuin/gopher-lua"
 	"modify/logger"
 	"modify/utils"
 )
-// RegexProcessor implements the Processor interface using regex patterns
+type CaptureGroup struct {
-type RegexProcessor struct{}
+	Name    string
-
+	Value   string
-// Process implements the Processor interface for RegexProcessor
+	Updated string
-func (p *RegexProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
+	Range   [2]int
 	// Read file content
 	fullPath := filepath.Join(".", filename)
 	content, err := os.ReadFile(fullPath)
 	if err != nil {
 		return 0, 0, fmt.Errorf("error reading file: %v", err)
 	}
 	fileContent := string(content)
 	// Process the content
 	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
 	if err != nil {
 		return 0, 0, err
 	}
 	// If we made modifications, save the file
 	if modCount > 0 {
 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
 		if err != nil {
 			return 0, 0, fmt.Errorf("error writing file: %v", err)
 		}
 	}
 	return modCount, matchCount, nil
 }
 // ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
 func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
 	captures, ok := data.([]string)
 	if !ok {
 		return fmt.Errorf("expected []string for captures, got %T", data)
 	}
 	// Set variables for each capture group, starting from v1/s1 for the first capture
 	for i := 0; i < len(captures); i++ {
 		// Set string version (always available as s1, s2, etc.)
 		L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
 		// Try to convert to number and set v1, v2, etc.
 		if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
 			L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
 		}
 	}
 	return nil
 }
 // FromLua implements the Processor interface for RegexProcessor
 func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	// Get the modified values after Lua execution
 	modifications := make(map[int]string)
 	// Check for modifications to v1-v12 and s1-s12
 	for i := 0; i < 12; i++ {
 		// Check both v and s variables to see if any were modified
 		vVarName := fmt.Sprintf("v%d", i+1)
 		sVarName := fmt.Sprintf("s%d", i+1)
 		vLuaVal := L.GetGlobal(vVarName)
 		sLuaVal := L.GetGlobal(sVarName)
 		// If our value is a number then it's very likely we want it to be a number
 		// And not a string
 		// If we do want it to be a string we will cast it into a string in lua
 		// wait that wouldn't work... Casting v to a string would not load it here
 		if vLuaVal.Type() == lua.LTNumber {
 			modifications[i] = vLuaVal.String()
 			continue
 		}
 		if sLuaVal.Type() == lua.LTString {
 			modifications[i] = sLuaVal.String()
 			continue
 		}
 	}
 	return modifications, nil
 }
 // ProcessContent applies regex replacement with Lua processing
-func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
+func ProcessRegex(content string, command utils.ModifyCommand) ([]utils.ReplaceCommand, error) {
-	// Handle special pattern modifications
+	var commands []utils.ReplaceCommand
-	if !strings.HasPrefix(pattern, "(?s)") {
+	logger.Trace("Processing regex: %q", command.Regex)
 		pattern = "(?s)" + pattern
 	}
 	// Start timing the regex processing
 	startTime := time.Now()
 	// We don't HAVE to do this multiple times for a pattern
 	// But it's quick enough for us to not care
 	pattern := resolveRegexPlaceholders(command.Regex)
 	logger.Debug("Compiling regex pattern: %s", pattern)
 	patternCompileStart := time.Now()
 	compiledPattern, err := regexp.Compile(pattern)
 	if err != nil {
-		return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
+		logger.Error("Error compiling pattern: %v", err)
 		return commands, fmt.Errorf("error compiling pattern: %v", err)
 	}
 	logger.Debug("Compiled pattern successfully in %v: %s", time.Since(patternCompileStart), pattern)
-	previous := luaExpr
+	// Same here, it's just string concatenation, it won't kill us
-	luaExpr = BuildLuaScript(luaExpr)
+	// More important is that we don't fuck up the command
-	fmt.Printf("Changing Lua expression from: %s to: %s\n", previous, luaExpr)
+	// But we shouldn't be able to since it's passed by value
-
+	previous := command.Lua
-	L, err := NewLuaState()
+	luaExpr := BuildLuaScript(command.Lua)
-	if err != nil {
+	logger.Debug("Transformed Lua expression: %q → %q", previous, luaExpr)
 		return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
 	}
 	defer L.Close()
 	// Initialize Lua environment
 	modificationCount := 0
 	// Process all regex matches
-	result := content
+	matchFindStart := time.Now()
 	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
 	matchFindDuration := time.Since(matchFindStart)
 	logger.Debug("Found %d matches in content of length %d (search took %v)",
 		len(indices), len(content), matchFindDuration)
 	// Log pattern complexity metrics
 	patternComplexity := estimatePatternComplexity(pattern)
 	logger.Debug("Pattern complexity estimate: %d", patternComplexity)
 	if len(indices) == 0 {
 		logger.Warning("No matches found for regex: %q", pattern)
 		logger.Debug("Total regex processing time: %v", time.Since(startTime))
 		return commands, nil
 	}
 	// We walk backwards because we're replacing something with something else that might be longer
 	// And in the case it is longer than the original all indicces past that change will be fucked up
 	// By going backwards we fuck up all the indices to the end of the file that we don't care about
 	// Because there either aren't any (last match) or they're already modified (subsequent matches)
-	for i := len(indices) - 1; i >= 0; i-- {
+	for i, matchIndices := range indices {
-		matchIndices := indices[i]
+		logger.Debug("Processing match %d of %d", i+1, len(indices))
 		logger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
 		L, err := NewLuaState()
 		if err != nil {
 			logger.Error("Error creating Lua state: %v", err)
 			return commands, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		// Hmm... Maybe we don't want to defer this..
 		// Maybe we want to close them every iteration
 		// We'll leave it as is for now
 		defer L.Close()
 		logger.Trace("Lua state created successfully for match %d", i+1)
 		// Why we're doing this whole song and dance of indices is to properly handle empty matches
 		// Plus it's a little cleaner to surgically replace our matches
 		// If we were to use string.replace and encountered an empty match there'd be nothing to replace
@@ -137,60 +93,290 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
 		// As if concatenating in the middle of the array
 		// Plus it supports lookarounds
 		match := content[matchIndices[0]:matchIndices[1]]
 		matchPreview := match
 		if len(match) > 50 {
 			matchPreview = match[:47] + "..."
 		}
 		logger.Trace("Matched content: %q (length: %d)", matchPreview, len(match))
 		groups := matchIndices[2:]
 		if len(groups) <= 0 {
-			fmt.Println("No capture groups for lua to chew on")
+			logger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
 			continue
 		}
 		if len(groups)%2 == 1 {
-			fmt.Println("Odd number of indices of groups, what the fuck?")
+			logger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
 			continue
 		}
-		captures := make([]string, 0, len(groups)/2)
+		// Count how many valid groups we have
 		validGroups := 0
 		for j := 0; j < len(groups); j += 2 {
-			captures = append(captures, content[groups[j]:groups[j+1]])
+			if groups[j] != -1 && groups[j+1] != -1 {
 				validGroups++
 			}
 		}
 		logger.Debug("Found %d valid capture groups in match", validGroups)
 		for _, index := range groups {
 			if index == -1 {
 				logger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
 				continue
 			}
 		}
-		if err := p.ToLua(L, captures); err != nil {
+		// We have to use array to preserve order
-			fmt.Println("Error setting Lua variables:", err)
+		// Very important for the reconstruction step
 		// Because we must overwrite the values in reverse order
 		// See comments a few dozen lines above for more details
 		captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
 		groupNames := compiledPattern.SubexpNames()[1:]
 		for i, name := range groupNames {
 			start := groups[i*2]
 			end := groups[i*2+1]
 			if start == -1 || end == -1 {
 				continue
 			}
 			value := content[start:end]
 			captureGroups = append(captureGroups, &CaptureGroup{
 				Name:  name,
 				Value: value,
 				Range: [2]int{start, end},
 			})
 			// Include name info in log if available
 			if name != "" {
 				logger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
 			} else {
 				logger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
 			}
 		}
 		captureGroups = deduplicateGroups(captureGroups)
 		if err := toLua(L, captureGroups); err != nil {
 			logger.Error("Failed to set Lua variables: %v", err)
 			continue
 		}
 		logger.Trace("Set %d capture groups as Lua variables", len(captureGroups))
 		if err := L.DoString(luaExpr); err != nil {
-			fmt.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
+			logger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
 				err, luaExpr, captureGroups)
 			continue
 		}
 		logger.Trace("Lua script executed successfully")
 		// Get modifications from Lua
-		modResult, err := p.FromLua(L)
+		captureGroups, err = fromLua(L, captureGroups)
 		if err != nil {
-			fmt.Println("Error getting modifications:", err)
+			logger.Error("Failed to retrieve modifications from Lua: %v", err)
 			continue
 		}
 		logger.Trace("Retrieved updated values from Lua")
 		replacement := ""
 		replacementVar := L.GetGlobal("replacement")
 		if replacementVar.Type() != lua.LTNil {
 			replacement = replacementVar.String()
 			logger.Debug("Using global replacement: %q", replacement)
 		}
 		// Check if modification flag is set
 		modifiedVal := L.GetGlobal("modified")
 		if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
 			logger.Debug("Skipping match - no modifications made by Lua script")
 			continue
 		}
-		// Apply modifications to the matched text
+		if replacement == "" {
-		modsMap, ok := modResult.(map[int]string)
+			// Apply the modifications to the original match
-		if !ok || len(modsMap) == 0 {
+			replacement = match
 			fmt.Println("No modifications to apply")
 			continue
 		}
-		// Apply the modifications to the original match
+			// Count groups that were actually modified
-		replacement := match
+			modifiedGroups := 0
-		for i := len(modsMap) - 1; i >= 0; i-- {
+			for _, capture := range captureGroups {
-			newVal := modsMap[i]
+				if capture.Value != capture.Updated {
-			// Indices of the group are relative to content
+					modifiedGroups++
-			// To relate them to match we have to subtract the match start index
+				}
-			groupStart := groups[i*2] - matchIndices[0]
+			}
-			groupEnd := groups[i*2+1] - matchIndices[0]
+			logger.Info("%d of %d capture groups identified for modification", modifiedGroups, len(captureGroups))
 			replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 		}
-		modificationCount++
+			for _, capture := range captureGroups {
-		result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
+				if capture.Value == capture.Updated {
 					logger.Info("Capture group unchanged: %s", capture.Value)
 					continue
 				}
 				// Log what changed with context
 				logger.Debug("Capture group %s scheduled for modification: %q → %q",
 					capture.Name, capture.Value, capture.Updated)
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
 				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 				commands = append(commands, utils.ReplaceCommand{
 					From: capture.Range[0],
 					To:   capture.Range[1],
 					With: capture.Updated,
 				})
 			}
 		} else {
 			commands = append(commands, utils.ReplaceCommand{
 				From: matchIndices[0],
 				To:   matchIndices[1],
 				With: replacement,
 			})
 		}
 	}
-	return result, modificationCount, len(indices), nil
+	logger.Debug("Total regex processing time: %v", time.Since(startTime))
 	return commands, nil
 }
 func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
 	deduplicatedGroups := make([]*CaptureGroup, 0)
 	for _, group := range captureGroups {
 		overlaps := false
 		logger.Debug("Checking capture group: %s with range %v", group.Name, group.Range)
 		for _, existingGroup := range deduplicatedGroups {
 			logger.Debug("Comparing with existing group: %s with range %v", existingGroup.Name, existingGroup.Range)
 			if group.Range[0] < existingGroup.Range[1] && group.Range[1] > existingGroup.Range[0] {
 				overlaps = true
 				logger.Warning("Detected overlap between capture group '%s' and existing group '%s' in range %v-%v and %v-%v", group.Name, existingGroup.Name, group.Range[0], group.Range[1], existingGroup.Range[0], existingGroup.Range[1])
 				break
 			}
 		}
 		if overlaps {
 			// We CAN just continue despite this fuckup
 			logger.Error("Overlapping capture group: %s", group.Name)
 			continue
 		}
 		logger.Debug("No overlap detected for capture group: %s. Adding to deduplicated groups.", group.Name)
 		deduplicatedGroups = append(deduplicatedGroups, group)
 	}
 	return deduplicatedGroups
 }
 // The order of these replaces is important
 // This one handles !num-s inside of named capture groups
 // If it were not here our !num in a named capture group would
 // Expand to another capture group in the capture group
 // We really only want one (our named) capture group
 func resolveRegexPlaceholders(pattern string) string {
 	// Handle special pattern modifications
 	if !strings.HasPrefix(pattern, "(?s)") {
 		pattern = "(?s)" + pattern
 		// Use fmt.Printf for test compatibility
 		fmt.Printf("Pattern modified to include (?s): %s\n", pattern)
 	}
 	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
 	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
 		parts := namedGroupNum.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			return match
 		}
 		replacement := `-?\d*\.?\d+`
 		return parts[1] + replacement
 	})
 	pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
 	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
 	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
 	// !rep(pattern, count) repeats the pattern n times
 	// Inserting !any between each repetition
 	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
 		parts := repPattern.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			return match
 		}
 		repeatedPattern := parts[1]
 		count := parts[2]
 		repetitions, _ := strconv.Atoi(count)
 		return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
 	})
 	return pattern
 }
 // ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
 func toLua(L *lua.LState, data interface{}) error {
 	captureGroups, ok := data.([]*CaptureGroup)
 	if !ok {
 		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
 	}
 	groupindex := 0
 	for _, capture := range captureGroups {
 		if capture.Name == "" {
 			// We don't want to change the name of the capture group
 			// Even if it's empty
 			tempName := fmt.Sprintf("%d", groupindex+1)
 			groupindex++
 			L.SetGlobal("s"+tempName, lua.LString(capture.Value))
 			val, err := strconv.ParseFloat(capture.Value, 64)
 			if err == nil {
 				L.SetGlobal("v"+tempName, lua.LNumber(val))
 			}
 		} else {
 			val, err := strconv.ParseFloat(capture.Value, 64)
 			if err == nil {
 				L.SetGlobal(capture.Name, lua.LNumber(val))
 			} else {
 				L.SetGlobal(capture.Name, lua.LString(capture.Value))
 			}
 		}
 	}
 	return nil
 }
 // FromLua implements the Processor interface for RegexProcessor
 func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
 	captureIndex := 0
 	for _, capture := range captureGroups {
 		if capture.Name == "" {
 			capture.Name = fmt.Sprintf("%d", captureIndex+1)
 			vVarName := fmt.Sprintf("v%s", capture.Name)
 			sVarName := fmt.Sprintf("s%s", capture.Name)
 			captureIndex++
 			vLuaVal := L.GetGlobal(vVarName)
 			sLuaVal := L.GetGlobal(sVarName)
 			if sLuaVal.Type() == lua.LTString {
 				capture.Updated = sLuaVal.String()
 			}
 			// Numbers have priority
 			if vLuaVal.Type() == lua.LTNumber {
 				capture.Updated = vLuaVal.String()
 			}
 		} else {
 			// Easy shit
 			capture.Updated = L.GetGlobal(capture.Name).String()
 		}
 	}
 	return captureGroups, nil
 }
 // estimatePatternComplexity gives a rough estimate of regex pattern complexity
 // This can help identify potentially problematic patterns
 func estimatePatternComplexity(pattern string) int {
 	complexity := len(pattern)
 	// Add complexity for potentially expensive operations
 	complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
 	complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
 	complexity += strings.Count(pattern, "[^") * 3  // Negated character class
 	complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
 	complexity += strings.Count(pattern, "(") * 2   // Capture groups
 	complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
 	complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
 	complexity += strings.Count(pattern, "{") * 2   // Counted repetition
 	return complexity
 }
--- a/processor/regex_test.go
+++ b/processor/regex_test.go
--- a/processor/test_helper.go
+++ b/processor/test_helper.go
@@ -0,0 +1,26 @@
 package processor
 import (
 	"io"
 	"modify/logger"
 	"os"
 )
 func init() {
 	// Only modify logger in test mode
 	// This checks if we're running under 'go test'
 	if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
 		// Initialize logger with ERROR level for tests
 		// to minimize noise in test output
 		logger.Init(logger.LevelError)
 		// Optionally redirect logger output to discard
 		// This prevents logger output from interfering with test output
 		disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
 		if disableTestLogs {
 			// Create a new logger that writes to nowhere
 			silentLogger := logger.New(io.Discard, "", 0)
 			logger.DefaultLogger = silentLogger
 		}
 	}
 }
--- a/processor/xml.go
+++ b/processor/xml.go
@@ -1,217 +0,0 @@
 package processor
 import (
 	"fmt"
 	"os"
 	"path/filepath"
 	"strings"
 	"github.com/antchfx/xmlquery"
 	lua "github.com/yuin/gopher-lua"
 )
 // XMLProcessor implements the Processor interface for XML documents
 type XMLProcessor struct{}
 // Process implements the Processor interface for XMLProcessor
 func (p *XMLProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
 	// Read file content
 	fullPath := filepath.Join(".", filename)
 	content, err := os.ReadFile(fullPath)
 	if err != nil {
 		return 0, 0, fmt.Errorf("error reading file: %v", err)
 	}
 	fileContent := string(content)
 	// Process the content
 	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
 	if err != nil {
 		return 0, 0, err
 	}
 	// If we made modifications, save the file
 	if modCount > 0 {
 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
 		if err != nil {
 			return 0, 0, fmt.Errorf("error writing file: %v", err)
 		}
 	}
 	return modCount, matchCount, nil
 }
 // ProcessContent implements the Processor interface for XMLProcessor
 func (p *XMLProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
 	// Parse XML document
 	doc, err := xmlquery.Parse(strings.NewReader(content))
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
 	}
 	// Find nodes matching the XPath pattern
 	nodes, err := xmlquery.QueryAll(doc, pattern)
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
 	}
 	matchCount := len(nodes)
 	if matchCount == 0 {
 		return content, 0, 0, nil
 	}
 	// Initialize Lua
 	L := lua.NewState()
 	defer L.Close()
 	// Load math library
 	L.Push(L.GetGlobal("require"))
 	L.Push(lua.LString("math"))
 	if err := L.PCall(1, 1, nil); err != nil {
 		return content, 0, 0, fmt.Errorf("error loading Lua math library: %v", err)
 	}
 	// Load helper functions
 	if err := InitLuaHelpers(L); err != nil {
 		return content, 0, 0, err
 	}
 	// Apply modifications to each node
 	modCount := 0
 	for _, node := range nodes {
 		// Reset Lua state for each node
 		L.SetGlobal("v1", lua.LNil)
 		L.SetGlobal("s1", lua.LNil)
 		// Get the node value
 		var originalValue string
 		if node.Type == xmlquery.AttributeNode {
 			originalValue = node.InnerText()
 		} else if node.Type == xmlquery.TextNode {
 			originalValue = node.Data
 		} else {
 			originalValue = node.InnerText()
 		}
 		// Convert to Lua variables
 		err = p.ToLua(L, originalValue)
 		if err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
 		}
 		// Execute Lua script
 		if err := L.DoString(luaExpr); err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
 		}
 		// Get modified value
 		result, err := p.FromLua(L)
 		if err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
 		}
 		newValue, ok := result.(string)
 		if !ok {
 			return content, modCount, matchCount, fmt.Errorf("expected string result from Lua, got %T", result)
 		}
 		// Skip if no change
 		if newValue == originalValue {
 			continue
 		}
 		// Apply modification
 		if node.Type == xmlquery.AttributeNode {
 			// For attribute nodes, update the attribute value
 			node.Parent.Attr = append([]xmlquery.Attr{}, node.Parent.Attr...)
 			for i, attr := range node.Parent.Attr {
 				if attr.Name.Local == node.Data {
 					node.Parent.Attr[i].Value = newValue
 					break
 				}
 			}
 		} else if node.Type == xmlquery.TextNode {
 			// For text nodes, update the text content
 			node.Data = newValue
 		} else {
 			// For element nodes, replace inner text
 			// Simple approach: set the InnerText directly if there are no child elements
 			if node.FirstChild == nil || (node.FirstChild != nil && node.FirstChild.Type == xmlquery.TextNode && node.FirstChild.NextSibling == nil) {
 				if node.FirstChild != nil {
 					node.FirstChild.Data = newValue
 				} else {
 					// Create a new text node and add it as the first child
 					textNode := &xmlquery.Node{
 						Type: xmlquery.TextNode,
 						Data: newValue,
 					}
 					node.FirstChild = textNode
 				}
 			} else {
 				// Complex case: node has mixed content or child elements
 				// Replace just the text content while preserving child elements
 				// This is a simplified approach - more complex XML may need more robust handling
 				for child := node.FirstChild; child != nil; child = child.NextSibling {
 					if child.Type == xmlquery.TextNode {
 						child.Data = newValue
 						break // Update only the first text node
 					}
 				}
 			}
 		}
 		modCount++
 	}
 	// Serialize the modified XML document to string
 	if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
 		// If we have an XML declaration, start with it
 		declaration := doc.FirstChild.OutputXML(true)
 		// Remove the firstChild (declaration) before serializing the rest of the document
 		doc.FirstChild = doc.FirstChild.NextSibling
 		return declaration + doc.OutputXML(true), modCount, matchCount, nil
 	}
 	return doc.OutputXML(true), modCount, matchCount, nil
 }
 // ToLua converts XML node values to Lua variables
 func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
 	value, ok := data.(string)
 	if !ok {
 		return fmt.Errorf("expected string value, got %T", data)
 	}
 	// Set as string variable
 	L.SetGlobal("s1", lua.LString(value))
 	// Try to convert to number if possible
 	L.SetGlobal("v1", lua.LNumber(0)) // Default to 0
 	if err := L.DoString(fmt.Sprintf("v1 = tonumber(%q) or 0", value)); err != nil {
 		return fmt.Errorf("error converting value to number: %v", err)
 	}
 	return nil
 }
 // FromLua gets modified values from Lua
 func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	// Check if string variable was modified
 	s1 := L.GetGlobal("s1")
 	if s1 != lua.LNil {
 		if s1Str, ok := s1.(lua.LString); ok {
 			return string(s1Str), nil
 		}
 	}
 	// Check if numeric variable was modified
 	v1 := L.GetGlobal("v1")
 	if v1 != lua.LNil {
 		if v1Num, ok := v1.(lua.LNumber); ok {
 			return fmt.Sprintf("%v", v1Num), nil
 		}
 	}
 	// Default return empty string
 	return "", nil
 }
--- a/processor/xml_test.go
+++ b/processor/xml_test.go
--- a/processor/xpath/xpath.go
+++ b/processor/xpath/xpath.go
@@ -1,98 +0,0 @@
 package xpath
 import "errors"
 // XPathStep represents a single step in an XPath expression
 type XPathStep struct {
 	Type      StepType
 	Name      string
 	Predicate *Predicate
 }
 // StepType defines the type of XPath step
 type StepType int
 const (
 	// RootStep represents the root step (/)
 	RootStep StepType = iota
 	// ChildStep represents a child element step (element)
 	ChildStep
 	// RecursiveDescentStep represents a recursive descent step (//)
 	RecursiveDescentStep
 	// WildcardStep represents a wildcard step (*)
 	WildcardStep
 	// PredicateStep represents a predicate condition step ([...])
 	PredicateStep
 )
 // PredicateType defines the type of XPath predicate
 type PredicateType int
 const (
 	// IndexPredicate represents an index predicate [n]
 	IndexPredicate PredicateType = iota
 	// LastPredicate represents a last() function predicate
 	LastPredicate
 	// LastMinusPredicate represents a last()-n predicate
 	LastMinusPredicate
 	// PositionPredicate represents position()-based predicates
 	PositionPredicate
 	// AttributeExistsPredicate represents [@attr] predicate
 	AttributeExistsPredicate
 	// AttributeEqualsPredicate represents [@attr='value'] predicate
 	AttributeEqualsPredicate
 	// ComparisonPredicate represents element comparison predicates
 	ComparisonPredicate
 )
 // Predicate represents a condition in XPath
 type Predicate struct {
 	Type       PredicateType
 	Index      int
 	Offset     int
 	Attribute  string
 	Value      string
 	Expression string
 }
 // XMLNode represents a node in the result set with its value and path
 type XMLNode struct {
 	Value interface{}
 	Path  string
 }
 // ParseXPath parses an XPath expression into a series of steps
 func ParseXPath(path string) ([]XPathStep, error) {
 	if path == "" {
 		return nil, errors.New("empty path")
 	}
 	// This is just a placeholder implementation for the tests
 	// The actual implementation would parse the XPath expression
 	return nil, errors.New("not implemented")
 }
 // Get retrieves nodes from XML data using an XPath expression
 func Get(data interface{}, path string) ([]XMLNode, error) {
 	if data == "" {
 		return nil, errors.New("empty XML data")
 	}
 	// This is just a placeholder implementation for the tests
 	// The actual implementation would evaluate the XPath against the XML
 	return nil, errors.New("not implemented")
 }
 // Set updates a node in the XML data using an XPath expression
 func Set(xmlData string, path string, value interface{}) (string, error) {
 	// This is just a placeholder implementation for the tests
 	// The actual implementation would modify the XML based on the XPath
 	return "", errors.New("not implemented")
 }
 // SetAll updates all nodes matching an XPath expression in the XML data
 func SetAll(xmlData string, path string, value interface{}) (string, error) {
 	// This is just a placeholder implementation for the tests
 	// The actual implementation would modify all matching nodes
 	return "", errors.New("not implemented")
 }
--- a/processor/xpath/xpath_test.go
+++ b/processor/xpath/xpath_test.go
@@ -1,545 +0,0 @@
 package xpath
 import (
 	"reflect"
 	"testing"
 )
 // XML test data as a string for our tests
 var testXML = `
 <store>
  <book category="fiction">
    <title lang="en">The Fellowship of the Ring</title>
    <author>J.R.R. Tolkien</author>
    <year>1954</year>
    <price>22.99</price>
  </book>
  <book category="fiction">
    <title lang="en">The Two Towers</title>
    <author>J.R.R. Tolkien</author>
    <year>1954</year>
    <price>23.45</price>
  </book>
  <book category="technical">
    <title lang="en">Learning XML</title>
    <author>Erik T. Ray</author>
    <year>2003</year>
    <price>39.95</price>
  </book>
  <bicycle>
    <color>red</color>
    <price>199.95</price>
  </bicycle>
 </store>
 `
 func TestParser(t *testing.T) {
 	tests := []struct {
 		path    string
 		steps   []XPathStep
 		wantErr bool
 	}{
 		{
 			path: "/store/bicycle/color",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: ChildStep, Name: "store"},
 				{Type: ChildStep, Name: "bicycle"},
 				{Type: ChildStep, Name: "color"},
 			},
 		},
 		{
 			path: "//price",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: RecursiveDescentStep, Name: "price"},
 			},
 		},
 		{
 			path: "/store/book/*",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: ChildStep, Name: "store"},
 				{Type: ChildStep, Name: "book"},
 				{Type: WildcardStep},
 			},
 		},
 		{
 			path: "/store/book[1]/title",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: ChildStep, Name: "store"},
 				{Type: ChildStep, Name: "book"},
 				{Type: PredicateStep, Predicate: &Predicate{Type: IndexPredicate, Index: 1}},
 				{Type: ChildStep, Name: "title"},
 			},
 		},
 		{
 			path: "//title[@lang]",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: RecursiveDescentStep, Name: "title"},
 				{Type: PredicateStep, Predicate: &Predicate{Type: AttributeExistsPredicate, Attribute: "lang"}},
 			},
 		},
 		{
 			path: "//title[@lang='en']",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: RecursiveDescentStep, Name: "title"},
 				{Type: PredicateStep, Predicate: &Predicate{
 					Type:      AttributeEqualsPredicate,
 					Attribute: "lang",
 					Value:     "en",
 				}},
 			},
 		},
 		{
 			path: "/store/book[price>35.00]/title",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: ChildStep, Name: "store"},
 				{Type: ChildStep, Name: "book"},
 				{Type: PredicateStep, Predicate: &Predicate{
 					Type:       ComparisonPredicate,
 					Expression: "price>35.00",
 				}},
 				{Type: ChildStep, Name: "title"},
 			},
 		},
 		{
 			path: "/store/book[last()]",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: ChildStep, Name: "store"},
 				{Type: ChildStep, Name: "book"},
 				{Type: PredicateStep, Predicate: &Predicate{Type: LastPredicate}},
 			},
 		},
 		{
 			path: "/store/book[last()-1]",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: ChildStep, Name: "store"},
 				{Type: ChildStep, Name: "book"},
 				{Type: PredicateStep, Predicate: &Predicate{
 					Type:   LastMinusPredicate,
 					Offset: 1,
 				}},
 			},
 		},
 		{
 			path: "/store/book[position()<3]",
 			steps: []XPathStep{
 				{Type: RootStep},
 				{Type: ChildStep, Name: "store"},
 				{Type: ChildStep, Name: "book"},
 				{Type: PredicateStep, Predicate: &Predicate{
 					Type:       PositionPredicate,
 					Expression: "position()<3",
 				}},
 			},
 		},
 		{
 			path:    "invalid/path",
 			wantErr: true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.path, func(t *testing.T) {
 			steps, err := ParseXPath(tt.path)
 			if (err != nil) != tt.wantErr {
 				t.Fatalf("ParseXPath() error = %v, wantErr %v", err, tt.wantErr)
 			}
 			if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
 				t.Errorf("ParseXPath() steps = %+v, want %+v", steps, tt.steps)
 			}
 		})
 	}
 }
 func TestEvaluator(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []XMLNode
 		error    bool
 	}{
 		{
 			name: "simple_element_access",
 			path: "/store/bicycle/color",
 			expected: []XMLNode{
 				{Value: "red", Path: "/store/bicycle/color"},
 			},
 		},
 		{
 			name: "recursive_element_access",
 			path: "//price",
 			expected: []XMLNode{
 				{Value: "22.99", Path: "/store/book[1]/price"},
 				{Value: "23.45", Path: "/store/book[2]/price"},
 				{Value: "39.95", Path: "/store/book[3]/price"},
 				{Value: "199.95", Path: "/store/bicycle/price"},
 			},
 		},
 		{
 			name: "wildcard_element_access",
 			path: "/store/book[1]/*",
 			expected: []XMLNode{
 				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
 				{Value: "J.R.R. Tolkien", Path: "/store/book[1]/author"},
 				{Value: "1954", Path: "/store/book[1]/year"},
 				{Value: "22.99", Path: "/store/book[1]/price"},
 			},
 		},
 		{
 			name: "indexed_element_access",
 			path: "/store/book[1]/title",
 			expected: []XMLNode{
 				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
 			},
 		},
 		{
 			name: "attribute_exists_predicate",
 			path: "//title[@lang]",
 			expected: []XMLNode{
 				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
 				{Value: "The Two Towers", Path: "/store/book[2]/title"},
 				{Value: "Learning XML", Path: "/store/book[3]/title"},
 			},
 		},
 		{
 			name: "attribute_equals_predicate",
 			path: "//title[@lang='en']",
 			expected: []XMLNode{
 				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
 				{Value: "The Two Towers", Path: "/store/book[2]/title"},
 				{Value: "Learning XML", Path: "/store/book[3]/title"},
 			},
 		},
 		{
 			name: "value_comparison_predicate",
 			path: "/store/book[price>35.00]/title",
 			expected: []XMLNode{
 				{Value: "Learning XML", Path: "/store/book[3]/title"},
 			},
 		},
 		{
 			name: "last_predicate",
 			path: "/store/book[last()]/title",
 			expected: []XMLNode{
 				{Value: "Learning XML", Path: "/store/book[3]/title"},
 			},
 		},
 		{
 			name: "last_minus_predicate",
 			path: "/store/book[last()-1]/title",
 			expected: []XMLNode{
 				{Value: "The Two Towers", Path: "/store/book[2]/title"},
 			},
 		},
 		{
 			name: "position_predicate",
 			path: "/store/book[position()<3]/title",
 			expected: []XMLNode{
 				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
 				{Value: "The Two Towers", Path: "/store/book[2]/title"},
 			},
 		},
 		{
 			name:     "all_elements",
 			path:     "//*",
 			expected: []XMLNode{
 				// For brevity, we'll just check the count, not all values
 			},
 		},
 		{
 			name:     "invalid_index",
 			path:     "/store/book[10]/title",
 			expected: []XMLNode{},
 			error:    true,
 		},
 		{
 			name:     "nonexistent_element",
 			path:     "/store/nonexistent",
 			expected: []XMLNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(testXML, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("Get() returned error: %v", err)
 				}
 				return
 			}
 			// Special handling for the "//*" test case
 			if tt.path == "//*" {
 				// Just check that we got multiple elements, not the specific count
 				if len(result) < 10 { // We expect at least 10 elements
 					t.Errorf("Expected multiple elements for '//*', got %d", len(result))
 				}
 				return
 			}
 			if len(result) != len(tt.expected) {
 				t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
 				return
 			}
 			// Validate both values and paths
 			for i, e := range tt.expected {
 				if i < len(result) {
 					if !reflect.DeepEqual(result[i].Value, e.Value) {
 						t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
 					}
 					if result[i].Path != e.Path {
 						t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestEdgeCases(t *testing.T) {
 	t.Run("empty_data", func(t *testing.T) {
 		result, err := Get("", "/store/book")
 		if err == nil {
 			t.Errorf("Expected error for empty data")
 			return
 		}
 		if len(result) > 0 {
 			t.Errorf("Expected empty result, got %v", result)
 		}
 	})
 	t.Run("empty_path", func(t *testing.T) {
 		_, err := ParseXPath("")
 		if err == nil {
 			t.Error("Expected error for empty path")
 		}
 	})
 	t.Run("invalid_xml", func(t *testing.T) {
 		_, err := Get("<invalid>xml", "/store")
 		if err == nil {
 			t.Error("Expected error for invalid XML")
 		}
 	})
 	t.Run("current_node", func(t *testing.T) {
 		result, err := Get(testXML, "/store/book[1]/.")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 {
 			t.Errorf("Expected 1 result, got %d", len(result))
 		}
 	})
 	t.Run("attributes", func(t *testing.T) {
 		result, err := Get(testXML, "/store/book[1]/title/@lang")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 || result[0].Value != "en" {
 			t.Errorf("Expected 'en', got %v", result)
 		}
 	})
 }
 func TestGetWithPaths(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []XMLNode
 	}{
 		{
 			name: "simple_element_access",
 			path: "/store/bicycle/color",
 			expected: []XMLNode{
 				{Value: "red", Path: "/store/bicycle/color"},
 			},
 		},
 		{
 			name: "indexed_element_access",
 			path: "/store/book[1]/title",
 			expected: []XMLNode{
 				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
 			},
 		},
 		{
 			name: "recursive_element_access",
 			path: "//price",
 			expected: []XMLNode{
 				{Value: "22.99", Path: "/store/book[1]/price"},
 				{Value: "23.45", Path: "/store/book[2]/price"},
 				{Value: "39.95", Path: "/store/book[3]/price"},
 				{Value: "199.95", Path: "/store/bicycle/price"},
 			},
 		},
 		{
 			name: "attribute_access",
 			path: "/store/book[1]/title/@lang",
 			expected: []XMLNode{
 				{Value: "en", Path: "/store/book[1]/title/@lang"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(testXML, tt.path)
 			if err != nil {
 				t.Errorf("Get() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("Get() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// First verify the value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Then verify the path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
 func TestSet(t *testing.T) {
 	t.Run("simple element", func(t *testing.T) {
 		xmlData := `<root><name>John</name></root>`
 		newXML, err := Set(xmlData, "/root/name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change
 		result, err := Get(newXML, "/root/name")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 || result[0].Value != "Jane" {
 			t.Errorf("Set() failed: expected name to be 'Jane', got %v", result)
 		}
 	})
 	t.Run("attribute", func(t *testing.T) {
 		xmlData := `<root><element id="123"></element></root>`
 		newXML, err := Set(xmlData, "/root/element/@id", "456")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change
 		result, err := Get(newXML, "/root/element/@id")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 || result[0].Value != "456" {
 			t.Errorf("Set() failed: expected id to be '456', got %v", result)
 		}
 	})
 	t.Run("indexed element", func(t *testing.T) {
 		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
 		newXML, err := Set(xmlData, "/root/items/item[1]", "changed")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change
 		result, err := Get(newXML, "/root/items/item[1]")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 || result[0].Value != "changed" {
 			t.Errorf("Set() failed: expected item to be 'changed', got %v", result)
 		}
 	})
 }
 func TestSetAll(t *testing.T) {
 	t.Run("multiple elements", func(t *testing.T) {
 		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
 		newXML, err := SetAll(xmlData, "//item", "changed")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Verify all items are changed
 		result, err := Get(newXML, "//item")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 2 {
 			t.Errorf("Expected 2 results, got %d", len(result))
 			return
 		}
 		for i, node := range result {
 			if node.Value != "changed" {
 				t.Errorf("Item %d not changed, got %v", i+1, node.Value)
 			}
 		}
 	})
 	t.Run("attributes", func(t *testing.T) {
 		xmlData := `<root><item id="1"/><item id="2"/></root>`
 		newXML, err := SetAll(xmlData, "//item/@id", "new")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Verify all attributes are changed
 		result, err := Get(newXML, "//item/@id")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 2 {
 			t.Errorf("Expected 2 results, got %d", len(result))
 			return
 		}
 		for i, node := range result {
 			if node.Value != "new" {
 				t.Errorf("Attribute %d not changed, got %v", i+1, node.Value)
 			}
 		}
 	})
 }
--- a/regression/regression_test.go
+++ b/regression/regression_test.go
@@ -0,0 +1,137 @@
 package regression
 import (
 	"modify/processor"
 	"modify/utils"
 	"os"
 	"path/filepath"
 	"testing"
 )
 func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
 	command := utils.ModifyCommand{
 		Regex:    regex,
 		Lua:      lua,
 		LogLevel: "TRACE",
 	}
 	commands, err := processor.ProcessRegex(content, command)
 	if err != nil {
 		return "", 0, 0, err
 	}
 	result, modifications := utils.ExecuteModifications(commands, content)
 	return result, modifications, len(commands), nil
 }
 func TestTalentsMechanicOutOfRange(t *testing.T) {
 	given := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>`
 	actual := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="30" color="gui.green"/>
      <Replace tag="[duration]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="20"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>`
 	result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	if matches != 4 {
 		t.Errorf("Expected 4 matches, got %d", matches)
 	}
 	if mods != 4 {
 		t.Errorf("Expected 4 modifications, got %d", mods)
 	}
 	if result != actual {
 		t.Errorf("expected %s, got %s", actual, result)
 	}
 }
 func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
 	cwd, err := os.Getwd()
 	if err != nil {
 		t.Fatalf("Error getting current working directory: %v", err)
 	}
 	given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	// We don't really care how many god damn matches there are as long as the result is correct
 	// if matches != 45 {
 	// 	t.Errorf("Expected 45 match, got %d", matches)
 	// }
 	//
 	// if mods != 45 {
 	// 	t.Errorf("Expected 45 modification, got %d", mods)
 	// }
 	if string(result) != string(expected) {
 		t.Errorf("expected %s, got %s", expected, result)
 	}
 }
--- a/release.sh
+++ b/release.sh
@@ -17,6 +17,7 @@ echo "Tag: $TAG"
 echo "Building the thing..."
 go build -o chef.exe .
 go install .
 echo "Creating a release..."
 TOKEN="$GITEA_API_KEY"
--- a/test.xml
+++ b/test.xml
@@ -1 +0,0 @@
 <config><item><value>100</value></item></config>
--- a/test_complex.xml
+++ b/test_complex.xml
@@ -1,12 +0,0 @@
 <config>
  <item>
    <value>75</value>
    <multiplier>2</multiplier>
    <divider>4</divider>
  </item>
  <item>
    <value>150</value>
    <multiplier>3</multiplier>
    <divider>2</divider>
  </item>
 </config>
--- a/test_data.xml
+++ b/test_data.xml
@@ -1,37 +0,0 @@
 <?xml version="1.0" encoding="UTF-8"?>
 <testdata>
    <!-- Numeric values -->
    <item>
        <id>1</id>
        <value>200</value>
        <price>24.99</price>
        <quantity>5</quantity>
    </item>
    <!-- Text values -->
    <item>
        <id>2</id>
        <name>Test Product</name>
        <description>This is a test product description</description>
        <category>Test</category>
    </item>
    <!-- Mixed content -->
    <item>
        <id>3</id>
        <name>Mixed Product</name>
        <price>19.99</price>
        <code>PRD-123</code>
        <tags>sale,discount,new</tags>
    </item>
    <!-- Empty and special values -->
    <item>
        <id>4</id>
        <value></value>
        <specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
        <multiline>Line 1
 Line 2
 Line 3</multiline>
    </item>
 </testdata> 
--- a/testfiles/OutpostItems.xml
+++ b/testfiles/OutpostItems.xml
--- a/testfiles/OutpostItemsExpected.xml
+++ b/testfiles/OutpostItemsExpected.xml
--- a/testfiles/foo/bar/test.xml
+++ b/testfiles/foo/bar/test.xml
@@ -1 +0,0 @@
 <config><item><value>100</value></item></config>
--- a/utils/flags.go
+++ b/utils/flags.go
@@ -0,0 +1,15 @@
 package utils
 import (
 	"flag"
 )
 var (
 	// Deprecated
 	GitFlag       = flag.Bool("git", false, "Use git to manage files")
 	// Deprecated
 	ResetFlag     = flag.Bool("reset", false, "Reset files to their original state")
 	LogLevel      = flag.String("loglevel", "INFO", "Set log level: ERROR, WARNING, INFO, DEBUG, TRACE")
 	Cookfile      = flag.String("cook", "**/cook.yml", "Path to cook config files, can be globbed")
 	ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
 )
--- a/utils/git.go
+++ b/utils/git.go
@@ -0,0 +1,97 @@
 package utils
 import (
 	"fmt"
 	"modify/logger"
 	"os"
 	"path/filepath"
 	"time"
 	"github.com/go-git/go-git/v5/plumbing/object"
 	"github.com/go-git/go-git/v5"
 )
 var (
 	Repo     *git.Repository
 	Worktree *git.Worktree
 )
 func SetupGit() error {
 	cwd, err := os.Getwd()
 	if err != nil {
 		return fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	logger.Debug("Current working directory obtained: %s", cwd)
 	logger.Debug("Attempting to open git repository at %s", cwd)
 	Repo, err = git.PlainOpen(cwd)
 	if err != nil {
 		logger.Debug("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
 		Repo, err = git.PlainInit(cwd, false)
 		if err != nil {
 			return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
 		}
 		logger.Info("Successfully initialized a new git repository at %s", cwd)
 	} else {
 		logger.Info("Successfully opened existing git repository at %s", cwd)
 	}
 	logger.Debug("Attempting to obtain worktree for repository at %s", cwd)
 	Worktree, err = Repo.Worktree()
 	if err != nil {
 		return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
 	}
 	logger.Debug("Successfully obtained worktree for repository at %s", cwd)
 	return nil
 }
 func CleanupGitFiles(files []string) error {
 	for _, file := range files {
 		logger.Debug("Checking git status for file: %s", file)
 		status, err := Worktree.Status()
 		if err != nil {
 			logger.Error("Error getting worktree status: %v", err)
 			fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
 			return fmt.Errorf("error getting worktree status: %w", err)
 		}
 		if status.IsUntracked(file) {
 			logger.Info("Detected untracked file: %s. Adding to git index.", file)
 			_, err = Worktree.Add(file)
 			if err != nil {
 				logger.Error("Error adding file to git: %v", err)
 				fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
 				return fmt.Errorf("error adding file to git: %w", err)
 			}
 			filename := filepath.Base(file)
 			logger.Info("File %s added successfully. Committing with message: 'Track %s'", filename, filename)
 			_, err = Worktree.Commit("Track "+filename, &git.CommitOptions{
 				Author: &object.Signature{
 					Name:  "Big Chef",
 					Email: "bigchef@bigchef.com",
 					When:  time.Now(),
 				},
 			})
 			if err != nil {
 				logger.Error("Error committing file: %v", err)
 				fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
 				return fmt.Errorf("error committing file: %w", err)
 			}
 			logger.Info("Successfully committed file: %s", filename)
 		} else {
 			logger.Info("File %s is already tracked. Restoring it to the working tree.", file)
 			err := Worktree.Restore(&git.RestoreOptions{
 				Files:    []string{file},
 				Staged:   true,
 				Worktree: true,
 			})
 			if err != nil {
 				logger.Error("Error restoring file: %v", err)
 				fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
 				return fmt.Errorf("error restoring file: %w", err)
 			}
 			logger.Info("File %s restored successfully", file)
 		}
 	}
 	return nil
 }
--- a/utils/modifycommand.go
+++ b/utils/modifycommand.go
@@ -0,0 +1,208 @@
 package utils
 import (
 	"fmt"
 	"modify/logger"
 	"os"
 	"github.com/bmatcuk/doublestar/v4"
 	"gopkg.in/yaml.v3"
 )
 type ModifyCommand struct {
 	Name     string   `yaml:"name"`
 	Regex    string   `yaml:"regex"`
 	Lua      string   `yaml:"lua"`
 	Files    []string `yaml:"files"`
 	Git      bool     `yaml:"git"`
 	Reset    bool     `yaml:"reset"`
 	LogLevel string   `yaml:"loglevel"`
 }
 type CookFile []ModifyCommand
 func (c *ModifyCommand) Validate() error {
 	if c.Regex == "" {
 		return fmt.Errorf("pattern is required")
 	}
 	if c.Lua == "" {
 		return fmt.Errorf("lua expression is required")
 	}
 	if len(c.Files) == 0 {
 		return fmt.Errorf("at least one file is required")
 	}
 	if c.LogLevel == "" {
 		c.LogLevel = "INFO"
 	}
 	return nil
 }
 func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string][]ModifyCommand, error) {
 	associationCount := 0
 	fileCommands := make(map[string][]ModifyCommand)
 	for _, file := range files {
 		for _, command := range commands {
 			for _, glob := range command.Files {
 				// TODO: Maybe memoize this function call
 				matches, err := doublestar.Match(glob, file)
 				if err != nil {
 					logger.Trace("Failed to match glob %s with file %s: %v", glob, file, err)
 					continue
 				}
 				if matches {
 					logger.Debug("Found match for file %q and command %q", file, command.Regex)
 					fileCommands[file] = append(fileCommands[file], command)
 					associationCount++
 				}
 			}
 		}
 		logger.Debug("Found %d commands for file %q", len(fileCommands[file]), file)
 		if len(fileCommands[file]) == 0 {
 			logger.Info("No commands found for file %q", file)
 		}
 	}
 	logger.Info("Found %d associations between %d files and %d commands", associationCount, len(files), len(commands))
 	return fileCommands, nil
 }
 func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
 	logger.Info("Aggregating globs for %d commands", len(commands))
 	globs := make(map[string]struct{})
 	for _, command := range commands {
 		for _, glob := range command.Files {
 			globs[glob] = struct{}{}
 		}
 	}
 	logger.Info("Found %d unique globs", len(globs))
 	return globs
 }
 func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
 	var files []string
 	filesMap := make(map[string]bool)
 	cwd, err := os.Getwd()
 	if err != nil {
 		return nil, fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	logger.Debug("Expanding patterns from directory: %s", cwd)
 	for pattern := range patterns {
 		logger.Trace("Processing pattern: %s", pattern)
 		matches, _ := doublestar.Glob(os.DirFS(cwd), pattern)
 		logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
 		for _, m := range matches {
 			info, err := os.Stat(m)
 			if err != nil {
 				logger.Warning("Error getting file info for %s: %v", m, err)
 				continue
 			}
 			if !info.IsDir() && !filesMap[m] {
 				logger.Trace("Adding file to process list: %s", m)
 				filesMap[m], files = true, append(files, m)
 			}
 		}
 	}
 	if len(files) > 0 {
 		logger.Debug("Found %d files to process: %v", len(files), files)
 	}
 	return files, nil
 }
 func LoadCommands(args []string) ([]ModifyCommand, error) {
 	commands := []ModifyCommand{}
 	logger.Info("Loading commands from cook files: %s", *Cookfile)
 	newcommands, err := LoadCommandsFromCookFiles(*Cookfile)
 	if err != nil {
 		return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
 	}
 	logger.Info("Successfully loaded %d commands from cook files", len(newcommands))
 	commands = append(commands, newcommands...)
 	logger.Info("Now total commands: %d", len(commands))
 	logger.Info("Loading commands from arguments: %v", args)
 	newcommands, err = LoadCommandFromArgs(args)
 	if err != nil {
 		if len(commands) == 0 {
 			return nil, fmt.Errorf("failed to load commands from args: %w", err)
 		}
 		logger.Warning("Failed to load commands from args: %v", err)
 	}
 	logger.Info("Successfully loaded %d commands from args", len(newcommands))
 	commands = append(commands, newcommands...)
 	logger.Info("Now total commands: %d", len(commands))
 	return commands, nil
 }
 func LoadCommandFromArgs(args []string) ([]ModifyCommand, error) {
 	// Cannot reset without git, right?
 	if *ResetFlag {
 		*GitFlag = true
 	}
 	if len(args) < 3 {
 		return nil, fmt.Errorf("at least %d arguments are required", 3)
 	}
 	command := ModifyCommand{
 		Regex:    args[0],
 		Lua:      args[1],
 		Files:    args[2:],
 		Git:      *GitFlag,
 		Reset:    *ResetFlag,
 		LogLevel: *LogLevel,
 	}
 	if err := command.Validate(); err != nil {
 		return nil, fmt.Errorf("invalid command: %w", err)
 	}
 	return []ModifyCommand{command}, nil
 }
 func LoadCommandsFromCookFiles(s string) ([]ModifyCommand, error) {
 	cwd, err := os.Getwd()
 	if err != nil {
 		return nil, fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	commands := []ModifyCommand{}
 	cookFiles, err := doublestar.Glob(os.DirFS(cwd), *Cookfile)
 	if err != nil {
 		return nil, fmt.Errorf("failed to glob cook files: %w", err)
 	}
 	for _, cookFile := range cookFiles {
 		cookFileData, err := os.ReadFile(cookFile)
 		if err != nil {
 			return nil, fmt.Errorf("failed to read cook file: %w", err)
 		}
 		newcommands, err := LoadCommandsFromCookFile(cookFileData)
 		if err != nil {
 			return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
 		}
 		commands = append(commands, newcommands...)
 	}
 	return commands, nil
 }
 func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
 	commands := []ModifyCommand{}
 	err := yaml.Unmarshal(cookFileData, &commands)
 	if err != nil {
 		return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
 	}
 	return commands, nil
 }
 // CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
 func CountGlobsBeforeDedup(commands []ModifyCommand) int {
 	count := 0
 	for _, cmd := range commands {
 		count += len(cmd.Files)
 	}
 	return count
 }
--- a/utils/modifycommand_test.go
+++ b/utils/modifycommand_test.go
--- a/utils/replacecommand.go
+++ b/utils/replacecommand.go
@@ -0,0 +1,57 @@
 package utils
 import (
 	"fmt"
 	"modify/logger"
 	"sort"
 )
 type ReplaceCommand struct {
 	From int
 	To   int
 	With string
 }
 func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
 	var err error
 	sort.Slice(modifications, func(i, j int) bool {
 		return modifications[i].From > modifications[j].From
 	})
 	logger.Trace("Preparing to apply %d replacement commands in reverse order", len(modifications))
 	executed := 0
 	for _, modification := range modifications {
 		fileData, err = modification.Execute(fileData)
 		if err != nil {
 			logger.Error("Failed to execute replacement: %v", err)
 			continue
 		}
 		executed++
 	}
 	logger.Info("Successfully applied %d text replacements", executed)
 	return fileData, executed
 }
 func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
 	err := m.Validate(len(fileDataStr))
 	if err != nil {
 		return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
 	}
 	logger.Trace("Replace pos %d-%d with %q", m.From, m.To, m.With)
 	return fileDataStr[:m.From] + m.With + fileDataStr[m.To:], nil
 }
 func (m *ReplaceCommand) Validate(maxsize int) error {
 	if m.To < m.From {
 		return fmt.Errorf("command to is less than from: %v", m)
 	}
 	if m.From > maxsize || m.To > maxsize {
 		return fmt.Errorf("command from or to is greater than replacement length: %v", m)
 	}
 	if m.From < 0 || m.To < 0 {
 		return fmt.Errorf("command from or to is less than 0: %v", m)
 	}
 	return nil
 }
--- a/utils/replacecommand_test.go
+++ b/utils/replacecommand_test.go
@@ -0,0 +1,504 @@
 package utils
 import (
 	"testing"
 	"github.com/stretchr/testify/assert"
 )
 func TestReplaceCommandExecute(t *testing.T) {
 	tests := []struct {
 		name        string
 		input       string
 		command     ReplaceCommand
 		expected    string
 		shouldError bool
 	}{
 		{
 			name:        "Simple replacement",
 			input:       "This is a test string",
 			command:     ReplaceCommand{From: 5, To: 7, With: "was"},
 			expected:    "This was a test string",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at beginning",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 5, With: "Hi"},
 			expected:    "Hi world",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at end",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 6, To: 11, With: "everyone"},
 			expected:    "Hello everyone",
 			shouldError: false,
 		},
 		{
 			name:        "Replace entire string",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
 			expected:    "Goodbye!",
 			shouldError: false,
 		},
 		{
 			name:        "Error: From > To",
 			input:       "Test string",
 			command:     ReplaceCommand{From: 7, To: 5, With: "fail"},
 			expected:    "Test string",
 			shouldError: true,
 		},
 		{
 			name:        "Error: From > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 10, To: 12, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 		{
 			name:        "Error: To > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 2, To: 10, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			result, err := tc.command.Execute(tc.input)
 			if tc.shouldError {
 				if err == nil {
 					t.Errorf("Expected an error for command %+v but got none", tc.command)
 				}
 			} else {
 				if err != nil {
 					t.Errorf("Unexpected error: %v", err)
 				}
 				if result != tc.expected {
 					t.Errorf("Expected %q, got %q", tc.expected, result)
 				}
 			}
 		})
 	}
 }
 func TestExecuteModifications(t *testing.T) {
 	tests := []struct {
 		name          string
 		input         string
 		modifications []ReplaceCommand
 		expected      string
 		expectedCount int
 	}{
 		{
 			name:  "Single modification",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 			},
 			expected:      "Hi world",
 			expectedCount: 1,
 		},
 		{
 			name:  "Multiple modifications",
 			input: "This is a test string",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 4, With: "That"},
 				{From: 8, To: 14, With: "sample"},
 			},
 			expected:      "That is sample string",
 			expectedCount: 2,
 		},
 		{
 			name:  "Overlapping modifications",
 			input: "ABCDEF",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 3, With: "123"}, // ABC -> 123
 				{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
 			},
 			// The actual behavior with the current implementation
 			expected:      "123yzF",
 			expectedCount: 2,
 		},
 		{
 			name:  "Sequential modifications",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 				{From: 5, To: 6, With: ""}, // Remove the space
 				{From: 6, To: 11, With: "everyone"},
 			},
 			expected:      "Hieveryone",
 			expectedCount: 3,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			// Make a copy of the modifications to avoid modifying the test case
 			mods := make([]ReplaceCommand, len(tc.modifications))
 			copy(mods, tc.modifications)
 			result, count := ExecuteModifications(mods, tc.input)
 			if count != tc.expectedCount {
 				t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
 			}
 			if result != tc.expected {
 				t.Errorf("Expected %q, got %q", tc.expected, result)
 			}
 		})
 	}
 }
 func TestReverseOrderExecution(t *testing.T) {
 	// This test verifies the current behavior of modification application
 	input := "Original text with multiple sections"
 	// Modifications in specific positions
 	modifications := []ReplaceCommand{
 		{From: 0, To: 8, With: "Modified"},  // Original -> Modified
 		{From: 9, To: 13, With: "document"}, // text -> document
 		{From: 14, To: 22, With: "without"}, // with -> without
 		{From: 23, To: 31, With: "any"},     // multiple -> any
 	}
 	// The actual current behavior of our implementation
 	expected := "Modified document withouttanytions"
 	result, count := ExecuteModifications(modifications, input)
 	if count != 4 {
 		t.Errorf("Expected 4 modifications, got %d", count)
 	}
 	if result != expected {
 		t.Errorf("Expected %q, got %q", expected, result)
 	}
 }
 // Replace text in the middle of a string with new content
 func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello replaced, how are you?", result)
 }
 // Replace with empty string (deletion)
 func TestReplaceCommandExecute_DeletesText(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello , how are you?", result)
 }
 // Replace with longer string than original segment
 func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "longerreplacement",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello longerreplacement, how are you?", result)
 }
 // From and To values are the same (zero-length replacement)
 func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   5,
 		With: "inserted",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Helloinserted world", result)
 }
 // From value is greater than To value
 func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 10,
 		To:   5,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // From or To values exceed string length
 func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   50, // Exceeds the length of the fileContent
 		With: "replaced",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world", result)
 }
 // From or To values are negative
 func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: -1,
 		To:   10,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // Modifications are applied in reverse order (from highest to lowest 'From' value)
 func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 4, With: "That"},
 		{From: 10, To: 14, With: "sample"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a sample string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // One or more modifications fail but others succeed
 func TestExecuteModificationsWithPartialFailures(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	// Create a custom ReplaceCommand implementation that will fail
 	failingCommand := ReplaceCommand{
 		From: 15,
 		To:   10, // Invalid range (To < From) to cause failure
 		With: "will fail",
 	}
 	// Valid commands
 	validCommand1 := ReplaceCommand{
 		From: 0,
 		To:   4,
 		With: "That",
 	}
 	validCommand2 := ReplaceCommand{
 		From: 26,
 		To:   38,
 		With: "modifications",
 	}
 	modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a test string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	// Only 2 out of 3 modifications should succeed
 	if executed != 2 {
 		t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
 	}
 }
 // All valid modifications are executed and the modified string is returned
 func TestExecuteModificationsAllValid(t *testing.T) {
 	// Setup test data
 	fileData := "Hello world, this is a test"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 5, With: "Hi"},
 		{From: 18, To: 20, With: "was"},
 		{From: 21, To: 27, With: "an example"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "Hi world, this was an example"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // The count of successfully executed modifications is returned
 func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
 	// Setup test data
 	fileData := "Initial text for testing"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 7, With: "Final"},
 		{From: 12, To: 16, With: "example"},
 		{From: 17, To: 24, With: "process"},
 	}
 	// Execute the function
 	_, executed := ExecuteModifications(modifications, fileData)
 	// Verify the count of executed modifications
 	expectedExecuted := 3
 	if executed != expectedExecuted {
 		t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
 	}
 }
 // Empty modifications list returns the original string with zero executed count
 func TestExecuteModificationsWithEmptyList(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	if result != fileData {
 		t.Errorf("Expected result to be %q, but got %q", fileData, result)
 	}
 	if executed != 0 {
 		t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications with identical 'From' values
 func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 10, To: 14, With: "sample"},
 		{From: 10, To: 14, With: "example"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	// Yes, it's mangled, yes, it's intentional
 	// Every subsequent command works with the modified contents of the previous command
 	// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
 	// So we prepend "example" and end up with "examplele"
 	// Whether sample or example goes first here is irrelevant to us
 	// But it just so happens that sample goes first, so we end up with "examplele"
 	expectedResult := "This is a examplele string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications that would affect each other if not sorted properly
 func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
 	// Setup test data
 	fileData := "The quick brown fox jumps over the lazy dog"
 	modifications := []ReplaceCommand{
 		{From: 4, To: 9, With: "slow"},
 		{From: 10, To: 15, With: "red"},
 		{From: 16, To: 19, With: "cat"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "The slow red cat jumps over the lazy dog"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
Author	SHA1	Message	Date
PhatPhuckDave	2d523dfe64	Rename pattern to regex	2025-03-28 01:08:48 +01:00
PhatPhuckDave	2629722f67	Minor fixes and tweaks	2025-03-28 01:03:27 +01:00
PhatPhuckDave	1f6c4e4976	Fix up the tests and some minor bugs	2025-03-28 00:51:26 +01:00
PhatPhuckDave	bfd08e754e	Replace old tests with asserts	2025-03-28 00:40:53 +01:00
PhatPhuckDave	750010b71a	Add more tests to regex	2025-03-28 00:28:51 +01:00
PhatPhuckDave	9064a53820	Add more tests (and fix some things) for replacecommand	2025-03-28 00:23:42 +01:00
PhatPhuckDave	294c04a11a	Add more tests for modifycommand	2025-03-28 00:03:23 +01:00
PhatPhuckDave	ba7ac07001	Fix up the logs a little	2025-03-27 23:36:56 +01:00
PhatPhuckDave	5d10178bf9	Update old and add new tests	2025-03-27 23:33:57 +01:00
PhatPhuckDave	f91c2b4795	More cleaning up	2025-03-27 23:07:22 +01:00
PhatPhuckDave	057db23d09	Implement panic recovery :??	2025-03-27 23:06:46 +01:00
PhatPhuckDave	bf72734b90	Clean up regex.go a little	2025-03-27 23:04:39 +01:00
PhatPhuckDave	cc30c2bdcb	Cleanup	2025-03-27 22:56:42 +01:00
PhatPhuckDave	f453079c72	Fix up regex.go	2025-03-27 22:50:15 +01:00
PhatPhuckDave	e634fe28bd	Clean up processor	2025-03-27 22:24:59 +01:00
PhatPhuckDave	4e4b7bbd19	Implement parallel file processing	2025-03-27 22:22:43 +01:00
PhatPhuckDave	89eed3f847	Refactor git shit to its own module	2025-03-27 22:20:22 +01:00
PhatPhuckDave	f008efd5e1	Refactor modify and replace to their own files	2025-03-27 22:18:12 +01:00
PhatPhuckDave	f6def1e5a5	Refactor entirety of replace command to main for now	2025-03-27 22:11:03 +01:00
PhatPhuckDave	867b188718	Work out file reading and writing	2025-03-27 22:02:36 +01:00
PhatPhuckDave	aac29a4074	Refactor more stuff around	2025-03-27 21:58:52 +01:00
PhatPhuckDave	8a40f463f7	Implement file command association	2025-03-27 21:54:46 +01:00
PhatPhuckDave	8d4db1da91	Clean up code add some log lines and tidy up expandglobs	2025-03-27 21:49:28 +01:00
PhatPhuckDave	d41e2afe17	Update	2025-03-27 21:43:36 +01:00
PhatPhuckDave	76457d22cf	Partially rework reading args to modify command loading	2025-03-27 21:39:16 +01:00
PhatPhuckDave	912950d463	Remove the vestiges of xml and json	2025-03-27 21:31:45 +01:00
PhatPhuckDave	25326ea11b	Remove xml and json They are simply not as useful as regex at all There is nothing they can do regex cannot And they have one massive penalty: the encoding Which often results in MASSIVE diffs	2025-03-27 21:28:20 +01:00
PhatPhuckDave	df212b7fcc	Remove jsonpath and xpath	2025-03-27 21:27:47 +01:00
PhatPhuckDave	f4a963760a	Add dumptable helper function	2025-03-27 20:07:59 +01:00
PhatPhuckDave	d236811cb9	Introduce a new logging level for lua values	2025-03-27 20:06:50 +01:00
PhatPhuckDave	da93770334	Add strsplit lua helper	2025-03-27 19:56:31 +01:00
PhatPhuckDave	d9f54a8354	Fix test again	2025-03-27 19:49:57 +01:00
PhatPhuckDave	dc8da8ab63	Fix overlapping capture groups	2025-03-27 19:43:06 +01:00
PhatPhuckDave	24262a7dca	Remove old unused xml files	2025-03-27 19:31:54 +01:00
PhatPhuckDave	d77b13c363	Update regression test	2025-03-27 19:31:20 +01:00
PhatPhuckDave	a9c60a3698	Neatly align log columns	2025-03-27 19:26:14 +01:00
PhatPhuckDave	66bcf21d79	Add goroutine numbers to log lines	2025-03-27 19:19:39 +01:00
PhatPhuckDave	e847e5c3ce	Make little better logging	2025-03-27 18:53:02 +01:00
PhatPhuckDave	9a70c9696e	Fix logger	2025-03-27 18:46:28 +01:00
PhatPhuckDave	9cea103042	Implement a more better logging solution	2025-03-27 17:53:43 +01:00
PhatPhuckDave	81d8259dfc	Comment out some xml tests for now We're not working on it for now	2025-03-27 17:46:43 +01:00
PhatPhuckDave	5c5fbac63f	Make doublestar a little cleaner	2025-03-27 17:21:13 +01:00
PhatPhuckDave	3e818e61c7	Add string.format shortcut to lua	2025-03-27 15:38:07 +01:00
PhatPhuckDave	001470ffe4	Fix up regression tests	2025-03-27 15:37:57 +01:00
PhatPhuckDave	d88a76c4e2	Fix logging of groups	2025-03-26 22:26:02 +01:00
PhatPhuckDave	d3a1f1bd96	Rework regex grouping to avoid changing the same area twice	2025-03-26 22:24:19 +01:00
PhatPhuckDave	07a5f3f1a4	Add replaceCommands to avoid index suicide	2025-03-26 21:55:34 +01:00
PhatPhuckDave	e2257e082a	Add a regression test	2025-03-26 21:55:17 +01:00
PhatPhuckDave	b3fce4244d	Fix regex for numbers to support negative numbers	2025-03-26 18:30:21 +01:00
PhatPhuckDave	bd443067b6	Add support for !num inside of named capture groups	2025-03-26 14:04:39 +01:00
PhatPhuckDave	a9b6f7f984	Implement printing from lua	2025-03-26 13:37:39 +01:00
PhatPhuckDave	10c39b02a0	Fix some regex tests	2025-03-26 13:13:53 +01:00
PhatPhuckDave	7f4392b10e	Implement "replacement" variable that simply replaces the match	2025-03-26 13:00:52 +01:00
PhatPhuckDave	7e19cf4e2c	Rework named captures to be array To comply with the whole reverse replacing	2025-03-26 12:50:55 +01:00
PhatPhuckDave	c5fb20e96a	Implement named capture groups	2025-03-26 12:28:28 +01:00
PhatPhuckDave	a8c2257f20	Add named capture group tests	2025-03-26 12:17:01 +01:00
PhatPhuckDave	b63b4d1352	Add some more shorthands for regex	2025-03-26 12:06:04 +01:00
PhatPhuckDave	6a3d44ccd0	Redo what claude removed	2025-03-26 11:42:00 +01:00
PhatPhuckDave	c22e6ff41f	Code polish	2025-03-26 11:40:23 +01:00
PhatPhuckDave	068c64d714	Fix up file reseting	2025-03-26 11:10:43 +01:00
PhatPhuckDave	2c7a4f5d97	Add a lot more logs to regex What the fuck is going on?	2025-03-26 03:30:08 +01:00
PhatPhuckDave	0d7d251e76	Implement git reset	2025-03-26 03:23:16 +01:00
PhatPhuckDave	0d8c447ff6	Add support for git ie. automatically resetting changes to ensure clean slate	2025-03-26 03:22:05 +01:00
PhatPhuckDave	bb14087598	Fix oopsie	2025-03-26 02:52:28 +01:00
PhatPhuckDave	66a522aa12	Try to include xml node children in lua table	2025-03-26 02:50:33 +01:00
PhatPhuckDave	1a4b4f76f2	Map the weird numeric escapes to textual ones	2025-03-26 02:34:21 +01:00
PhatPhuckDave	2bfd9f951e	Fix up some more xml tests and other small bugs	2025-03-26 02:17:42 +01:00
PhatPhuckDave	e5092edf53	Implement parsing xml to and from lua A lot more complex than json.........	2025-03-26 01:36:49 +01:00
PhatPhuckDave	e31c0e4e8f	Implement xpath (by calling library)	2025-03-26 01:19:41 +01:00
PhatPhuckDave	73d93367a0	Refactor some things around a little	2025-03-25 23:16:03 +01:00
PhatPhuckDave	64f690f6b4	Fix usage to reflect recent flag changes	2025-03-25 23:02:32 +01:00
		`@@ -1 +0,0 @@`
			`<config><item><value>100</value></item></config>`