Add rimworld cook file

It's really not necessary

.gitignore

@@ -1 +1,2 @@
 *.exe
+.qodo

.vscode/launch.json

@@ -5,16 +5,63 @@
 	"version": "0.2.0",
 	"configurations": [
 		{
-			"name": "Launch Package",
+			"name": "Launch Package (Barotrauma)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
+			"args": [
+				"-loglevel",
+				"trace",
+				"-cook",
+				"*.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Barotrauma cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
+			"args": [
+				"-loglevel",
+				"trace",
+				"-cook",
+				"cookassistant.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Quasimorph cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
+			"args": [
+				"cook.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Rimworld cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
+			"args": [
+				"cookVehicles.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Workspace)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"args": [
-				"-mode=json",
-				"$..name",
-				"v='pero'",
-				"test.json"
+				"tester.yml",
 			]
 		}
 	]

TalentsMechanic.xml

@@ -1,651 +0,0 @@
-<?xml version="1.0" encoding="utf-8"?>
-<Talents>
-  <Talent identifier="powerarmor">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.powerarmor">
-      <Replace tag="[bonusmovement]" value="25" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionHasItem tags="deepdivinglarge" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AddedRecipe itemidentifier="exosuit"/>
-  </Talent>
-  
-  <Talent identifier="foolhardy">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.lowhealthstatboost">
-      <Replace tag="[health]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
-              <Affliction identifier="foolhardy" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-
-  <Talent identifier="berserker">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.lowhealthstatboost">
-      <Replace tag="[health]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
-              <Affliction identifier="berserker" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="mudraptorwrestler">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.mudraptorwrestler">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattypeself">
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData weapontype="NoWeapon,Melee" />
-        <AbilityConditionCharacter>
-          <Conditional group="eq mudraptor" />
-        </AbilityConditionCharacter>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="heavylifting">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.heavylifting">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionHoldingItem tags="alienartifact,crate"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-
-  <Talent identifier="iamthatguy">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.iamthatguy">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.skillbonus">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
-      <Abilities>
-        <CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="heavywrench"/>
-  </Talent>
-  
-  <Talent identifier="robotics">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.robotics"/>
-    <Description tag="talentdescription.roboticsreminder">
-      <Replace tag="[amount]" value="2" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="defensebotspawner"/>
-    <AddedRecipe itemidentifier="defensebotammobox"/>
-  </Talent>
-  
-  <Talent identifier="ironstorm">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.ironstorm">
-      <Replace tag="[chance]" value="10" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="scrapcannon"/>
-  </Talent>
-  
-  <Talent identifier="residualwaste">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.residualwaste">
-      <Replace tag="[chance]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionServerRandom randomChance="0.2"/>
-        <!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
-        <AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="massproduction">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.massproduction">
-      <Replace tag="[chance]" value="40" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
-      <Conditions>
-        <AbilityConditionServerRandom randomChance="0.4" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityRemoveRandomIngredient>
-          <AbilityConditionItem category="Material"/>
-        </CharacterAbilityRemoveRandomIngredient>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="toolmaintenance">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.toolmaintenance">
-      <Replace tag="[amount]" value="1" color="gui.green"/>
-    </Description>
-    <!-- Give once when unlocking the talent -->
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <!-- Give every 60 seconds for late comers -->
-    <AbilityGroupInterval interval="60">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="miner">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
-    <Description tag="talentdescription.miner">
-      <Replace tag="[probability]" value="320" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.gainoredetachspeed">
-      <Replace tag="[amount]" value="1600" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionServerRandom randomchance="12.8"/>
-        <AbilityConditionItem tags="ore"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="retrofit">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.retrofit" />
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="ironman">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="ironhelmet"/>
-    <AddedRecipe itemidentifier="makeshiftarmor"/>
-  </Talent>
-  
-  <Talent identifier="oiledmachinery">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.oiledmachinery">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupInterval interval="60">
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
-        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
-        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="pumpndump">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.pumpndump">
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <conditions>
-        <AbilityConditionItem tags="pump"/>
-      </conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="ballastdenizen">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.ballastdenizen">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="engineengineer">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.engineengineer">
-      <Replace tag="[amount]" value="2.5" color="gui.green"/>
-      <Replace tag="[max]" value="5" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="1" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="2" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="3" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="4" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="5" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="6" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="7" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel minlevel="8" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="multifunctional">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.multifunctional">
-      <Replace tag="[powerincrease]" value="50" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData tags="wrenchitem"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData tags="crowbaritem"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="salvagecrew">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.bonusxponmission">
-      <Replace tag="[xpbonus]" value="30" color="gui.green"/>
-      <Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.salvagecrew">
-      <Replace tag="[swimbonus]" value="50" color="gui.green"/>
-      <Replace tag="[resistanceamount]" value="10" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
-      <Conditions>
-        <AbilityConditionMission missiontype="Salvage"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="1.3"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionInSubmarine submarinetype="Wreck" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="This" disabledeltatime="true">
-              <Affliction identifier="salvagecrew" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.machinemaniac">
-      <Replace tag="[bonus]" value="80" color="gui.green"/>
-      <Replace tag="[amount]" value="3" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.30">
-      <Replace tag="[requirement]" value="12" color="gui.green"/>
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
-      <Replace tag="[xpamount]" value="500" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.50">
-      <Replace tag="[requirement]" value="20" color="gui.green"/>
-      <Replace tag="[level]" value="1" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.100">
-      <Replace tag="[requirement]" value="40" color="gui.green"/>
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-
-    <!-- Give the player stats that tracks if the rewards should be given -->
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveExperience amount="2000"/>
-        <CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="tinkerer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.increasemaxrepairmechanical">
-      <Replace tag="[percentage]" value="40" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="modularrepairs">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.freeupgrade">
-      <Replace tag="[level]" value="1" color="gui.green"/>
-      <Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="repairpack"/>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-  </Talent>
-
-  <Talent identifier="hullfixer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="25" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="fixfoamgrenade"/>
-    <AddedRecipe itemidentifier="handheldstatusmonitor"/>
-  </Talent>
-
-  <Talent identifier="letitdrain">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.letitdrain"/>
-    <Description tag="talentdescription.letitdrainreminder">
-      <Replace tag="[itemcount]" value="2" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="portablepump"/>
-  </Talent>
-
-  <Talent identifier="quickfixer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.quickfixer">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[duration]" value="10" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
-              <Affliction identifier="quickfixer" amount="10.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="scrapsavant">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.doublescrapoutput" />
-    <Description tag="talentdescription.findadditionalscrap">
-      <Replace tag="[probability]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionItem tags="scrap"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
-      <Conditions>
-        <AbilityConditionItemInSubmarine submarinetype="Wreck"/>
-        <AbilityConditionItem tags="container"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="UseTarget" >
-              <SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilitySpawnItemsToContainer>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="safetyfirst">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="safetyharness"/>
-  </Talent>
-
-</Talents>

cmd/log_format_test/main.go

@@ -0,0 +1,27 @@
+package main
+
+import (
+	"modify/logger"
+	"time"
+)
+
+func main() {
+	// Initialize logger with DEBUG level
+	logger.Init(logger.LevelDebug)
+
+	// Test different log levels
+	logger.Info("This is an info message")
+	logger.Debug("This is a debug message")
+	logger.Warning("This is a warning message")
+	logger.Error("This is an error message")
+	logger.Trace("This is a trace message (not visible at DEBUG level)")
+
+	// Test with a goroutine
+	logger.SafeGo(func() {
+		time.Sleep(10 * time.Millisecond)
+		logger.Info("Message from goroutine")
+	})
+
+	// Wait for goroutine to complete
+	time.Sleep(20 * time.Millisecond)
+}

glob_test.go

@@ -1,6 +1,7 @@
 package main
 
 import (
+	"modify/utils"
 	"os"
 	"path/filepath"
 	"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
 
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
-			files, err := expandFilePatterns(tc.patterns)
+			// Convert string patterns to map[string]struct{} for ExpandGLobs
+			patternMap := make(map[string]struct{})
+			for _, pattern := range tc.patterns {
+				patternMap[pattern] = struct{}{}
+			}
+			files, err := utils.ExpandGLobs(patternMap)
 			if err != nil {
-				t.Fatalf("expandFilePatterns failed: %v", err)
+				t.Fatalf("ExpandGLobs failed: %v", err)
 			}
 
 			if len(files) != tc.expected {

go.mod

@@ -1,18 +1,38 @@
-module modify
+module cook
 
 go 1.24.1
 
 require (
-	github.com/PaesslerAG/jsonpath v0.1.1
-	github.com/antchfx/xmlquery v1.4.4
 	github.com/bmatcuk/doublestar/v4 v4.8.1
+	github.com/stretchr/testify v1.10.0
 	github.com/yuin/gopher-lua v1.1.1
+	gopkg.in/yaml.v3 v3.0.1
 )
 
 require (
-	github.com/PaesslerAG/gval v1.0.0 // indirect
-	github.com/antchfx/xpath v1.3.3 // indirect
-	github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da // indirect
-	golang.org/x/net v0.33.0 // indirect
-	golang.org/x/text v0.21.0 // indirect
+	dario.cat/mergo v1.0.0 // indirect
+	github.com/Microsoft/go-winio v0.6.2 // indirect
+	github.com/ProtonMail/go-crypto v1.1.5 // indirect
+	github.com/cloudflare/circl v1.6.0 // indirect
+	github.com/cyphar/filepath-securejoin v0.4.1 // indirect
+	github.com/davecgh/go-spew v1.1.1 // indirect
+	github.com/emirpasic/gods v1.18.1 // indirect
+	github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
+	github.com/go-git/go-billy/v5 v5.6.2 // indirect
+	github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect
+	github.com/kevinburke/ssh_config v1.2.0 // indirect
+	github.com/pjbgf/sha1cd v0.3.2 // indirect
+	github.com/pmezard/go-difflib v1.0.0 // indirect
+	github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect
+	github.com/skeema/knownhosts v1.3.1 // indirect
+	github.com/xanzy/ssh-agent v0.3.3 // indirect
+	golang.org/x/crypto v0.35.0 // indirect
+	golang.org/x/sys v0.30.0 // indirect
+	gopkg.in/warnings.v0 v0.1.2 // indirect
+)
+
+require (
+	github.com/go-git/go-git/v5 v5.14.0
+	github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect
+	golang.org/x/net v0.35.0 // indirect
 )

go.sum

@@ -1,82 +1,106 @@
-github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
-github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
-github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
-github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
-github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
-github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
-github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
-github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
-github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
+dario.cat/mergo v1.0.0 h1:AGCNq9Evsj31mOgNPcLyXc+4PNABt905YmuqPYYpBWk=
+dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk=
+github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY=
+github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY=
+github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU=
+github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4=
+github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE=
+github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8=
+github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4=
+github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio=
+github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs=
 github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
 github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
-github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da h1:oI5xCqsCo564l8iNU+DwB5epxmsaqB+rhGL0m5jtYqE=
-github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
-github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
-github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
+github.com/cloudflare/circl v1.6.0 h1:cr5JKic4HI+LkINy2lg3W2jF8sHCVTBncJr5gIIq7qk=
+github.com/cloudflare/circl v1.6.0/go.mod h1:uddAzsPgqdMAYatqJ0lsjX1oECcQLIlRpzZh3pJrofs=
+github.com/cyphar/filepath-securejoin v0.4.1 h1:JyxxyPEaktOD+GAnqIqTf9A8tHyAG22rowi7HkoSU1s=
+github.com/cyphar/filepath-securejoin v0.4.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI=
+github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
+github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
+github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
+github.com/elazarl/goproxy v1.7.2 h1:Y2o6urb7Eule09PjlhQRGNsqRfPmYI3KKQLFpCAV3+o=
+github.com/elazarl/goproxy v1.7.2/go.mod h1:82vkLNir0ALaW14Rc399OTTjyNREgmdL2cVoIbS6XaE=
+github.com/emirpasic/gods v1.18.1 h1:FXtiHYKDGKCW2KzwZKx0iC0PQmdlorYgdFG9jPXJ1Bc=
+github.com/emirpasic/gods v1.18.1/go.mod h1:8tpGGwCnJ5H4r6BWwaV6OrWmMoPhUl5jm/FMNAnJvWQ=
+github.com/gliderlabs/ssh v0.3.8 h1:a4YXD1V7xMF9g5nTkdfnja3Sxy1PVDCj1Zg4Wb8vY6c=
+github.com/gliderlabs/ssh v0.3.8/go.mod h1:xYoytBv1sV0aL3CavoDuJIQNURXkkfPA/wxQ1pL1fAU=
+github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI=
+github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic=
+github.com/go-git/go-billy/v5 v5.6.2 h1:6Q86EsPXMa7c3YZ3aLAQsMA0VlWmy43r6FHqa/UNbRM=
+github.com/go-git/go-billy/v5 v5.6.2/go.mod h1:rcFC2rAsp/erv7CMz9GczHcuD0D32fWzH+MJAU+jaUU=
+github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4=
+github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
+github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60=
+github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k=
+github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ=
+github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw=
+github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8=
+github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU=
+github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A=
+github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99/go.mod h1:1lJo3i6rXxKeerYnT8Nvf0QmHCRC1n8sfWVwXF2Frvo=
+github.com/kevinburke/ssh_config v1.2.0 h1:x584FjTGwHzMwvHx18PXxbBVzfnxogHaAReU4gf13a4=
+github.com/kevinburke/ssh_config v1.2.0/go.mod h1:CT57kijsi8u/K/BOFA39wgDQJ9CxiF4nAY/ojJ6r6mM=
+github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
+github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
+github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
+github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
+github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
+github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
+github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
+github.com/onsi/gomega v1.34.1 h1:EUMJIKUjM8sKjYbtxQI9A4z2o+rruxnzNvpknOXie6k=
+github.com/onsi/gomega v1.34.1/go.mod h1:kU1QgUvBDLXBJq618Xvm2LUX6rSAfRaFRTcdOeDLwwY=
+github.com/pjbgf/sha1cd v0.3.2 h1:a9wb0bp1oC2TGwStyn0Umc/IGKQnEgF0vVaZ8QF8eo4=
+github.com/pjbgf/sha1cd v0.3.2/go.mod h1:zQWigSxVmsHEZow5qaLtPYxpcKMMQpa09ixqBxuCS6A=
+github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
+github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
+github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
+github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
+github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
+github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
+github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 h1:n661drycOFuPLCN3Uc8sB6B/s6Z4t2xvBgU1htSHuq8=
+github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3/go.mod h1:A0bzQcvG0E7Rwjx0REVgAGH58e96+X0MeOfepqsbeW4=
+github.com/sirupsen/logrus v1.7.0/go.mod h1:yWOB1SBYBC5VeMP7gHvWumXLIWorT60ONWic61uBYv0=
+github.com/skeema/knownhosts v1.3.1 h1:X2osQ+RAjK76shCbvhHHHVl3ZlgDm8apHEHFqRjnBY8=
+github.com/skeema/knownhosts v1.3.1/go.mod h1:r7KTdC8l4uxWRyK2TpQZ/1o5HaSzh06ePQNxPwTcfiY=
+github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
+github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
+github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
+github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
+github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
+github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM=
+github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw=
 github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
 github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
-golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
-golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
-golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
-golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
-golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
-golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
-golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
-golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
-golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
-golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
-golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
-golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
-golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
-golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
-golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
-golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
-golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
-golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
-golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
-golang.org/x/net v0.33.0 h1:74SYHlV8BIgHIFC/LrYkOGIwL19eTYXQ5wc6TBuO36I=
-golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
-golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
-golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
-golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
-golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
-golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
-golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
-golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
-golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
+golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
+golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs=
+golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ=
+golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8=
+golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY=
+golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
+golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
+golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
+golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
+golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
+golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
+golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc=
+golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
-golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
-golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
-golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
-golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
-golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
-golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
-golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
-golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
-golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
-golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
-golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
-golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
-golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
-golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
-golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
-golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo=
-golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
+golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU=
+golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s=
+golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
+golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
+golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
 golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
-golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
-golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
-golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
-golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
-golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
-golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
+gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
+gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
+gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
+gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
+gopkg.in/warnings.v0 v0.1.2 h1:wFXVbFY8DY5/xOe1ECiWdKCzZlxgshcYVNkBHstARME=
+gopkg.in/warnings.v0 v0.1.2/go.mod h1:jksf8JmL6Qr/oQM2OXTHunEvvTAsrWBLb6OOjuVWRNI=
+gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
+gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
+gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
+gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=

logger/logger.go

@@ -0,0 +1,465 @@
+package logger
+
+import (
+	"bytes"
+	"fmt"
+	"io"
+	"log"
+	"os"
+	"path/filepath"
+	"runtime"
+	"strconv"
+	"strings"
+	"sync"
+	"time"
+)
+
+// LogLevel defines the severity of log messages
+type LogLevel int
+
+const (
+	// LevelError is for critical errors that should always be displayed
+	LevelError LogLevel = iota
+	// LevelWarning is for important warnings
+	LevelWarning
+	// LevelInfo is for informational messages
+	LevelInfo
+	// LevelDebug is for detailed debugging information
+	LevelDebug
+	// LevelTrace is for very detailed tracing information
+	LevelTrace
+	// LevelLua is specifically for output from Lua scripts
+	LevelLua
+)
+
+var levelNames = map[LogLevel]string{
+	LevelError:   "ERROR",
+	LevelWarning: "WARNING",
+	LevelInfo:    "INFO",
+	LevelDebug:   "DEBUG",
+	LevelTrace:   "TRACE",
+	LevelLua:     "LUA",
+}
+
+var levelColors = map[LogLevel]string{
+	LevelError:   "\033[1;31m", // Bold Red
+	LevelWarning: "\033[1;33m", // Bold Yellow
+	LevelInfo:    "\033[1;32m", // Bold Green
+	LevelDebug:   "\033[1;36m", // Bold Cyan
+	LevelTrace:   "\033[1;35m", // Bold Magenta
+	LevelLua:     "\033[1;34m", // Bold Blue
+}
+
+// ResetColor is the ANSI code to reset text color
+const ResetColor = "\033[0m"
+
+// Logger is our custom logger with level support
+type Logger struct {
+	mu            sync.Mutex
+	out           io.Writer
+	currentLevel  LogLevel
+	prefix        string
+	flag          int
+	useColors     bool
+	callerOffset  int
+	defaultFields map[string]interface{}
+	showGoroutine bool
+}
+
+var (
+	// DefaultLogger is the global logger instance
+	DefaultLogger *Logger
+	// defaultLogLevel is the default log level if not specified
+	defaultLogLevel = LevelInfo
+	// Global mutex for DefaultLogger initialization
+	initMutex sync.Mutex
+)
+
+// ParseLevel converts a string log level to LogLevel
+func ParseLevel(levelStr string) LogLevel {
+	switch strings.ToUpper(levelStr) {
+	case "ERROR":
+		return LevelError
+	case "WARNING", "WARN":
+		return LevelWarning
+	case "INFO":
+		return LevelInfo
+	case "DEBUG":
+		return LevelDebug
+	case "TRACE":
+		return LevelTrace
+	case "LUA":
+		return LevelLua
+	default:
+		return defaultLogLevel
+	}
+}
+
+// String returns the string representation of the log level
+func (l LogLevel) String() string {
+	if name, ok := levelNames[l]; ok {
+		return name
+	}
+	return fmt.Sprintf("Level(%d)", l)
+}
+
+// New creates a new Logger instance
+func New(out io.Writer, prefix string, flag int) *Logger {
+	return &Logger{
+		out:           out,
+		currentLevel:  defaultLogLevel,
+		prefix:        prefix,
+		flag:          flag,
+		useColors:     true,
+		callerOffset:  0,
+		defaultFields: make(map[string]interface{}),
+		showGoroutine: true,
+	}
+}
+
+// Init initializes the DefaultLogger
+func Init(level LogLevel) {
+	initMutex.Lock()
+	defer initMutex.Unlock()
+
+	if DefaultLogger == nil {
+		DefaultLogger = New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
+	}
+	DefaultLogger.SetLevel(level)
+}
+
+// SetLevel sets the current log level
+func (l *Logger) SetLevel(level LogLevel) {
+	l.mu.Lock()
+	defer l.mu.Unlock()
+	l.currentLevel = level
+}
+
+// GetLevel returns the current log level
+func (l *Logger) GetLevel() LogLevel {
+	l.mu.Lock()
+	defer l.mu.Unlock()
+	return l.currentLevel
+}
+
+// SetCallerOffset sets the caller offset for correct file and line reporting
+func (l *Logger) SetCallerOffset(offset int) {
+	l.mu.Lock()
+	defer l.mu.Unlock()
+	l.callerOffset = offset
+}
+
+// SetShowGoroutine sets whether to include goroutine ID in log messages
+func (l *Logger) SetShowGoroutine(show bool) {
+	l.mu.Lock()
+	defer l.mu.Unlock()
+	l.showGoroutine = show
+}
+
+// ShowGoroutine returns whether goroutine ID is included in log messages
+func (l *Logger) ShowGoroutine() bool {
+	l.mu.Lock()
+	defer l.mu.Unlock()
+	return l.showGoroutine
+}
+
+// WithField adds a field to the logger's context
+func (l *Logger) WithField(key string, value interface{}) *Logger {
+	newLogger := &Logger{
+		out:           l.out,
+		currentLevel:  l.currentLevel,
+		prefix:        l.prefix,
+		flag:          l.flag,
+		useColors:     l.useColors,
+		callerOffset:  l.callerOffset,
+		defaultFields: make(map[string]interface{}),
+		showGoroutine: l.showGoroutine,
+	}
+
+	// Copy existing fields
+	for k, v := range l.defaultFields {
+		newLogger.defaultFields[k] = v
+	}
+
+	// Add new field
+	newLogger.defaultFields[key] = value
+	return newLogger
+}
+
+// WithFields adds multiple fields to the logger's context
+func (l *Logger) WithFields(fields map[string]interface{}) *Logger {
+	newLogger := &Logger{
+		out:           l.out,
+		currentLevel:  l.currentLevel,
+		prefix:        l.prefix,
+		flag:          l.flag,
+		useColors:     l.useColors,
+		callerOffset:  l.callerOffset,
+		defaultFields: make(map[string]interface{}),
+		showGoroutine: l.showGoroutine,
+	}
+
+	// Copy existing fields
+	for k, v := range l.defaultFields {
+		newLogger.defaultFields[k] = v
+	}
+
+	// Add new fields
+	for k, v := range fields {
+		newLogger.defaultFields[k] = v
+	}
+	return newLogger
+}
+
+// GetGoroutineID extracts the goroutine ID from the runtime stack
+func GetGoroutineID() string {
+	buf := make([]byte, 64)
+	n := runtime.Stack(buf, false)
+	// Format of first line is "goroutine N [state]:"
+	// We only need the N part
+	buf = buf[:n]
+	idField := bytes.Fields(bytes.Split(buf, []byte{':'})[0])[1]
+	return string(idField)
+}
+
+// formatMessage formats a log message with level, time, file, and line information
+func (l *Logger) formatMessage(level LogLevel, format string, args ...interface{}) string {
+	var msg string
+	if len(args) > 0 {
+		msg = fmt.Sprintf(format, args...)
+	} else {
+		msg = format
+	}
+
+	// Format default fields if any
+	var fields string
+	if len(l.defaultFields) > 0 {
+		var pairs []string
+		for k, v := range l.defaultFields {
+			pairs = append(pairs, fmt.Sprintf("%s=%v", k, v))
+		}
+		fields = " " + strings.Join(pairs, " ")
+	}
+
+	var levelColor, resetColor string
+	if l.useColors {
+		levelColor = levelColors[level]
+		resetColor = ResetColor
+	}
+
+	var caller string
+	if l.flag&log.Lshortfile != 0 || l.flag&log.Llongfile != 0 {
+		// Find the actual caller by scanning up the stack
+		// until we find a function outside the logger package
+		var file string
+		var line int
+		var ok bool
+
+		// Start at a reasonable depth and scan up to 10 frames
+		for depth := 4; depth < 15; depth++ {
+			_, file, line, ok = runtime.Caller(depth)
+			if !ok {
+				break
+			}
+
+			// If the caller is not in the logger package, we found our caller
+			if !strings.Contains(file, "logger/logger.go") {
+				break
+			}
+		}
+
+		if !ok {
+			file = "???"
+			line = 0
+		}
+
+		if l.flag&log.Lshortfile != 0 {
+			file = filepath.Base(file)
+		}
+		caller = fmt.Sprintf("%-25s ", file+":"+strconv.Itoa(line))
+	}
+
+	// Format the timestamp with fixed width
+	var timeStr string
+	if l.flag&(log.Ldate|log.Ltime|log.Lmicroseconds) != 0 {
+		t := time.Now()
+		if l.flag&log.Ldate != 0 {
+			timeStr += fmt.Sprintf("%04d/%02d/%02d ", t.Year(), t.Month(), t.Day())
+		}
+		if l.flag&(log.Ltime|log.Lmicroseconds) != 0 {
+			timeStr += fmt.Sprintf("%02d:%02d:%02d", t.Hour(), t.Minute(), t.Second())
+			if l.flag&log.Lmicroseconds != 0 {
+				timeStr += fmt.Sprintf(".%06d", t.Nanosecond()/1000)
+			}
+		}
+		timeStr = fmt.Sprintf("%-15s ", timeStr)
+	}
+
+	// Add goroutine ID if enabled, with fixed width
+	var goroutineStr string
+	if l.showGoroutine {
+		goroutineID := GetGoroutineID()
+		goroutineStr = fmt.Sprintf("[g:%-4s] ", goroutineID)
+	}
+
+	// Create a colored level indicator with both brackets colored
+	levelStr := fmt.Sprintf("%s[%s]%s", levelColor, levelNames[level], levelColor)
+	// Add a space after the level and before the reset color
+	levelColumn := fmt.Sprintf("%s %s", levelStr, resetColor)
+
+	return fmt.Sprintf("%s%s%s%s%s%s%s\n",
+		l.prefix, timeStr, caller, goroutineStr, levelColumn, msg, fields)
+}
+
+// log logs a message at the specified level
+func (l *Logger) log(level LogLevel, format string, args ...interface{}) {
+	// Always show LUA level logs regardless of the current log level
+	if level != LevelLua && level > l.currentLevel {
+		return
+	}
+
+	l.mu.Lock()
+	defer l.mu.Unlock()
+
+	msg := l.formatMessage(level, format, args...)
+	fmt.Fprint(l.out, msg)
+}
+
+// Error logs an error message
+func (l *Logger) Error(format string, args ...interface{}) {
+	l.log(LevelError, format, args...)
+}
+
+// Warning logs a warning message
+func (l *Logger) Warning(format string, args ...interface{}) {
+	l.log(LevelWarning, format, args...)
+}
+
+// Info logs an informational message
+func (l *Logger) Info(format string, args ...interface{}) {
+	l.log(LevelInfo, format, args...)
+}
+
+// Debug logs a debug message
+func (l *Logger) Debug(format string, args ...interface{}) {
+	l.log(LevelDebug, format, args...)
+}
+
+// Trace logs a trace message
+func (l *Logger) Trace(format string, args ...interface{}) {
+	l.log(LevelTrace, format, args...)
+}
+
+// Lua logs a Lua message
+func (l *Logger) Lua(format string, args ...interface{}) {
+	l.log(LevelLua, format, args...)
+}
+
+// Global log functions that use DefaultLogger
+
+// Error logs an error message using the default logger
+func Error(format string, args ...interface{}) {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	DefaultLogger.Error(format, args...)
+}
+
+// Warning logs a warning message using the default logger
+func Warning(format string, args ...interface{}) {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	DefaultLogger.Warning(format, args...)
+}
+
+// Info logs an informational message using the default logger
+func Info(format string, args ...interface{}) {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	DefaultLogger.Info(format, args...)
+}
+
+// Debug logs a debug message using the default logger
+func Debug(format string, args ...interface{}) {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	DefaultLogger.Debug(format, args...)
+}
+
+// Trace logs a trace message using the default logger
+func Trace(format string, args ...interface{}) {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	DefaultLogger.Trace(format, args...)
+}
+
+// Lua logs a Lua message using the default logger
+func Lua(format string, args ...interface{}) {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	DefaultLogger.Lua(format, args...)
+}
+
+// LogPanic logs a panic error and its stack trace
+func LogPanic(r interface{}) {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	stack := make([]byte, 4096)
+	n := runtime.Stack(stack, false)
+	DefaultLogger.Error("PANIC: %v\n%s", r, stack[:n])
+}
+
+// SetLevel sets the log level for the default logger
+func SetLevel(level LogLevel) {
+	if DefaultLogger == nil {
+		Init(level)
+		return
+	}
+	DefaultLogger.SetLevel(level)
+}
+
+// GetLevel gets the log level for the default logger
+func GetLevel() LogLevel {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	return DefaultLogger.GetLevel()
+}
+
+// WithField returns a new logger with the field added to the default logger's context
+func WithField(key string, value interface{}) *Logger {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	return DefaultLogger.WithField(key, value)
+}
+
+// WithFields returns a new logger with the fields added to the default logger's context
+func WithFields(fields map[string]interface{}) *Logger {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	return DefaultLogger.WithFields(fields)
+}
+
+// SetShowGoroutine enables or disables goroutine ID display in the default logger
+func SetShowGoroutine(show bool) {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	DefaultLogger.SetShowGoroutine(show)
+}
+
+// ShowGoroutine returns whether goroutine ID is included in default logger's messages
+func ShowGoroutine() bool {
+	if DefaultLogger == nil {
+		Init(defaultLogLevel)
+	}
+	return DefaultLogger.ShowGoroutine()
+}

logger/panic_handler.go

@@ -0,0 +1,49 @@
+package logger
+
+import (
+	"fmt"
+	"runtime/debug"
+)
+
+// PanicHandler handles a panic and logs it
+func PanicHandler() {
+	if r := recover(); r != nil {
+		goroutineID := GetGoroutineID()
+		stackTrace := debug.Stack()
+		Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
+	}
+}
+
+// SafeGo launches a goroutine with panic recovery
+// Usage: logger.SafeGo(func() { ... your code ... })
+func SafeGo(f func()) {
+	go func() {
+		defer PanicHandler()
+		f()
+	}()
+}
+
+// SafeGoWithArgs launches a goroutine with panic recovery and passes arguments
+// Usage: logger.SafeGoWithArgs(func(arg1, arg2 interface{}) { ... }, "value1", 42)
+func SafeGoWithArgs(f func(...interface{}), args ...interface{}) {
+	go func() {
+		defer PanicHandler()
+		f(args...)
+	}()
+}
+
+// SafeExec executes a function with panic recovery
+// Useful for code that should not panic
+func SafeExec(f func()) (err error) {
+	defer func() {
+		if r := recover(); r != nil {
+			goroutineID := GetGoroutineID()
+			stackTrace := debug.Stack()
+			Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
+			err = fmt.Errorf("panic recovered: %v", r)
+		}
+	}()
+
+	f()
+	return nil
+}

main.go

@@ -3,13 +3,17 @@ package main
 import (
 	"flag"
 	"fmt"
-	"log"
 	"os"
+	"sort"
 	"sync"
+	"time"
 
-	"github.com/bmatcuk/doublestar/v4"
+	"cook/processor"
+	"cook/utils"
 
-	"modify/processor"
+	"github.com/go-git/go-git/v5"
+
+	"cook/logger"
 )
 
 type GlobalStats struct {
@@ -17,36 +21,30 @@ type GlobalStats struct {
 	TotalModifications      int
 	ProcessedFiles          int
 	FailedFiles             int
+	ModificationsPerCommand sync.Map
 }
 
-var stats GlobalStats
-var logger *log.Logger
-
 var (
-	jsonFlag = flag.Bool("json", false, "Process JSON files")
-	xmlFlag  = flag.Bool("xml", false, "Process XML files")
-)
-
-func init() {
-	log.SetFlags(log.Lmicroseconds | log.Lshortfile)
-	logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
-
-	stats = GlobalStats{}
+	repo     *git.Repository
+	worktree *git.Worktree
+	stats    GlobalStats = GlobalStats{
+		ModificationsPerCommand: sync.Map{},
 	}
+)
 
 func main() {
 	flag.Usage = func() {
 		fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nOptions:\n")
-		fmt.Fprintf(os.Stderr, "  -mode string\n")
-		fmt.Fprintf(os.Stderr, "        Processing mode: regex, xml, json (default \"regex\")\n")
+		fmt.Fprintf(os.Stderr, "  -git\n")
+		fmt.Fprintf(os.Stderr, "        Use git to manage files\n")
+		fmt.Fprintf(os.Stderr, "  -reset\n")
+		fmt.Fprintf(os.Stderr, "        Reset files to their original state\n")
+		fmt.Fprintf(os.Stderr, "  -loglevel string\n")
+		fmt.Fprintf(os.Stderr, "        Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
 		fmt.Fprintf(os.Stderr, "\nExamples:\n")
 		fmt.Fprintf(os.Stderr, "  Regex mode (default):\n")
 		fmt.Fprintf(os.Stderr, "    %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
-		fmt.Fprintf(os.Stderr, "  XML mode:\n")
-		fmt.Fprintf(os.Stderr, "    %s -mode=xml -xpath=\"//value\" \"*1.5\" data.xml\n", os.Args[0])
-		fmt.Fprintf(os.Stderr, "  JSON mode:\n")
-		fmt.Fprintf(os.Stderr, "    %s -mode=json -jsonpath=\"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
 		fmt.Fprintf(os.Stderr, "      s1, s2, etc. are used to refer to capture groups as strings.\n")
 		fmt.Fprintf(os.Stderr, "      Helper functions: num(str) converts string to number, str(num) converts number to string\n")
@@ -55,106 +53,275 @@ func main() {
 		fmt.Fprintf(os.Stderr, "      You can use any valid Lua code, including if statements, loops, etc.\n")
 		fmt.Fprintf(os.Stderr, "      Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
 	}
-
+	// TODO: Fix bed shitting when doing *.yml in barotrauma directory
 	flag.Parse()
 	args := flag.Args()
 
-	if len(args) < 3 {
-		log.Printf("At least %d arguments are required", 3)
+	level := logger.ParseLevel(*utils.LogLevel)
+	logger.Init(level)
+	logger.Info("Initializing with log level: %s", level.String())
+
+	// The plan is:
+	// Load all commands
+	commands, err := utils.LoadCommands(args)
+	if err != nil {
+		logger.Error("Failed to load commands: %v", err)
 		flag.Usage()
 		return
 	}
 
-	// Get the appropriate pattern and expression based on mode
-	var pattern, luaExpr string
-	var filePatterns []string
-
-	pattern = args[0]
-	luaExpr = args[1]
-	filePatterns = args[2:]
-
-	// Prepare the Lua expression
-	originalLuaExpr := luaExpr
-	luaExpr = processor.BuildLuaScript(luaExpr)
-	if originalLuaExpr != luaExpr {
-		logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
+	if *utils.Filter != "" {
+		logger.Info("Filtering commands by name: %s", *utils.Filter)
+		commands = utils.FilterCommands(commands, *utils.Filter)
+		logger.Info("Filtered %d commands", len(commands))
 	}
 
-	// Expand file patterns with glob support
-	files, err := expandFilePatterns(filePatterns)
+	// Then aggregate all the globs and deduplicate them
+	globs := utils.AggregateGlobs(commands)
+	logger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
+
+	for _, command := range commands {
+		logger.Trace("Command: %s", command.Name)
+		logger.Trace("Regex: %s", command.Regex)
+		logger.Trace("Files: %v", command.Files)
+		logger.Trace("Lua: %s", command.Lua)
+		logger.Trace("Git: %t", command.Git)
+		logger.Trace("Reset: %t", command.Reset)
+		logger.Trace("Isolate: %t", command.Isolate)
+		logger.Trace("LogLevel: %s", command.LogLevel)
+	}
+
+	// Resolve all the files for all the globs
+	logger.Info("Found %d unique file patterns", len(globs))
+	files, err := utils.ExpandGLobs(globs)
 	if err != nil {
-		fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
+		logger.Error("Failed to expand file patterns: %v", err)
+		return
+	}
+	logger.Info("Found %d files to process", len(files))
+
+	// Somehow connect files to commands via globs..
+	// For each file check every glob of every command
+	// Maybe memoize this part
+	// That way we know what commands affect what files
+	associations, err := utils.AssociateFilesWithCommands(files, commands)
+	if err != nil {
+		logger.Error("Failed to associate files with commands: %v", err)
 		return
 	}
 
-	if len(files) == 0 {
-		fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
-		return
-	}
+	// Then for each file run all commands associated with the file
+	workers := make(chan struct{}, *utils.ParallelFiles)
+	wg := sync.WaitGroup{}
 
-	// Create the processor based on mode
-	var proc processor.Processor
-	switch {
-	case *xmlFlag:
-		proc = &processor.XMLProcessor{}
-		logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
-			pattern, luaExpr, len(files))
-	case *jsonFlag:
-		proc = &processor.JSONProcessor{}
-		logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
-			pattern, luaExpr, len(files))
-	default:
-		proc = &processor.RegexProcessor{}
-		logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
-			pattern, luaExpr, len(files))
-	}
+	// Add performance tracking
+	startTime := time.Now()
+	var fileMutex sync.Mutex
 
-	var wg sync.WaitGroup
-	// Process each file
-	for _, file := range files {
-		wg.Add(1)
-		go func(file string) {
-			defer wg.Done()
-			logger.Printf("Processing file: %s", file)
-
-			modCount, matchCount, err := proc.Process(file, pattern, luaExpr)
-			if err != nil {
-				fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
-				stats.FailedFiles++
+	// Create a map to store loggers for each command
+	commandLoggers := make(map[string]*logger.Logger)
+	for _, command := range commands {
+		// Create a named logger for each command
+		cmdName := command.Name
+		if cmdName == "" {
+			// If no name is provided, use a short version of the regex pattern
+			if len(command.Regex) > 20 {
+				cmdName = command.Regex[:17] + "..."
 			} else {
-				logger.Printf("Successfully processed file: %s", file)
-				stats.ProcessedFiles++
-				stats.TotalMatches += matchCount
-				stats.TotalModifications += modCount
+				cmdName = command.Regex
 			}
-		}(file)
+		}
+
+		// Parse the log level for this specific command
+		cmdLogLevel := logger.ParseLevel(command.LogLevel)
+
+		// Create a logger with the command name as a field
+		commandLoggers[command.Name] = logger.WithField("command", cmdName)
+		commandLoggers[command.Name].SetLevel(cmdLogLevel)
+
+		logger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
+	}
+
+	// This aggregation is great but what if one modification replaces the whole entire file?
+	// Shit......
+	// TODO: Add "Isolate" field to modifications which makes them run alone
+	for file, association := range associations {
+		workers <- struct{}{}
+		wg.Add(1)
+		logger.SafeGoWithArgs(func(args ...interface{}) {
+			defer func() { <-workers }()
+			defer wg.Done()
+
+			// Track per-file processing time
+			fileStartTime := time.Now()
+
+			fileData, err := os.ReadFile(file)
+			if err != nil {
+				logger.Error("Failed to read file %q: %v", file, err)
+				return
+			}
+			fileDataStr := string(fileData)
+
+			fileDataStr, err = RunIsolateCommands(association, file, fileDataStr, &fileMutex)
+			if err != nil {
+				logger.Error("Failed to run isolate commands for file %q: %v", file, err)
+				return
+			}
+
+			fileDataStr, err = RunOtherCommands(file, fileDataStr, association, &fileMutex, commandLoggers)
+			if err != nil {
+				logger.Error("Failed to run other commands for file %q: %v", file, err)
+				return
+			}
+
+			err = os.WriteFile(file, []byte(fileDataStr), 0644)
+			if err != nil {
+				logger.Error("Failed to write file %q: %v", file, err)
+				return
+			}
+
+			logger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
+		}, file, commands)
 	}
 	wg.Wait()
 
+	processingTime := time.Since(startTime)
+	logger.Info("Processing completed in %v", processingTime)
+	if stats.ProcessedFiles > 0 {
+		logger.Info("Average time per file: %v", processingTime/time.Duration(stats.ProcessedFiles))
+	}
+
+	// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
+	// Do that with logger.WithField("loglevel", level.String())
+	// Since each command also has its own log level
+	// TODO: Maybe even figure out how to run individual commands...?
+	// TODO: What to do with git? Figure it out ....
+
+	// if *gitFlag {
+	// 	logger.Info("Git integration enabled, setting up git repository")
+	// 	err := setupGit()
+	// 	if err != nil {
+	// 		logger.Error("Failed to setup git: %v", err)
+	// 		fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
+	// 		return
+	// 	}
+	// }
+
+	// logger.Debug("Expanding file patterns")
+	// files, err := expandFilePatterns(filePatterns)
+	// if err != nil {
+	// 	logger.Error("Failed to expand file patterns: %v", err)
+	// 	fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
+	// 	return
+	// }
+
+	// if *gitFlag {
+	// 	logger.Info("Cleaning up git files before processing")
+	// 	err := cleanupGitFiles(files)
+	// 	if err != nil {
+	// 		logger.Error("Failed to cleanup git files: %v", err)
+	// 		fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
+	// 		return
+	// 	}
+	// }
+	// if *resetFlag {
+	// 	logger.Info("Files reset to their original state, nothing more to do")
+	// 	log.Printf("Files reset to their original state, nothing more to do")
+	// 	return
+	// }
+
 	// Print summary
 	if stats.TotalModifications == 0 {
-		fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
+		logger.Warning("No modifications were made in any files")
 	} else {
-		fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
+		logger.Info("Operation complete! Modified %d values in %d/%d files",
 			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
-	}
-}
+		sortedCommands := []string{}
+		stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
+			sortedCommands = append(sortedCommands, key.(string))
+			return true
+		})
+		sort.Strings(sortedCommands)
 
-func expandFilePatterns(patterns []string) ([]string, error) {
-	var files []string
-	filesMap := make(map[string]bool)
-
-	for _, pattern := range patterns {
-		matches, _ := doublestar.Glob(os.DirFS("."), pattern)
-		for _, m := range matches {
-			if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
-				filesMap[m], files = true, append(files, m)
+		for _, command := range sortedCommands {
+			count, _ := stats.ModificationsPerCommand.Load(command)
+			if count.(int) > 0 {
+				logger.Info("\tCommand %q made %d modifications", command, count)
+			} else {
+				logger.Warning("\tCommand %q made no modifications", command)
+			}
 		}
 	}
 }
 
-	if len(files) > 0 {
-		logger.Printf("Found %d files to process", len(files))
+func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, fileMutex *sync.Mutex, commandLoggers map[string]*logger.Logger) (string, error) {
+	// Aggregate all the modifications and execute them
+	modifications := []utils.ReplaceCommand{}
+	for _, command := range association.Commands {
+		// Use command-specific logger if available, otherwise fall back to default logger
+		cmdLogger := logger.DefaultLogger
+		if cmdLog, ok := commandLoggers[command.Name]; ok {
+			cmdLogger = cmdLog
 		}
-	return files, nil
+
+		cmdLogger.Info("Processing file %q with command %q", file, command.Regex)
+		newModifications, err := processor.ProcessRegex(fileDataStr, command, file)
+		if err != nil {
+			return fileDataStr, fmt.Errorf("failed to process file %q with command %q: %w", file, command.Regex, err)
+		}
+		modifications = append(modifications, newModifications...)
+		// It is not guranteed that all the commands will be executed...
+		// TODO: Make this better
+		// We'd have to pass the map to executemodifications or something...
+		count, ok := stats.ModificationsPerCommand.Load(command.Name)
+		if !ok {
+			count = 0
+		}
+		stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
+
+		cmdLogger.Debug("Command %q generated %d modifications", command.Name, len(newModifications))
+	}
+
+	if len(modifications) == 0 {
+		logger.Info("No modifications found for file %q", file)
+		return fileDataStr, nil
+	}
+
+	// Sort commands in reverse order for safe replacements
+	var count int
+	fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
+
+	fileMutex.Lock()
+	stats.ProcessedFiles++
+	stats.TotalModifications += count
+	fileMutex.Unlock()
+
+	logger.Info("Executed %d modifications for file %q", count, file)
+	return fileDataStr, nil
+}
+
+func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string, fileMutex *sync.Mutex) (string, error) {
+	for _, isolateCommand := range association.IsolateCommands {
+		logger.Info("Processing file %q with isolate command %q", file, isolateCommand.Regex)
+		modifications, err := processor.ProcessRegex(fileDataStr, isolateCommand, file)
+		if err != nil {
+			return fileDataStr, fmt.Errorf("failed to process file %q with isolate command %q: %w", file, isolateCommand.Regex, err)
+		}
+
+		if len(modifications) == 0 {
+			logger.Warning("No modifications found for file %q", file)
+			return fileDataStr, nil
+		}
+
+		var count int
+		fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
+
+		fileMutex.Lock()
+		stats.ProcessedFiles++
+		stats.TotalModifications += count
+		fileMutex.Unlock()
+
+		logger.Info("Executed %d isolate modifications for file %q", count, file)
+	}
+	return fileDataStr, nil
 }

processor/json.go

@@ -1,217 +0,0 @@
-package processor
-
-import (
-	"encoding/json"
-	"fmt"
-	"log"
-	"modify/processor/jsonpath"
-	"os"
-	"path/filepath"
-
-	lua "github.com/yuin/gopher-lua"
-)
-
-// JSONProcessor implements the Processor interface for JSON documents
-type JSONProcessor struct{}
-
-// Process implements the Processor interface for JSONProcessor
-func (p *JSONProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
-	// Read file content
-	cwd, err := os.Getwd()
-	if err != nil {
-		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
-	}
-
-	fullPath := filepath.Join(cwd, filename)
-	content, err := os.ReadFile(fullPath)
-	if err != nil {
-		return 0, 0, fmt.Errorf("error reading file: %v", err)
-	}
-
-	fileContent := string(content)
-
-	// Process the content
-	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
-	if err != nil {
-		return 0, 0, err
-	}
-
-	// If we made modifications, save the file
-	if modCount > 0 {
-		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
-		if err != nil {
-			return 0, 0, fmt.Errorf("error writing file: %v", err)
-		}
-	}
-
-	return modCount, matchCount, nil
-}
-
-// ProcessContent implements the Processor interface for JSONProcessor
-func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
-	// Parse JSON document
-	var jsonData interface{}
-	err := json.Unmarshal([]byte(content), &jsonData)
-	if err != nil {
-		return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
-	}
-
-	// Find nodes matching the JSONPath pattern
-	nodes, err := jsonpath.Get(jsonData, pattern)
-	if err != nil {
-		return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
-	}
-
-	matchCount := len(nodes)
-	if matchCount == 0 {
-		return content, 0, 0, nil
-	}
-
-	modCount := 0
-	for _, node := range nodes {
-		log.Printf("Processing node at path: %s with value: %v", node.Path, node.Value)
-
-		// Initialize Lua
-		L, err := NewLuaState()
-		if err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
-		}
-		defer L.Close()
-		log.Println("Lua state initialized successfully.")
-
-		err = p.ToLua(L, node.Value)
-		if err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
-		}
-		log.Printf("Converted node value to Lua: %v", node.Value)
-
-		originalScript := luaExpr
-		fullScript := BuildLuaScript(luaExpr)
-		log.Printf("Original script: %q, Full script: %q", originalScript, fullScript)
-
-		// Execute Lua script
-		log.Printf("Executing Lua script: %q", fullScript)
-		if err := L.DoString(fullScript); err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
-		}
-		log.Println("Lua script executed successfully.")
-
-		// Get modified value
-		result, err := p.FromLua(L)
-		if err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
-		}
-		log.Printf("Retrieved modified value from Lua: %v", result)
-
-		modified := false
-		modified = L.GetGlobal("modified").String() == "true"
-		if !modified {
-			log.Printf("No changes made to node at path: %s", node.Path)
-			continue
-		}
-
-		// Apply the modification to the JSON data
-		err = p.updateJSONValue(jsonData, node.Path, result)
-		if err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
-		}
-		log.Printf("Updated JSON at path: %s with new value: %v", node.Path, result)
-		modCount++
-	}
-
-	// Convert the modified JSON back to a string with same formatting
-	var jsonBytes []byte
-	jsonBytes, err = json.MarshalIndent(jsonData, "", "  ")
-	if err != nil {
-		return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
-	}
-	return string(jsonBytes), modCount, matchCount, nil
-}
-
-// / 	Selects from the root node
-// // 	Selects nodes in the document from the current node that match the selection no matter where they are
-// . 	Selects the current node
-// @ 	Selects attributes
-
-// /bookstore/* 	Selects all the child element nodes of the bookstore element
-// //* 	Selects all elements in the document
-
-// /bookstore/book[1] 	Selects the first book element that is the child of the bookstore element.
-// /bookstore/book[last()] 	Selects the last book element that is the child of the bookstore element
-// /bookstore/book[last()-1] 	Selects the last but one book element that is the child of the bookstore element
-// /bookstore/book[position()<3] 	Selects the first two book elements that are children of the bookstore element
-// //title[@lang] 	Selects all the title elements that have an attribute named lang
-// //title[@lang='en'] 	Selects all the title elements that have a "lang" attribute with a value of "en"
-// /bookstore/book[price>35.00] 	Selects all the book elements of the bookstore element that have a price element with a value greater than 35.00
-// /bookstore/book[price>35.00]/title 	Selects all the title elements of the book elements of the bookstore element that have a price element with a value greater than 35.00
-
-// updateJSONValue updates a value in the JSON structure based on its JSONPath
-func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
-	// Special handling for root node
-	if path == "$" {
-		// For the root node, we'll copy the value to the jsonData reference
-		// This is a special case since we can't directly replace the interface{} variable
-
-		// We need to handle different types of root elements
-		switch rootValue := newValue.(type) {
-		case map[string]interface{}:
-			// For objects, we need to copy over all keys
-			rootMap, ok := jsonData.(map[string]interface{})
-			if !ok {
-				// If the original wasn't a map, completely replace it with the new map
-				// This is handled by the jsonpath.Set function
-				return jsonpath.Set(jsonData, path, newValue)
-			}
-
-			// Clear the original map
-			for k := range rootMap {
-				delete(rootMap, k)
-			}
-
-			// Copy all keys from the new map
-			for k, v := range rootValue {
-				rootMap[k] = v
-			}
-			return nil
-
-		case []interface{}:
-			// For arrays, we need to handle similarly
-			rootArray, ok := jsonData.([]interface{})
-			if !ok {
-				// If the original wasn't an array, use jsonpath.Set
-				return jsonpath.Set(jsonData, path, newValue)
-			}
-
-			// Clear and recreate the array
-			*&rootArray = rootValue
-			return nil
-
-		default:
-			// For other types, use jsonpath.Set
-			return jsonpath.Set(jsonData, path, newValue)
-		}
-	}
-
-	// For non-root paths, use the regular Set method
-	err := jsonpath.Set(jsonData, path, newValue)
-	if err != nil {
-		return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
-	}
-	return nil
-}
-
-// ToLua converts JSON values to Lua variables
-func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
-	table, err := ToLua(L, data)
-	if err != nil {
-		return err
-	}
-	L.SetGlobal("v", table)
-	return nil
-}
-
-// FromLua retrieves values from Lua
-func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
-	luaValue := L.GetGlobal("v")
-	return FromLua(L, luaValue)
-}

processor/jsonpath/jsonpath.go

@@ -1,490 +0,0 @@
-package jsonpath
-
-import (
-	"fmt"
-	"strconv"
-)
-
-// JSONStep represents a single step in a JSONPath query
-type JSONStep struct {
-	Type  StepType
-	Key   string // For Child/RecursiveDescent
-	Index int    // For Index (use -1 for wildcard "*")
-}
-
-// JSONNode represents a value in the JSON data with its path
-type JSONNode struct {
-	Value interface{} // The value found at the path
-	Path  string      // The exact JSONPath where the value was found
-}
-
-// StepType defines the types of steps in a JSONPath
-type StepType int
-
-const (
-	RootStep             StepType = iota // $ - The root element
-	ChildStep                            // .key - Direct child access
-	RecursiveDescentStep                 // ..key - Recursive search for key
-	WildcardStep                         // .* - All children of an object
-	IndexStep                            // [n] - Array index access (or [*] for all elements)
-)
-
-// TraversalMode determines how the traversal behaves
-type TraversalMode int
-
-const (
-	CollectMode     TraversalMode = iota // Just collect matched nodes
-	ModifyFirstMode                      // Modify first matching node
-	ModifyAllMode                        // Modify all matching nodes
-)
-
-// ParseJSONPath parses a JSONPath string into a sequence of steps
-func ParseJSONPath(path string) ([]JSONStep, error) {
-	if len(path) == 0 || path[0] != '$' {
-		return nil, fmt.Errorf("path must start with $; received: %q", path)
-	}
-
-	steps := []JSONStep{}
-	i := 0
-
-	for i < len(path) {
-		switch path[i] {
-		case '$':
-			steps = append(steps, JSONStep{Type: RootStep})
-			i++
-		case '.':
-			i++
-			if i < len(path) && path[i] == '.' {
-				// Recursive descent
-				i++
-				key, nextPos := readKey(path, i)
-				steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
-				i = nextPos
-			} else {
-				// Child step or wildcard
-				key, nextPos := readKey(path, i)
-				if key == "*" {
-					steps = append(steps, JSONStep{Type: WildcardStep})
-				} else {
-					steps = append(steps, JSONStep{Type: ChildStep, Key: key})
-				}
-				i = nextPos
-			}
-		case '[':
-			// Index step
-			i++
-			indexStr, nextPos := readIndex(path, i)
-			if indexStr == "*" {
-				steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
-			} else {
-				index, err := strconv.Atoi(indexStr)
-				if err != nil {
-					return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
-				}
-				steps = append(steps, JSONStep{Type: IndexStep, Index: index})
-			}
-			i = nextPos + 1 // Skip closing ]
-		default:
-			return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
-		}
-	}
-
-	return steps, nil
-}
-
-// readKey extracts a key name from the path
-func readKey(path string, start int) (string, int) {
-	i := start
-	for ; i < len(path); i++ {
-		if path[i] == '.' || path[i] == '[' {
-			break
-		}
-	}
-	return path[start:i], i
-}
-
-// readIndex extracts an array index or wildcard from the path
-func readIndex(path string, start int) (string, int) {
-	i := start
-	for ; i < len(path); i++ {
-		if path[i] == ']' {
-			break
-		}
-	}
-	return path[start:i], i
-}
-
-// Get retrieves values with their paths from data at the specified JSONPath
-// Each returned JSONNode contains both the value and its exact path in the data structure
-func Get(data interface{}, path string) ([]JSONNode, error) {
-	steps, err := ParseJSONPath(path)
-	if err != nil {
-		return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
-	}
-
-	results := []JSONNode{}
-	err = traverseWithPaths(data, steps, &results, "$")
-	if err != nil {
-		return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
-	}
-	return results, nil
-}
-
-// Set updates the value at the specified JSONPath in the original data structure.
-// It only modifies the first matching node.
-func Set(data interface{}, path string, value interface{}) error {
-	steps, err := ParseJSONPath(path)
-	if err != nil {
-		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
-	}
-
-	success := false
-	err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
-	if err != nil {
-		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
-	}
-	return nil
-}
-
-// SetAll updates all matching values at the specified JSONPath.
-func SetAll(data interface{}, path string, value interface{}) error {
-	steps, err := ParseJSONPath(path)
-	if err != nil {
-		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
-	}
-
-	success := false
-	err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
-	if err != nil {
-		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
-	}
-	return nil
-}
-
-// setWithPath modifies values while tracking paths
-func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
-	if node == nil || *success && mode == ModifyFirstMode {
-		return nil
-	}
-
-	// Skip root step
-	actualSteps := steps
-	if len(steps) > 0 && steps[0].Type == RootStep {
-		actualSteps = steps[1:]
-	}
-
-	// If we have no steps left, we're setting the root value
-	if len(actualSteps) == 0 {
-		// For the root node, we need to handle it differently depending on what's passed in
-		// since we can't directly replace the interface{} variable
-
-		// We'll signal success and let the JSONProcessor handle updating the root
-		*success = true
-		return nil
-	}
-
-	// Process the first step
-	step := actualSteps[0]
-	remainingSteps := actualSteps[1:]
-	isLastStep := len(remainingSteps) == 0
-
-	switch step.Type {
-	case ChildStep:
-		m, ok := node.(map[string]interface{})
-		if !ok {
-			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
-		}
-
-		childPath := currentPath + "." + step.Key
-
-		if isLastStep {
-			// We've reached the target, set the value
-			m[step.Key] = value
-			*success = true
-			return nil
-		}
-
-		// Create intermediate nodes if necessary
-		child, exists := m[step.Key]
-		if !exists {
-			// Create missing intermediate node
-			if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
-				child = []interface{}{}
-			} else {
-				child = map[string]interface{}{}
-			}
-			m[step.Key] = child
-		}
-
-		err := setWithPath(child, remainingSteps, success, value, childPath, mode)
-		if err != nil {
-			return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
-		}
-
-	case IndexStep:
-		arr, ok := node.([]interface{})
-		if !ok {
-			return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
-		}
-
-		// Handle wildcard index
-		if step.Index == -1 {
-			for i, item := range arr {
-				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
-				if isLastStep {
-					arr[i] = value
-					*success = true
-					if mode == ModifyFirstMode {
-						return nil
-					}
-				} else {
-					err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
-					if err != nil {
-						return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
-					}
-					if *success && mode == ModifyFirstMode {
-						return nil
-					}
-				}
-			}
-			return nil
-		}
-
-		// Handle specific index
-		if step.Index >= 0 && step.Index < len(arr) {
-			item := arr[step.Index]
-			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
-			if isLastStep {
-				arr[step.Index] = value
-				*success = true
-			} else {
-				err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
-				if err != nil {
-					return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
-				}
-			}
-		}
-
-	case RecursiveDescentStep:
-		// For recursive descent, first check direct match at this level
-		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
-			if val, exists := m[step.Key]; exists {
-				directPath := currentPath + "." + step.Key
-				if isLastStep {
-					m[step.Key] = value
-					*success = true
-					if mode == ModifyFirstMode {
-						return nil
-					}
-				} else {
-					err := setWithPath(val, remainingSteps, success, value, directPath, mode)
-					if err != nil {
-						return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
-					}
-					if *success && mode == ModifyFirstMode {
-						return nil
-					}
-				}
-			}
-		}
-
-		// Then continue recursion to all children
-		switch n := node.(type) {
-		case map[string]interface{}:
-			for k, v := range n {
-				childPath := currentPath + "." + k
-				// Skip keys we've already processed directly
-				if step.Key != "*" && k == step.Key {
-					continue
-				}
-				err := setWithPath(v, steps, success, value, childPath, mode)
-				if err != nil {
-					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
-				}
-				if *success && mode == ModifyFirstMode {
-					return nil
-				}
-			}
-		case []interface{}:
-			for i, v := range n {
-				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
-				err := setWithPath(v, steps, success, value, childPath, mode)
-				if err != nil {
-					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
-				}
-				if *success && mode == ModifyFirstMode {
-					return nil
-				}
-			}
-		}
-
-	case WildcardStep:
-		m, ok := node.(map[string]interface{})
-		if !ok {
-			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
-		}
-
-		for k, v := range m {
-			childPath := currentPath + "." + k
-			if isLastStep {
-				m[k] = value
-				*success = true
-				if mode == ModifyFirstMode {
-					return nil
-				}
-			} else {
-				err := setWithPath(v, remainingSteps, success, value, childPath, mode)
-				if err != nil {
-					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
-				}
-				if *success && mode == ModifyFirstMode {
-					return nil
-				}
-			}
-		}
-	}
-	return nil
-}
-
-// traverseWithPaths tracks both nodes and their paths during traversal
-func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
-	if len(steps) == 0 || node == nil {
-		return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
-	}
-
-	// Skip root step
-	actualSteps := steps
-	if steps[0].Type == RootStep {
-		if len(steps) == 1 {
-			*results = append(*results, JSONNode{Value: node, Path: currentPath})
-			return nil
-		}
-		actualSteps = steps[1:]
-	}
-
-	// Process the first step
-	step := actualSteps[0]
-	remainingSteps := actualSteps[1:]
-	isLastStep := len(remainingSteps) == 0
-
-	switch step.Type {
-	case ChildStep:
-		m, ok := node.(map[string]interface{})
-		if !ok {
-			return fmt.Errorf("node is not a map; actual type: %T", node)
-		}
-
-		child, exists := m[step.Key]
-		if !exists {
-			return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
-		}
-
-		childPath := currentPath + "." + step.Key
-		if isLastStep {
-			*results = append(*results, JSONNode{Value: child, Path: childPath})
-		} else {
-			err := traverseWithPaths(child, remainingSteps, results, childPath)
-			if err != nil {
-				return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
-			}
-		}
-
-	case IndexStep:
-		arr, ok := node.([]interface{})
-		if !ok {
-			return fmt.Errorf("node is not an array; actual type: %T", node)
-		}
-
-		// Handle wildcard index
-		if step.Index == -1 {
-			for i, item := range arr {
-				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
-				if isLastStep {
-					*results = append(*results, JSONNode{Value: item, Path: itemPath})
-				} else {
-					err := traverseWithPaths(item, remainingSteps, results, itemPath)
-					if err != nil {
-						return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
-					}
-				}
-			}
-			return nil
-		}
-
-		// Handle specific index
-		if step.Index >= 0 && step.Index < len(arr) {
-			item := arr[step.Index]
-			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
-			if isLastStep {
-				*results = append(*results, JSONNode{Value: item, Path: itemPath})
-			} else {
-				err := traverseWithPaths(item, remainingSteps, results, itemPath)
-				if err != nil {
-					return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
-				}
-			}
-		} else {
-			return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
-		}
-
-	case RecursiveDescentStep:
-		// For recursive descent, first check direct match at this level
-		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
-			if val, exists := m[step.Key]; exists {
-				directPath := currentPath + "." + step.Key
-				if isLastStep {
-					*results = append(*results, JSONNode{Value: val, Path: directPath})
-				} else {
-					err := traverseWithPaths(val, remainingSteps, results, directPath)
-					if err != nil {
-						return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
-					}
-				}
-			}
-		}
-
-		// For wildcard, collect this node
-		if step.Key == "*" && isLastStep {
-			*results = append(*results, JSONNode{Value: node, Path: currentPath})
-		}
-
-		// Then continue recursion to all children
-		switch n := node.(type) {
-		case map[string]interface{}:
-			for k, v := range n {
-				childPath := currentPath + "." + k
-				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
-				if err != nil {
-					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
-				}
-			}
-		case []interface{}:
-			for i, v := range n {
-				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
-				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
-				if err != nil {
-					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
-				}
-			}
-		}
-
-	case WildcardStep:
-		m, ok := node.(map[string]interface{})
-		if !ok {
-			return fmt.Errorf("node is not a map; actual type: %T", node)
-		}
-
-		for k, v := range m {
-			childPath := currentPath + "." + k
-			if isLastStep {
-				*results = append(*results, JSONNode{Value: v, Path: childPath})
-			} else {
-				err := traverseWithPaths(v, remainingSteps, results, childPath)
-				if err != nil {
-					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
-				}
-			}
-		}
-	}
-	return nil
-}

processor/jsonpath/jsonpath_get_set_test.go

@@ -1,577 +0,0 @@
-package jsonpath
-
-import (
-	"reflect"
-	"testing"
-)
-
-func TestGetWithPathsBasic(t *testing.T) {
-	tests := []struct {
-		name     string
-		data     map[string]interface{}
-		path     string
-		expected []JSONNode
-		error    bool
-	}{
-		{
-			name: "simple property",
-			data: map[string]interface{}{
-				"name": "John",
-				"age":  30,
-			},
-			path: "$.name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.name"},
-			},
-		},
-		{
-			name: "nested property",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-					"age":  30,
-				},
-			},
-			path: "$.user.name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.user.name"},
-			},
-		},
-		{
-			name: "array access",
-			data: map[string]interface{}{
-				"users": []interface{}{
-					map[string]interface{}{"name": "John", "age": 30},
-					map[string]interface{}{"name": "Jane", "age": 25},
-				},
-			},
-			path: "$.users[1].name",
-			expected: []JSONNode{
-				{Value: "Jane", Path: "$.users[1].name"},
-			},
-		},
-		{
-			name: "wildcard",
-			data: map[string]interface{}{
-				"users": []interface{}{
-					map[string]interface{}{"name": "John", "age": 30},
-					map[string]interface{}{"name": "Jane", "age": 25},
-				},
-			},
-			path: "$.users[*].name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.users[0].name"},
-				{Value: "Jane", Path: "$.users[1].name"},
-			},
-		},
-		{
-			name: "recursive descent",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-					"profile": map[string]interface{}{
-						"email": "john@example.com",
-					},
-				},
-				"admin": map[string]interface{}{
-					"email": "admin@example.com",
-				},
-			},
-			path: "$..email",
-			expected: []JSONNode{
-				{Value: "john@example.com", Path: "$.user.profile.email"},
-				{Value: "admin@example.com", Path: "$.admin.email"},
-			},
-		},
-		{
-			name: "nonexistent path",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-				},
-			},
-			path:     "$.user.email",
-			expected: []JSONNode{},
-			error:    true,
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(tt.data, tt.path)
-			if err != nil {
-				if !tt.error {
-					t.Errorf("GetWithPaths() returned error: %v", err)
-				}
-				return
-			}
-
-			// For nonexistent path, we expect empty slice
-			if tt.name == "nonexistent path" {
-				if len(result) > 0 {
-					t.Errorf("GetWithPaths() returned %v, expected empty result", result)
-				}
-				return
-			}
-
-			// Check if lengths match
-			if len(result) != len(tt.expected) {
-				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
-				return
-			}
-
-			// For wildcard results, we need to check containment rather than exact order
-			if tt.name == "wildcard" || tt.name == "recursive descent" {
-				// For each expected item, check if it exists in the results by both value and path
-				for _, expected := range tt.expected {
-					found := false
-					for _, r := range result {
-						if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
-							found = true
-							break
-						}
-					}
-					if !found {
-						t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
-					}
-				}
-			} else {
-				// Otherwise check exact equality of both values and paths
-				for i, expected := range tt.expected {
-					if !reflect.DeepEqual(result[i].Value, expected.Value) {
-						t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
-					}
-					if result[i].Path != expected.Path {
-						t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
-					}
-				}
-			}
-		})
-	}
-}
-
-func TestSet(t *testing.T) {
-	t.Run("simple property", func(t *testing.T) {
-		data := map[string]interface{}{
-			"name": "John",
-			"age":  30,
-		}
-		 err := Set(data, "$.name", "Jane")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		if data["name"] != "Jane" {
-			t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
-		}
-	})
-
-	t.Run("nested property", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-				"age":  30,
-			},
-		}
-		err := Set(data, "$.user.name", "Jane")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		user, ok := data["user"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-		if user["name"] != "Jane" {
-			t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
-		}
-	})
-
-	t.Run("array element", func(t *testing.T) {
-		data := map[string]interface{}{
-			"users": []interface{}{
-				map[string]interface{}{"name": "John", "age": 30},
-				map[string]interface{}{"name": "Jane", "age": 25},
-			},
-		}
-		err := Set(data, "$.users[0].name", "Bob")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-		users, ok := data["users"].([]interface{})
-		if !ok {
-			t.Fatalf("Users is not a slice")
-		}
-		user0, ok := users[0].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-		if user0["name"] != "Bob" {
-			t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
-		}
-	})
-
-	t.Run("complex value", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-				"profile": map[string]interface{}{
-					"email": "john@example.com",
-				},
-			},
-		}
-
-		newProfile := map[string]interface{}{
-			"email": "john.doe@example.com",
-			"phone": "123-456-7890",
-		}
-
-		err := Set(data, "$.user.profile", newProfile)
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		userMap, ok := data["user"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-
-		profile, ok := userMap["profile"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("Profile is not a map")
-		}
-
-		if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
-			t.Errorf("Set() failed: expected profile to be updated with new values")
-		}
-	})
-
-	t.Run("create new property", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-			},
-		}
-
-		err := Set(data, "$.user.email", "john@example.com")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-		userMap, ok := data["user"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-
-		if email, exists := userMap["email"]; !exists || email != "john@example.com" {
-			t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
-		}
-	})
-
-	t.Run("create nested properties", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-			},
-		}
-
-		err := Set(data, "$.user.contact.email", "john@example.com")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-		userMap, ok := data["user"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-
-		contact, ok := userMap["contact"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("Contact is not a map")
-		}
-
-		if email, exists := contact["email"]; !exists || email != "john@example.com" {
-			t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
-		}
-	})
-
-	t.Run("create array and element", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-			},
-		}
-
-		// This should create an empty addresses array, but won't be able to set index 0
-		// since the array is empty
-		err := Set(data, "$.user.addresses[0].street", "123 Main St")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-	})
-
-	t.Run("multiple targets (should only update first)", func(t *testing.T) {
-		data := map[string]interface{}{
-			"users": []interface{}{
-				map[string]interface{}{"active": true},
-				map[string]interface{}{"active": true},
-			},
-		}
-
-		err := Set(data, "$.users[*].active", false)
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		users, ok := data["users"].([]interface{})
-		if !ok {
-			t.Fatalf("Users is not a slice")
-		}
-
-		user0, ok := users[0].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User0 is not a map")
-		}
-
-		user1, ok := users[1].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User1 is not a map")
-		}
-
-		// Only the first one should be changed
-		if active, exists := user0["active"]; !exists || active != false {
-			t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
-		}
-
-		// The second one should remain unchanged
-		if active, exists := user1["active"]; !exists || active != true {
-			t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
-		}
-	})
-
-	t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
-		data := map[string]interface{}{
-			"name": "John",
-		}
-
-		err := Set(data, "$", "Jane")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		// Data should be unchanged
-		if data["name"] != "John" {
-			t.Errorf("Data was modified when setting on root")
-		}
-	})
-}
-
-func TestSetAll(t *testing.T) {
-	t.Run("simple property", func(t *testing.T) {
-		data := map[string]interface{}{
-			"name": "John",
-			"age":  30,
-		}
-		err := SetAll(data, "$.name", "Jane")
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-		if data["name"] != "Jane" {
-			t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
-		}
-	})
-
-	t.Run("all array elements", func(t *testing.T) {
-		data := map[string]interface{}{
-			"users": []interface{}{
-				map[string]interface{}{"active": true},
-				map[string]interface{}{"active": true},
-			},
-		}
-
-		err := SetAll(data, "$.users[*].active", false)
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-
-		users, ok := data["users"].([]interface{})
-		if !ok {
-			t.Fatalf("Users is not a slice")
-		}
-
-		// Both elements should be updated
-		for i, user := range users {
-			userMap, ok := user.(map[string]interface{})
-			if !ok {
-				t.Fatalf("User%d is not a map", i)
-			}
-
-			if active, exists := userMap["active"]; !exists || active != false {
-				t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
-			}
-		}
-	})
-
-	t.Run("recursive descent", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"profile": map[string]interface{}{
-					"active": true,
-				},
-			},
-			"admin": map[string]interface{}{
-				"profile": map[string]interface{}{
-					"active": true,
-				},
-			},
-		}
-
-		err := SetAll(data, "$..active", false)
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-
-		// Check user profile
-		userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("Failed to access user.profile")
-		}
-		if active, exists := userProfile["active"]; !exists || active != false {
-			t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
-		}
-
-		// Check admin profile
-		adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("Failed to access admin.profile")
-		}
-		if active, exists := adminProfile["active"]; !exists || active != false {
-			t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
-		}
-	})
-}
-
-func TestGetWithPathsExtended(t *testing.T) {
-	tests := []struct {
-		name     string
-		data     map[string]interface{}
-		path     string
-		expected []JSONNode
-	}{
-		{
-			name: "simple property",
-			data: map[string]interface{}{
-				"name": "John",
-				"age":  30,
-			},
-			path: "$.name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.name"},
-			},
-		},
-		{
-			name: "nested property",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-					"age":  30,
-				},
-			},
-			path: "$.user.name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.user.name"},
-			},
-		},
-		{
-			name: "array access",
-			data: map[string]interface{}{
-				"users": []interface{}{
-					map[string]interface{}{"name": "John", "age": 30},
-					map[string]interface{}{"name": "Jane", "age": 25},
-				},
-			},
-			path: "$.users[1].name",
-			expected: []JSONNode{
-				{Value: "Jane", Path: "$.users[1].name"},
-			},
-		},
-		{
-			name: "wildcard",
-			data: map[string]interface{}{
-				"users": []interface{}{
-					map[string]interface{}{"name": "John", "age": 30},
-					map[string]interface{}{"name": "Jane", "age": 25},
-				},
-			},
-			path: "$.users[*].name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.users[0].name"},
-				{Value: "Jane", Path: "$.users[1].name"},
-			},
-		},
-		{
-			name: "recursive descent",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-					"profile": map[string]interface{}{
-						"email": "john@example.com",
-					},
-				},
-				"admin": map[string]interface{}{
-					"email": "admin@example.com",
-				},
-			},
-			path: "$..email",
-			expected: []JSONNode{
-				{Value: "john@example.com", Path: "$.user.profile.email"},
-				{Value: "admin@example.com", Path: "$.admin.email"},
-			},
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(tt.data, tt.path)
-			if err != nil {
-				t.Errorf("GetWithPaths() returned error: %v", err)
-				return
-			}
-
-			// Check if lengths match
-			if len(result) != len(tt.expected) {
-				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
-				return
-			}
-
-			// For each expected item, find its match in the results and verify both value and path
-			for _, expected := range tt.expected {
-				found := false
-				for _, r := range result {
-					// Check if value matches
-					if reflect.DeepEqual(r.Value, expected.Value) {
-						found = true
-						// Check if path matches
-						if r.Path != expected.Path {
-							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
-						}
-						break
-					}
-				}
-				if !found {
-					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
-				}
-			}
-		})
-	}
-}

processor/jsonpath/jsonpath_test.go

@@ -1,318 +0,0 @@
-package jsonpath
-
-import (
-	"reflect"
-	"testing"
-)
-
-var testData = map[string]interface{}{
-	"store": map[string]interface{}{
-		"book": []interface{}{
-			map[string]interface{}{
-				"title": "The Fellowship of the Ring",
-				"price": 22.99,
-			},
-			map[string]interface{}{
-				"title": "The Two Towers",
-				"price": 23.45,
-			},
-		},
-		"bicycle": map[string]interface{}{
-			"color": "red",
-			"price": 199.95,
-		},
-	},
-}
-
-func TestParser(t *testing.T) {
-	tests := []struct {
-		path    string
-		steps   []JSONStep
-		wantErr bool
-	}{
-		{
-			path: "$.store.bicycle.color",
-			steps: []JSONStep{
-				{Type: RootStep},
-				{Type: ChildStep, Key: "store"},
-				{Type: ChildStep, Key: "bicycle"},
-				{Type: ChildStep, Key: "color"},
-			},
-		},
-		{
-			path: "$..price",
-			steps: []JSONStep{
-				{Type: RootStep},
-				{Type: RecursiveDescentStep, Key: "price"},
-			},
-		},
-		{
-			path: "$.store.book[*].title",
-			steps: []JSONStep{
-				{Type: RootStep},
-				{Type: ChildStep, Key: "store"},
-				{Type: ChildStep, Key: "book"},
-				{Type: IndexStep, Index: -1}, // Wildcard
-				{Type: ChildStep, Key: "title"},
-			},
-		},
-		{
-			path: "$.store.book[0]",
-			steps: []JSONStep{
-				{Type: RootStep},
-				{Type: ChildStep, Key: "store"},
-				{Type: ChildStep, Key: "book"},
-				{Type: IndexStep, Index: 0},
-			},
-		},
-		{
-			path:    "invalid.path",
-			wantErr: true,
-		},
-		{
-			path:    "$.store.book[abc]",
-			wantErr: true,
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.path, func(t *testing.T) {
-			steps, err := ParseJSONPath(tt.path)
-			if (err != nil) != tt.wantErr {
-				t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
-			}
-			if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
-				t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
-			}
-		})
-	}
-}
-
-func TestEvaluator(t *testing.T) {
-	tests := []struct {
-		name     string
-		path     string
-		expected []JSONNode
-		error    bool
-	}{
-		{
-			name: "simple_property_access",
-			path: "$.store.bicycle.color",
-			expected: []JSONNode{
-				{Value: "red", Path: "$.store.bicycle.color"},
-			},
-		},
-		{
-			name: "array_index_access",
-			path: "$.store.book[0].title",
-			expected: []JSONNode{
-				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
-			},
-		},
-		{
-			name: "wildcard_array_access",
-			path: "$.store.book[*].title",
-			expected: []JSONNode{
-				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
-				{Value: "The Two Towers", Path: "$.store.book[1].title"},
-			},
-		},
-		{
-			name: "recursive_price_search",
-			path: "$..price",
-			expected: []JSONNode{
-				{Value: 22.99, Path: "$.store.book[0].price"},
-				{Value: 23.45, Path: "$.store.book[1].price"},
-				{Value: 199.95, Path: "$.store.bicycle.price"},
-			},
-		},
-		{
-			name: "wildcard_recursive",
-			path: "$..*",
-			expected: []JSONNode{
-				// These will be compared by value only, paths will be validated separately
-				{Value: testData["store"].(map[string]interface{})["book"]},
-				{Value: testData["store"].(map[string]interface{})["bicycle"]},
-				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
-				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
-				{Value: "The Fellowship of the Ring"},
-				{Value: 22.99},
-				{Value: "The Two Towers"},
-				{Value: 23.45},
-				{Value: "red"},
-				{Value: 199.95},
-			},
-		},
-		{
-			name:     "invalid_index",
-			path:     "$.store.book[5]",
-			expected: []JSONNode{},
-			error:    true,
-		},
-		{
-			name:     "nonexistent_property",
-			path:     "$.store.nonexistent",
-			expected: []JSONNode{},
-			error:    true,
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			// Use GetWithPaths directly
-			result, err := Get(testData, tt.path)
-			if err != nil {
-				if !tt.error {
-					t.Errorf("Get() returned error: %v", err)
-				}
-				return
-			}
-
-			// Special handling for wildcard recursive test
-			if tt.name == "wildcard_recursive" {
-				// Skip length check for wildcard recursive since it might vary
-				// Just verify that each expected item is in the results
-
-				// Validate values match and paths are filled in
-				for _, e := range tt.expected {
-					found := false
-					for _, r := range result {
-						if reflect.DeepEqual(r.Value, e.Value) {
-							found = true
-							break
-						}
-					}
-					if !found {
-						t.Errorf("Expected value %v not found in results", e.Value)
-					}
-				}
-				return
-			}
-
-			if len(result) != len(tt.expected) {
-				t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
-			}
-
-			// Validate both values and paths
-			for i, e := range tt.expected {
-				if i < len(result) {
-					if !reflect.DeepEqual(result[i].Value, e.Value) {
-						t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
-					}
-					if result[i].Path != e.Path {
-						t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
-					}
-				}
-			}
-		})
-	}
-}
-
-func TestEdgeCases(t *testing.T) {
-	t.Run("empty_data", func(t *testing.T) {
-		result, err := Get(nil, "$.a.b")
-		if err == nil {
-			t.Errorf("Expected error for empty data")
-			return
-		}
-		if len(result) > 0 {
-			t.Errorf("Expected empty result, got %v", result)
-		}
-	})
-
-	t.Run("empty_path", func(t *testing.T) {
-		_, err := ParseJSONPath("")
-		if err == nil {
-			t.Error("Expected error for empty path")
-		}
-	})
-
-	t.Run("numeric_keys", func(t *testing.T) {
-		data := map[string]interface{}{
-			"42": "answer",
-		}
-		result, err := Get(data, "$.42")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) == 0 || result[0].Value != "answer" {
-			t.Errorf("Expected 'answer', got %v", result)
-		}
-	})
-}
-
-func TestGetWithPaths(t *testing.T) {
-	tests := []struct {
-		name     string
-		path     string
-		expected []JSONNode
-	}{
-		{
-			name: "simple_property_access",
-			path: "$.store.bicycle.color",
-			expected: []JSONNode{
-				{Value: "red", Path: "$.store.bicycle.color"},
-			},
-		},
-		{
-			name: "array_index_access",
-			path: "$.store.book[0].title",
-			expected: []JSONNode{
-				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
-			},
-		},
-		{
-			name: "wildcard_array_access",
-			path: "$.store.book[*].title",
-			expected: []JSONNode{
-				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
-				{Value: "The Two Towers", Path: "$.store.book[1].title"},
-			},
-		},
-		{
-			name: "recursive_price_search",
-			path: "$..price",
-			expected: []JSONNode{
-				{Value: 22.99, Path: "$.store.book[0].price"},
-				{Value: 23.45, Path: "$.store.book[1].price"},
-				{Value: 199.95, Path: "$.store.bicycle.price"},
-			},
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(testData, tt.path)
-			if err != nil {
-				t.Errorf("Get() returned error: %v", err)
-				return
-			}
-
-			// Check if lengths match
-			if len(result) != len(tt.expected) {
-				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
-				return
-			}
-
-			// For each expected item, find its match in the results and verify both value and path
-			for _, expected := range tt.expected {
-				found := false
-				for _, r := range result {
-					// First verify the value matches
-					if reflect.DeepEqual(r.Value, expected.Value) {
-						found = true
-						// Then verify the path matches
-						if r.Path != expected.Path {
-							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
-						}
-						break
-					}
-				}
-				if !found {
-					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
-				}
-			}
-		})
-	}
-}

processor/processor.go

@@ -5,87 +5,103 @@ import (
 	"strings"
 
 	lua "github.com/yuin/gopher-lua"
+
+	"cook/logger"
 )
 
-// Processor defines the interface for all file processors
-type Processor interface {
-	// Process handles processing a file with the given pattern and Lua expression
-	Process(filename string, pattern string, luaExpr string) (int, int, error)
-
-	// ProcessContent handles processing a string content directly with the given pattern and Lua expression
-	// Returns the modified content, modification count, match count, and any error
-	ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
-
-	// ToLua converts processor-specific data to Lua variables
-	ToLua(L *lua.LState, data interface{}) error
-
-	// FromLua retrieves modified data from Lua
-	FromLua(L *lua.LState) (interface{}, error)
-}
-
-// ModificationRecord tracks a single value modification
-type ModificationRecord struct {
-	File      string
-	OldValue  string
-	NewValue  string
-	Operation string
-	Context   string
-}
+// Maybe we make this an interface again for the shits and giggles
+// We will see, it could easily be...
 
 func NewLuaState() (*lua.LState, error) {
 	L := lua.NewState()
 	// defer L.Close()
 
 	// Load math library
+	logger.Debug("Loading Lua math library")
 	L.Push(L.GetGlobal("require"))
 	L.Push(lua.LString("math"))
 	if err := L.PCall(1, 1, nil); err != nil {
+		logger.Error("Failed to load Lua math library: %v", err)
 		return nil, fmt.Errorf("error loading Lua math library: %v", err)
 	}
 
 	// Initialize helper functions
+	logger.Debug("Initializing Lua helper functions")
 	if err := InitLuaHelpers(L); err != nil {
+		logger.Error("Failed to initialize Lua helper functions: %v", err)
 		return nil, err
 	}
 
 	return L, nil
 }
 
-// ToLua converts a struct or map to a Lua table recursively
-func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
-	switch v := data.(type) {
-	case map[string]interface{}:
-		luaTable := L.NewTable()
-		for key, value := range v {
-			luaValue, err := ToLua(L, value)
-			if err != nil {
-				return nil, err
-			}
-			luaTable.RawSetString(key, luaValue)
-		}
-		return luaTable, nil
-	case []interface{}:
-		luaTable := L.NewTable()
-		for i, value := range v {
-			luaValue, err := ToLua(L, value)
-			if err != nil {
-				return nil, err
-			}
-			luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
-		}
-		return luaTable, nil
-	case string:
-		return lua.LString(v), nil
-	case bool:
-		return lua.LBool(v), nil
-	case float64:
-		return lua.LNumber(v), nil
-	case nil:
-		return lua.LNil, nil
-	default:
-		return nil, fmt.Errorf("unsupported data type: %T", data)
-	}
-}
+// func Process(filename string, pattern string, luaExpr string) (int, int, error) {
+// 	logger.Debug("Processing file %q with pattern %q", filename, pattern)
+//
+// 	// Read file content
+// 	cwd, err := os.Getwd()
+// 	if err != nil {
+// 		logger.Error("Failed to get current working directory: %v", err)
+// 		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
+// 	}
+//
+// 	fullPath := filepath.Join(cwd, filename)
+// 	logger.Trace("Reading file from: %s", fullPath)
+//
+// 	stat, err := os.Stat(fullPath)
+// 	if err != nil {
+// 		logger.Error("Failed to stat file %s: %v", fullPath, err)
+// 		return 0, 0, fmt.Errorf("error getting file info: %v", err)
+// 	}
+// 	logger.Debug("File size: %d bytes, modified: %s", stat.Size(), stat.ModTime().Format(time.RFC3339))
+//
+// 	content, err := os.ReadFile(fullPath)
+// 	if err != nil {
+// 		logger.Error("Failed to read file %s: %v", fullPath, err)
+// 		return 0, 0, fmt.Errorf("error reading file: %v", err)
+// 	}
+//
+// 	fileContent := string(content)
+// 	logger.Trace("File read successfully: %d bytes, hash: %x", len(content), md5sum(content))
+//
+// 	// Detect and log file type
+// 	fileType := detectFileType(filename, fileContent)
+// 	if fileType != "" {
+// 		logger.Debug("Detected file type: %s", fileType)
+// 	}
+//
+// 	// Process the content
+// 	logger.Debug("Starting content processing")
+// 	modifiedContent, modCount, matchCount, err := ProcessContent(fileContent, pattern, luaExpr)
+// 	if err != nil {
+// 		logger.Error("Processing error: %v", err)
+// 		return 0, 0, err
+// 	}
+//
+// 	logger.Debug("Processing results: %d matches, %d modifications", matchCount, modCount)
+//
+// 	// If we made modifications, save the file
+// 	if modCount > 0 {
+// 		// Calculate changes summary
+// 		changePercent := float64(len(modifiedContent)) / float64(len(fileContent)) * 100
+// 		logger.Info("File size change: %d → %d bytes (%.1f%%)",
+// 			len(fileContent), len(modifiedContent), changePercent)
+//
+// 		logger.Debug("Writing modified content to %s", fullPath)
+// 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
+// 		if err != nil {
+// 			logger.Error("Failed to write to file %s: %v", fullPath, err)
+// 			return 0, 0, fmt.Errorf("error writing file: %v", err)
+// 		}
+// 		logger.Debug("File written successfully, new hash: %x", md5sum([]byte(modifiedContent)))
+// 	} else if matchCount > 0 {
+// 		logger.Debug("No content modifications needed for %d matches", matchCount)
+// 	} else {
+// 		logger.Debug("No matches found in file")
+// 	}
+//
+// 	return modCount, matchCount, nil
+// }
 
 // FromLua converts a Lua table to a struct or map recursively
 func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
@@ -127,25 +143,28 @@ func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
 }
 
 func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
+	logger.Trace("Checking if Lua table is an array")
 	L.SetGlobal("table_to_check", v)
 
 	// Use our predefined helper function from InitLuaHelpers
 	err := L.DoString(`is_array = isArray(table_to_check)`)
 	if err != nil {
+		logger.Error("Error determining if table is an array: %v", err)
 		return false, fmt.Errorf("error determining if table is array: %w", err)
 	}
 
 	// Check the result of our Lua function
 	isArray := L.GetGlobal("is_array")
 	// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
-	if !lua.LVIsFalse(isArray) {
-		return true, nil
-	}
-	return false, nil
+	result := !lua.LVIsFalse(isArray)
+	logger.Trace("Lua table is array: %v", result)
+	return result, nil
 }
 
 // InitLuaHelpers initializes common Lua helper functions
 func InitLuaHelpers(L *lua.LState) error {
+	logger.Debug("Loading Lua helper functions")
+
 	helperScript := `
 -- Custom Lua helpers for math operations
 function min(a, b) return math.min(a, b) end
@@ -158,6 +177,39 @@ function floor(x) return math.floor(x) end
 function ceil(x) return math.ceil(x) end
 function upper(s) return string.upper(s) end
 function lower(s) return string.lower(s) end
+function format(s, ...) return string.format(s, ...) end
+
+-- String split helper
+function strsplit(inputstr, sep)
+  if sep == nil then
+    sep = "%s"
+  end
+  local t = {}
+  for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
+    table.insert(t, str)
+  end
+  return t
+end
+
+---@param table table
+---@param depth number?
+function DumpTable(table, depth)
+	if depth == nil then
+		depth = 0
+	end
+	if (depth > 200) then
+		print("Error: Depth > 200 in dumpTable()")
+		return
+	end
+	for k, v in pairs(table) do
+		if (type(v) == "table") then
+			print(string.rep("  ", depth) .. k .. ":")
+			DumpTable(v, depth + 1)
+		else
+			print(string.rep("  ", depth) .. k .. ": ", v)
+		end
+	end
+end
 
 -- String to number conversion helper
 function num(str)
@@ -191,13 +243,15 @@ end
 modified = false
 `
 	if err := L.DoString(helperScript); err != nil {
+		logger.Error("Failed to load Lua helper functions: %v", err)
 		return fmt.Errorf("error loading helper functions: %v", err)
 	}
+
+	logger.Debug("Setting up Lua print function to Go")
+	L.SetGlobal("print", L.NewFunction(printToGo))
 	return nil
 }
 
-// Helper utility functions
-
 // LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	s = strings.ReplaceAll(s, "\n", "\\n")
@@ -230,6 +284,8 @@ func PrependLuaAssignment(luaExpr string) string {
 
 // BuildLuaScript prepares a Lua expression from shorthand notation
 func BuildLuaScript(luaExpr string) string {
+	logger.Debug("Building Lua script from expression: %s", luaExpr)
+
 	luaExpr = PrependLuaAssignment(luaExpr)
 
 	// This allows the user to specify whether or not they modified a value
@@ -249,18 +305,22 @@ func BuildLuaScript(luaExpr string) string {
 	return fullScript
 }
 
-// Max returns the maximum of two integers
-func Max(a, b int) int {
-	if a > b {
-		return a
-	}
-	return b
+func printToGo(L *lua.LState) int {
+	top := L.GetTop()
+
+	args := make([]interface{}, top)
+	for i := 1; i <= top; i++ {
+		args[i-1] = L.Get(i)
 	}
 
-// Min returns the minimum of two integers
-func Min(a, b int) int {
-	if a < b {
-		return a
+	// Format the message with proper spacing between arguments
+	var parts []string
+	for _, arg := range args {
+		parts = append(parts, fmt.Sprintf("%v", arg))
 	}
-	return b
+	message := strings.Join(parts, " ")
+
+	// Use the LUA log level with a script tag
+	logger.Lua("%s", message)
+	return 0
 }

processor/regex.go

@@ -2,133 +2,97 @@ package processor
 
 import (
 	"fmt"
-	"os"
-	"path/filepath"
 	"regexp"
 	"strconv"
 	"strings"
+	"time"
 
 	lua "github.com/yuin/gopher-lua"
+
+	"cook/logger"
+	"cook/utils"
 )
 
-// RegexProcessor implements the Processor interface using regex patterns
-type RegexProcessor struct{}
-
-// Process implements the Processor interface for RegexProcessor
-func (p *RegexProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
-	// Read file content
-	fullPath := filepath.Join(".", filename)
-	content, err := os.ReadFile(fullPath)
-	if err != nil {
-		return 0, 0, fmt.Errorf("error reading file: %v", err)
-	}
-
-	fileContent := string(content)
-
-	// Process the content
-	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
-	if err != nil {
-		return 0, 0, err
-	}
-
-	// If we made modifications, save the file
-	if modCount > 0 {
-		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
-		if err != nil {
-			return 0, 0, fmt.Errorf("error writing file: %v", err)
-		}
-	}
-
-	return modCount, matchCount, nil
-}
-
-// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
-func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
-	captures, ok := data.([]string)
-	if !ok {
-		return fmt.Errorf("expected []string for captures, got %T", data)
-	}
-
-	// Set variables for each capture group, starting from v1/s1 for the first capture
-	for i := 0; i < len(captures); i++ {
-		// Set string version (always available as s1, s2, etc.)
-		L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
-
-		// Try to convert to number and set v1, v2, etc.
-		if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
-			L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
-		}
-	}
-
-	return nil
-}
-
-// FromLua implements the Processor interface for RegexProcessor
-func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
-	// Get the modified values after Lua execution
-	modifications := make(map[int]string)
-
-	// Check for modifications to v1-v12 and s1-s12
-	for i := 0; i < 12; i++ {
-		// Check both v and s variables to see if any were modified
-		vVarName := fmt.Sprintf("v%d", i+1)
-		sVarName := fmt.Sprintf("s%d", i+1)
-
-		vLuaVal := L.GetGlobal(vVarName)
-		sLuaVal := L.GetGlobal(sVarName)
-
-		// If our value is a number then it's very likely we want it to be a number
-		// And not a string
-		// If we do want it to be a string we will cast it into a string in lua
-		// wait that wouldn't work... Casting v to a string would not load it here
-		if vLuaVal.Type() == lua.LTNumber {
-			modifications[i] = vLuaVal.String()
-			continue
-		}
-		if sLuaVal.Type() == lua.LTString {
-			modifications[i] = sLuaVal.String()
-			continue
-		}
-
-	}
-
-	return modifications, nil
+type CaptureGroup struct {
+	Name    string
+	Value   string
+	Updated string
+	Range   [2]int
 }
 
 // ProcessContent applies regex replacement with Lua processing
-func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
-	// Handle special pattern modifications
-	if !strings.HasPrefix(pattern, "(?s)") {
-		pattern = "(?s)" + pattern
-	}
+// The filename here exists ONLY so we can pass it to the lua environment
+// It's not used for anything else
+func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
+	var commands []utils.ReplaceCommand
+	logger.Trace("Processing regex: %q", command.Regex)
 
+	// Start timing the regex processing
+	startTime := time.Now()
+
+	// We don't HAVE to do this multiple times for a pattern
+	// But it's quick enough for us to not care
+	pattern := resolveRegexPlaceholders(command.Regex)
+	// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
+	// But it's a compromise that allows us to use | in yaml
+	// Otherwise we would have to escape every god damn pair of quotation marks
+	// And a bunch of other shit
+	pattern = strings.TrimSpace(pattern)
+	logger.Debug("Compiling regex pattern: %s", pattern)
+
+	patternCompileStart := time.Now()
 	compiledPattern, err := regexp.Compile(pattern)
 	if err != nil {
-		return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
+		logger.Error("Error compiling pattern: %v", err)
+		return commands, fmt.Errorf("error compiling pattern: %v", err)
 	}
+	logger.Debug("Compiled pattern successfully in %v: %s", time.Since(patternCompileStart), pattern)
 
-	previous := luaExpr
-	luaExpr = BuildLuaScript(luaExpr)
-	fmt.Printf("Changing Lua expression from: %s to: %s\n", previous, luaExpr)
-
-	L, err := NewLuaState()
-	if err != nil {
-		return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
-	}
-	defer L.Close()
-
-	// Initialize Lua environment
-	modificationCount := 0
+	// Same here, it's just string concatenation, it won't kill us
+	// More important is that we don't fuck up the command
+	// But we shouldn't be able to since it's passed by value
+	previous := command.Lua
+	luaExpr := BuildLuaScript(command.Lua)
+	logger.Debug("Transformed Lua expression: %q → %q", previous, luaExpr)
 
 	// Process all regex matches
-	result := content
+	matchFindStart := time.Now()
 	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
+	matchFindDuration := time.Since(matchFindStart)
+
+	logger.Debug("Found %d matches in content of length %d (search took %v)",
+		len(indices), len(content), matchFindDuration)
+
+	// Log pattern complexity metrics
+	patternComplexity := estimatePatternComplexity(pattern)
+	logger.Debug("Pattern complexity estimate: %d", patternComplexity)
+
+	if len(indices) == 0 {
+		logger.Warning("No matches found for regex: %q", pattern)
+		logger.Debug("Total regex processing time: %v", time.Since(startTime))
+		return commands, nil
+	}
+
 	// We walk backwards because we're replacing something with something else that might be longer
 	// And in the case it is longer than the original all indicces past that change will be fucked up
 	// By going backwards we fuck up all the indices to the end of the file that we don't care about
 	// Because there either aren't any (last match) or they're already modified (subsequent matches)
-	for i := len(indices) - 1; i >= 0; i-- {
-		matchIndices := indices[i]
+	for i, matchIndices := range indices {
+		logger.Debug("Processing match %d of %d", i+1, len(indices))
+		logger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
+
+		L, err := NewLuaState()
+		if err != nil {
+			logger.Error("Error creating Lua state: %v", err)
+			return commands, fmt.Errorf("error creating Lua state: %v", err)
+		}
+		L.SetGlobal("file", lua.LString(filename))
+		// Hmm... Maybe we don't want to defer this..
+		// Maybe we want to close them every iteration
+		// We'll leave it as is for now
+		defer L.Close()
+		logger.Trace("Lua state created successfully for match %d", i+1)
+
 		// Why we're doing this whole song and dance of indices is to properly handle empty matches
 		// Plus it's a little cleaner to surgically replace our matches
 		// If we were to use string.replace and encountered an empty match there'd be nothing to replace
@@ -137,60 +101,292 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
 		// As if concatenating in the middle of the array
 		// Plus it supports lookarounds
 		match := content[matchIndices[0]:matchIndices[1]]
+		matchPreview := match
+		if len(match) > 50 {
+			matchPreview = match[:47] + "..."
+		}
+		logger.Trace("Matched content: %q (length: %d)", matchPreview, len(match))
 
 		groups := matchIndices[2:]
 		if len(groups) <= 0 {
-			fmt.Println("No capture groups for lua to chew on")
+			logger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
 			continue
 		}
 		if len(groups)%2 == 1 {
-			fmt.Println("Odd number of indices of groups, what the fuck?")
+			logger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
 			continue
 		}
 
-		captures := make([]string, 0, len(groups)/2)
+		// Count how many valid groups we have
+		validGroups := 0
 		for j := 0; j < len(groups); j += 2 {
-			captures = append(captures, content[groups[j]:groups[j+1]])
+			if groups[j] != -1 && groups[j+1] != -1 {
+				validGroups++
 			}
+		}
+		logger.Debug("Found %d valid capture groups in match", validGroups)
 
-		if err := p.ToLua(L, captures); err != nil {
-			fmt.Println("Error setting Lua variables:", err)
+		for _, index := range groups {
+			if index == -1 {
+				logger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
 				continue
 			}
+		}
+
+		// We have to use array to preserve order
+		// Very important for the reconstruction step
+		// Because we must overwrite the values in reverse order
+		// See comments a few dozen lines above for more details
+		captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
+		groupNames := compiledPattern.SubexpNames()[1:]
+		for i, name := range groupNames {
+			start := groups[i*2]
+			end := groups[i*2+1]
+			if start == -1 || end == -1 {
+				continue
+			}
+
+			value := content[start:end]
+			captureGroups = append(captureGroups, &CaptureGroup{
+				Name:  name,
+				Value: value,
+				Range: [2]int{start, end},
+			})
+
+			// Include name info in log if available
+			if name != "" {
+				logger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
+			} else {
+				logger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
+			}
+		}
+
+		// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
+		if !command.NoDedup {
+			logger.Debug("Deduplicating capture groups as specified in command settings")
+			captureGroups = deduplicateGroups(captureGroups)
+		}
+
+		if err := toLua(L, captureGroups); err != nil {
+			logger.Error("Failed to set Lua variables: %v", err)
+			continue
+		}
+		logger.Trace("Set %d capture groups as Lua variables", len(captureGroups))
 
 		if err := L.DoString(luaExpr); err != nil {
-			fmt.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
+			logger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
+				err, luaExpr, captureGroups)
 			continue
 		}
+		logger.Trace("Lua script executed successfully")
 
 		// Get modifications from Lua
-		modResult, err := p.FromLua(L)
+		captureGroups, err = fromLua(L, captureGroups)
 		if err != nil {
-			fmt.Println("Error getting modifications:", err)
-			continue
-		}
-
-		// Apply modifications to the matched text
-		modsMap, ok := modResult.(map[int]string)
-		if !ok || len(modsMap) == 0 {
-			fmt.Println("No modifications to apply")
+			logger.Error("Failed to retrieve modifications from Lua: %v", err)
+			continue
+		}
+		logger.Trace("Retrieved updated values from Lua")
+
+		replacement := ""
+		replacementVar := L.GetGlobal("replacement")
+		if replacementVar.Type() != lua.LTNil {
+			replacement = replacementVar.String()
+			logger.Debug("Using global replacement: %q", replacement)
+		}
+
+		// Check if modification flag is set
+		modifiedVal := L.GetGlobal("modified")
+		if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
+			logger.Debug("Skipping match - no modifications made by Lua script")
 			continue
 		}
 
+		if replacement == "" {
 			// Apply the modifications to the original match
-		replacement := match
-		for i := len(modsMap) - 1; i >= 0; i-- {
-			newVal := modsMap[i]
+			replacement = match
+
+			// Count groups that were actually modified
+			modifiedGroups := 0
+			for _, capture := range captureGroups {
+				if capture.Value != capture.Updated {
+					modifiedGroups++
+				}
+			}
+			logger.Info("%d of %d capture groups identified for modification", modifiedGroups, len(captureGroups))
+
+			for _, capture := range captureGroups {
+				if capture.Value == capture.Updated {
+					logger.Info("Capture group unchanged: %s", LimitString(capture.Value, 50))
+					continue
+				}
+
+				// Log what changed with context
+				logger.Debug("Capture group %s scheduled for modification: %q → %q",
+					capture.Name, capture.Value, capture.Updated)
+
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
-			groupStart := groups[i*2] - matchIndices[0]
-			groupEnd := groups[i*2+1] - matchIndices[0]
-			replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
+				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
+				commands = append(commands, utils.ReplaceCommand{
+					From: capture.Range[0],
+					To:   capture.Range[1],
+					With: capture.Updated,
+				})
+			}
+		} else {
+			commands = append(commands, utils.ReplaceCommand{
+				From: matchIndices[0],
+				To:   matchIndices[1],
+				With: replacement,
+			})
+		}
 	}
 
-		modificationCount++
-		result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
+	logger.Debug("Total regex processing time: %v", time.Since(startTime))
+	return commands, nil
 }
 
-	return result, modificationCount, len(indices), nil
+func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
+	deduplicatedGroups := make([]*CaptureGroup, 0)
+	for _, group := range captureGroups {
+		overlaps := false
+		logger.Debug("Checking capture group: %s with range %v", group.Name, group.Range)
+		for _, existingGroup := range deduplicatedGroups {
+			logger.Debug("Comparing with existing group: %s with range %v", existingGroup.Name, existingGroup.Range)
+			if group.Range[0] < existingGroup.Range[1] && group.Range[1] > existingGroup.Range[0] {
+				overlaps = true
+				logger.Warning("Detected overlap between capture group '%s' and existing group '%s' in range %v-%v and %v-%v", group.Name, existingGroup.Name, group.Range[0], group.Range[1], existingGroup.Range[0], existingGroup.Range[1])
+				break
+			}
+		}
+		if overlaps {
+			// We CAN just continue despite this fuckup
+			logger.Warning("Overlapping capture group: %s", group.Name)
+			continue
+		}
+		logger.Debug("No overlap detected for capture group: %s. Adding to deduplicated groups.", group.Name)
+		deduplicatedGroups = append(deduplicatedGroups, group)
+	}
+	return deduplicatedGroups
+}
+
+// The order of these replaces is important
+// This one handles !num-s inside of named capture groups
+// If it were not here our !num in a named capture group would
+// Expand to another capture group in the capture group
+// We really only want one (our named) capture group
+func resolveRegexPlaceholders(pattern string) string {
+	// Handle special pattern modifications
+	if !strings.HasPrefix(pattern, "(?s)") {
+		pattern = "(?s)" + pattern
+	}
+
+	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
+	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
+		parts := namedGroupNum.FindStringSubmatch(match)
+		if len(parts) != 3 {
+			return match
+		}
+		replacement := `-?\d*\.?\d+`
+		return parts[1] + replacement
+	})
+	pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
+	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
+	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
+	// !rep(pattern, count) repeats the pattern n times
+	// Inserting !any between each repetition
+	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
+		parts := repPattern.FindStringSubmatch(match)
+		if len(parts) != 3 {
+			return match
+		}
+		repeatedPattern := parts[1]
+		count := parts[2]
+		repetitions, _ := strconv.Atoi(count)
+		return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
+	})
+	return pattern
+}
+
+// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
+func toLua(L *lua.LState, data interface{}) error {
+	captureGroups, ok := data.([]*CaptureGroup)
+	if !ok {
+		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
+	}
+
+	groupindex := 0
+	for _, capture := range captureGroups {
+		if capture.Name == "" {
+			// We don't want to change the name of the capture group
+			// Even if it's empty
+			tempName := fmt.Sprintf("%d", groupindex+1)
+			groupindex++
+
+			L.SetGlobal("s"+tempName, lua.LString(capture.Value))
+
+			val, err := strconv.ParseFloat(capture.Value, 64)
+			if err == nil {
+				L.SetGlobal("v"+tempName, lua.LNumber(val))
+			}
+		} else {
+			val, err := strconv.ParseFloat(capture.Value, 64)
+			if err == nil {
+				L.SetGlobal(capture.Name, lua.LNumber(val))
+			} else {
+				L.SetGlobal(capture.Name, lua.LString(capture.Value))
+			}
+		}
+	}
+
+	return nil
+}
+
+// FromLua implements the Processor interface for RegexProcessor
+func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
+	captureIndex := 0
+	for _, capture := range captureGroups {
+		if capture.Name == "" {
+			capture.Name = fmt.Sprintf("%d", captureIndex+1)
+
+			vVarName := fmt.Sprintf("v%s", capture.Name)
+			sVarName := fmt.Sprintf("s%s", capture.Name)
+			captureIndex++
+
+			vLuaVal := L.GetGlobal(vVarName)
+			sLuaVal := L.GetGlobal(sVarName)
+
+			if sLuaVal.Type() == lua.LTString {
+				capture.Updated = sLuaVal.String()
+			}
+			// Numbers have priority
+			if vLuaVal.Type() == lua.LTNumber {
+				capture.Updated = vLuaVal.String()
+			}
+		} else {
+			// Easy shit
+			capture.Updated = L.GetGlobal(capture.Name).String()
+		}
+	}
+
+	return captureGroups, nil
+}
+
+// estimatePatternComplexity gives a rough estimate of regex pattern complexity
+// This can help identify potentially problematic patterns
+func estimatePatternComplexity(pattern string) int {
+	complexity := len(pattern)
+
+	// Add complexity for potentially expensive operations
+	complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
+	complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
+	complexity += strings.Count(pattern, "[^") * 3  // Negated character class
+	complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
+	complexity += strings.Count(pattern, "(") * 2   // Capture groups
+	complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
+	complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
+	complexity += strings.Count(pattern, "{") * 2   // Counted repetition
+
+	return complexity
 }

processor/test_helper.go

@@ -0,0 +1,26 @@
+package processor
+
+import (
+	"io"
+	"cook/logger"
+	"os"
+)
+
+func init() {
+	// Only modify logger in test mode
+	// This checks if we're running under 'go test'
+	if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
+		// Initialize logger with ERROR level for tests
+		// to minimize noise in test output
+		logger.Init(logger.LevelError)
+
+		// Optionally redirect logger output to discard
+		// This prevents logger output from interfering with test output
+		disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
+		if disableTestLogs {
+			// Create a new logger that writes to nowhere
+			silentLogger := logger.New(io.Discard, "", 0)
+			logger.DefaultLogger = silentLogger
+		}
+	}
+}

processor/xml.go

@@ -1,217 +0,0 @@
-package processor
-
-import (
-	"fmt"
-	"os"
-	"path/filepath"
-	"strings"
-
-	"github.com/antchfx/xmlquery"
-	lua "github.com/yuin/gopher-lua"
-)
-
-// XMLProcessor implements the Processor interface for XML documents
-type XMLProcessor struct{}
-
-// Process implements the Processor interface for XMLProcessor
-func (p *XMLProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
-	// Read file content
-	fullPath := filepath.Join(".", filename)
-	content, err := os.ReadFile(fullPath)
-	if err != nil {
-		return 0, 0, fmt.Errorf("error reading file: %v", err)
-	}
-
-	fileContent := string(content)
-
-	// Process the content
-	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
-	if err != nil {
-		return 0, 0, err
-	}
-
-	// If we made modifications, save the file
-	if modCount > 0 {
-		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
-		if err != nil {
-			return 0, 0, fmt.Errorf("error writing file: %v", err)
-		}
-	}
-
-	return modCount, matchCount, nil
-}
-
-// ProcessContent implements the Processor interface for XMLProcessor
-func (p *XMLProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
-	// Parse XML document
-	doc, err := xmlquery.Parse(strings.NewReader(content))
-	if err != nil {
-		return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
-	}
-
-	// Find nodes matching the XPath pattern
-	nodes, err := xmlquery.QueryAll(doc, pattern)
-	if err != nil {
-		return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
-	}
-
-	matchCount := len(nodes)
-	if matchCount == 0 {
-		return content, 0, 0, nil
-	}
-
-	// Initialize Lua
-	L := lua.NewState()
-	defer L.Close()
-
-	// Load math library
-	L.Push(L.GetGlobal("require"))
-	L.Push(lua.LString("math"))
-	if err := L.PCall(1, 1, nil); err != nil {
-		return content, 0, 0, fmt.Errorf("error loading Lua math library: %v", err)
-	}
-
-	// Load helper functions
-	if err := InitLuaHelpers(L); err != nil {
-		return content, 0, 0, err
-	}
-
-	// Apply modifications to each node
-	modCount := 0
-	for _, node := range nodes {
-		// Reset Lua state for each node
-		L.SetGlobal("v1", lua.LNil)
-		L.SetGlobal("s1", lua.LNil)
-
-		// Get the node value
-		var originalValue string
-		if node.Type == xmlquery.AttributeNode {
-			originalValue = node.InnerText()
-		} else if node.Type == xmlquery.TextNode {
-			originalValue = node.Data
-		} else {
-			originalValue = node.InnerText()
-		}
-
-		// Convert to Lua variables
-		err = p.ToLua(L, originalValue)
-		if err != nil {
-			return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
-		}
-
-		// Execute Lua script
-		if err := L.DoString(luaExpr); err != nil {
-			return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
-		}
-
-		// Get modified value
-		result, err := p.FromLua(L)
-		if err != nil {
-			return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
-		}
-
-		newValue, ok := result.(string)
-		if !ok {
-			return content, modCount, matchCount, fmt.Errorf("expected string result from Lua, got %T", result)
-		}
-
-		// Skip if no change
-		if newValue == originalValue {
-			continue
-		}
-
-		// Apply modification
-		if node.Type == xmlquery.AttributeNode {
-			// For attribute nodes, update the attribute value
-			node.Parent.Attr = append([]xmlquery.Attr{}, node.Parent.Attr...)
-			for i, attr := range node.Parent.Attr {
-				if attr.Name.Local == node.Data {
-					node.Parent.Attr[i].Value = newValue
-					break
-				}
-			}
-		} else if node.Type == xmlquery.TextNode {
-			// For text nodes, update the text content
-			node.Data = newValue
-		} else {
-			// For element nodes, replace inner text
-			// Simple approach: set the InnerText directly if there are no child elements
-			if node.FirstChild == nil || (node.FirstChild != nil && node.FirstChild.Type == xmlquery.TextNode && node.FirstChild.NextSibling == nil) {
-				if node.FirstChild != nil {
-					node.FirstChild.Data = newValue
-				} else {
-					// Create a new text node and add it as the first child
-					textNode := &xmlquery.Node{
-						Type: xmlquery.TextNode,
-						Data: newValue,
-					}
-					node.FirstChild = textNode
-				}
-			} else {
-				// Complex case: node has mixed content or child elements
-				// Replace just the text content while preserving child elements
-				// This is a simplified approach - more complex XML may need more robust handling
-				for child := node.FirstChild; child != nil; child = child.NextSibling {
-					if child.Type == xmlquery.TextNode {
-						child.Data = newValue
-						break // Update only the first text node
-					}
-				}
-			}
-		}
-
-		modCount++
-	}
-
-	// Serialize the modified XML document to string
-	if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
-		// If we have an XML declaration, start with it
-		declaration := doc.FirstChild.OutputXML(true)
-		// Remove the firstChild (declaration) before serializing the rest of the document
-		doc.FirstChild = doc.FirstChild.NextSibling
-		return declaration + doc.OutputXML(true), modCount, matchCount, nil
-	}
-
-	return doc.OutputXML(true), modCount, matchCount, nil
-}
-
-// ToLua converts XML node values to Lua variables
-func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
-	value, ok := data.(string)
-	if !ok {
-		return fmt.Errorf("expected string value, got %T", data)
-	}
-
-	// Set as string variable
-	L.SetGlobal("s1", lua.LString(value))
-
-	// Try to convert to number if possible
-	L.SetGlobal("v1", lua.LNumber(0)) // Default to 0
-	if err := L.DoString(fmt.Sprintf("v1 = tonumber(%q) or 0", value)); err != nil {
-		return fmt.Errorf("error converting value to number: %v", err)
-	}
-
-	return nil
-}
-
-// FromLua gets modified values from Lua
-func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
-	// Check if string variable was modified
-	s1 := L.GetGlobal("s1")
-	if s1 != lua.LNil {
-		if s1Str, ok := s1.(lua.LString); ok {
-			return string(s1Str), nil
-		}
-	}
-
-	// Check if numeric variable was modified
-	v1 := L.GetGlobal("v1")
-	if v1 != lua.LNil {
-		if v1Num, ok := v1.(lua.LNumber); ok {
-			return fmt.Sprintf("%v", v1Num), nil
-		}
-	}
-
-	// Default return empty string
-	return "", nil
-}

processor/xpath/xpath.go

@@ -1,98 +0,0 @@
-package xpath
-
-import "errors"
-
-// XPathStep represents a single step in an XPath expression
-type XPathStep struct {
-	Type      StepType
-	Name      string
-	Predicate *Predicate
-}
-
-// StepType defines the type of XPath step
-type StepType int
-
-const (
-	// RootStep represents the root step (/)
-	RootStep StepType = iota
-	// ChildStep represents a child element step (element)
-	ChildStep
-	// RecursiveDescentStep represents a recursive descent step (//)
-	RecursiveDescentStep
-	// WildcardStep represents a wildcard step (*)
-	WildcardStep
-	// PredicateStep represents a predicate condition step ([...])
-	PredicateStep
-)
-
-// PredicateType defines the type of XPath predicate
-type PredicateType int
-
-const (
-	// IndexPredicate represents an index predicate [n]
-	IndexPredicate PredicateType = iota
-	// LastPredicate represents a last() function predicate
-	LastPredicate
-	// LastMinusPredicate represents a last()-n predicate
-	LastMinusPredicate
-	// PositionPredicate represents position()-based predicates
-	PositionPredicate
-	// AttributeExistsPredicate represents [@attr] predicate
-	AttributeExistsPredicate
-	// AttributeEqualsPredicate represents [@attr='value'] predicate
-	AttributeEqualsPredicate
-	// ComparisonPredicate represents element comparison predicates
-	ComparisonPredicate
-)
-
-// Predicate represents a condition in XPath
-type Predicate struct {
-	Type       PredicateType
-	Index      int
-	Offset     int
-	Attribute  string
-	Value      string
-	Expression string
-}
-
-// XMLNode represents a node in the result set with its value and path
-type XMLNode struct {
-	Value interface{}
-	Path  string
-}
-
-// ParseXPath parses an XPath expression into a series of steps
-func ParseXPath(path string) ([]XPathStep, error) {
-	if path == "" {
-		return nil, errors.New("empty path")
-	}
-
-	// This is just a placeholder implementation for the tests
-	// The actual implementation would parse the XPath expression
-	return nil, errors.New("not implemented")
-}
-
-// Get retrieves nodes from XML data using an XPath expression
-func Get(data interface{}, path string) ([]XMLNode, error) {
-	if data == "" {
-		return nil, errors.New("empty XML data")
-	}
-
-	// This is just a placeholder implementation for the tests
-	// The actual implementation would evaluate the XPath against the XML
-	return nil, errors.New("not implemented")
-}
-
-// Set updates a node in the XML data using an XPath expression
-func Set(xmlData string, path string, value interface{}) (string, error) {
-	// This is just a placeholder implementation for the tests
-	// The actual implementation would modify the XML based on the XPath
-	return "", errors.New("not implemented")
-}
-
-// SetAll updates all nodes matching an XPath expression in the XML data
-func SetAll(xmlData string, path string, value interface{}) (string, error) {
-	// This is just a placeholder implementation for the tests
-	// The actual implementation would modify all matching nodes
-	return "", errors.New("not implemented")
-}

processor/xpath/xpath_test.go

@@ -1,545 +0,0 @@
-package xpath
-
-import (
-	"reflect"
-	"testing"
-)
-
-// XML test data as a string for our tests
-var testXML = `
-<store>
-  <book category="fiction">
-    <title lang="en">The Fellowship of the Ring</title>
-    <author>J.R.R. Tolkien</author>
-    <year>1954</year>
-    <price>22.99</price>
-  </book>
-  <book category="fiction">
-    <title lang="en">The Two Towers</title>
-    <author>J.R.R. Tolkien</author>
-    <year>1954</year>
-    <price>23.45</price>
-  </book>
-  <book category="technical">
-    <title lang="en">Learning XML</title>
-    <author>Erik T. Ray</author>
-    <year>2003</year>
-    <price>39.95</price>
-  </book>
-  <bicycle>
-    <color>red</color>
-    <price>199.95</price>
-  </bicycle>
-</store>
-`
-
-func TestParser(t *testing.T) {
-	tests := []struct {
-		path    string
-		steps   []XPathStep
-		wantErr bool
-	}{
-		{
-			path: "/store/bicycle/color",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: ChildStep, Name: "store"},
-				{Type: ChildStep, Name: "bicycle"},
-				{Type: ChildStep, Name: "color"},
-			},
-		},
-		{
-			path: "//price",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: RecursiveDescentStep, Name: "price"},
-			},
-		},
-		{
-			path: "/store/book/*",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: ChildStep, Name: "store"},
-				{Type: ChildStep, Name: "book"},
-				{Type: WildcardStep},
-			},
-		},
-		{
-			path: "/store/book[1]/title",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: ChildStep, Name: "store"},
-				{Type: ChildStep, Name: "book"},
-				{Type: PredicateStep, Predicate: &Predicate{Type: IndexPredicate, Index: 1}},
-				{Type: ChildStep, Name: "title"},
-			},
-		},
-		{
-			path: "//title[@lang]",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: RecursiveDescentStep, Name: "title"},
-				{Type: PredicateStep, Predicate: &Predicate{Type: AttributeExistsPredicate, Attribute: "lang"}},
-			},
-		},
-		{
-			path: "//title[@lang='en']",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: RecursiveDescentStep, Name: "title"},
-				{Type: PredicateStep, Predicate: &Predicate{
-					Type:      AttributeEqualsPredicate,
-					Attribute: "lang",
-					Value:     "en",
-				}},
-			},
-		},
-		{
-			path: "/store/book[price>35.00]/title",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: ChildStep, Name: "store"},
-				{Type: ChildStep, Name: "book"},
-				{Type: PredicateStep, Predicate: &Predicate{
-					Type:       ComparisonPredicate,
-					Expression: "price>35.00",
-				}},
-				{Type: ChildStep, Name: "title"},
-			},
-		},
-		{
-			path: "/store/book[last()]",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: ChildStep, Name: "store"},
-				{Type: ChildStep, Name: "book"},
-				{Type: PredicateStep, Predicate: &Predicate{Type: LastPredicate}},
-			},
-		},
-		{
-			path: "/store/book[last()-1]",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: ChildStep, Name: "store"},
-				{Type: ChildStep, Name: "book"},
-				{Type: PredicateStep, Predicate: &Predicate{
-					Type:   LastMinusPredicate,
-					Offset: 1,
-				}},
-			},
-		},
-		{
-			path: "/store/book[position()<3]",
-			steps: []XPathStep{
-				{Type: RootStep},
-				{Type: ChildStep, Name: "store"},
-				{Type: ChildStep, Name: "book"},
-				{Type: PredicateStep, Predicate: &Predicate{
-					Type:       PositionPredicate,
-					Expression: "position()<3",
-				}},
-			},
-		},
-		{
-			path:    "invalid/path",
-			wantErr: true,
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.path, func(t *testing.T) {
-			steps, err := ParseXPath(tt.path)
-			if (err != nil) != tt.wantErr {
-				t.Fatalf("ParseXPath() error = %v, wantErr %v", err, tt.wantErr)
-			}
-			if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
-				t.Errorf("ParseXPath() steps = %+v, want %+v", steps, tt.steps)
-			}
-		})
-	}
-}
-
-func TestEvaluator(t *testing.T) {
-	tests := []struct {
-		name     string
-		path     string
-		expected []XMLNode
-		error    bool
-	}{
-		{
-			name: "simple_element_access",
-			path: "/store/bicycle/color",
-			expected: []XMLNode{
-				{Value: "red", Path: "/store/bicycle/color"},
-			},
-		},
-		{
-			name: "recursive_element_access",
-			path: "//price",
-			expected: []XMLNode{
-				{Value: "22.99", Path: "/store/book[1]/price"},
-				{Value: "23.45", Path: "/store/book[2]/price"},
-				{Value: "39.95", Path: "/store/book[3]/price"},
-				{Value: "199.95", Path: "/store/bicycle/price"},
-			},
-		},
-		{
-			name: "wildcard_element_access",
-			path: "/store/book[1]/*",
-			expected: []XMLNode{
-				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
-				{Value: "J.R.R. Tolkien", Path: "/store/book[1]/author"},
-				{Value: "1954", Path: "/store/book[1]/year"},
-				{Value: "22.99", Path: "/store/book[1]/price"},
-			},
-		},
-		{
-			name: "indexed_element_access",
-			path: "/store/book[1]/title",
-			expected: []XMLNode{
-				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
-			},
-		},
-		{
-			name: "attribute_exists_predicate",
-			path: "//title[@lang]",
-			expected: []XMLNode{
-				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
-				{Value: "The Two Towers", Path: "/store/book[2]/title"},
-				{Value: "Learning XML", Path: "/store/book[3]/title"},
-			},
-		},
-		{
-			name: "attribute_equals_predicate",
-			path: "//title[@lang='en']",
-			expected: []XMLNode{
-				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
-				{Value: "The Two Towers", Path: "/store/book[2]/title"},
-				{Value: "Learning XML", Path: "/store/book[3]/title"},
-			},
-		},
-		{
-			name: "value_comparison_predicate",
-			path: "/store/book[price>35.00]/title",
-			expected: []XMLNode{
-				{Value: "Learning XML", Path: "/store/book[3]/title"},
-			},
-		},
-		{
-			name: "last_predicate",
-			path: "/store/book[last()]/title",
-			expected: []XMLNode{
-				{Value: "Learning XML", Path: "/store/book[3]/title"},
-			},
-		},
-		{
-			name: "last_minus_predicate",
-			path: "/store/book[last()-1]/title",
-			expected: []XMLNode{
-				{Value: "The Two Towers", Path: "/store/book[2]/title"},
-			},
-		},
-		{
-			name: "position_predicate",
-			path: "/store/book[position()<3]/title",
-			expected: []XMLNode{
-				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
-				{Value: "The Two Towers", Path: "/store/book[2]/title"},
-			},
-		},
-		{
-			name:     "all_elements",
-			path:     "//*",
-			expected: []XMLNode{
-				// For brevity, we'll just check the count, not all values
-			},
-		},
-		{
-			name:     "invalid_index",
-			path:     "/store/book[10]/title",
-			expected: []XMLNode{},
-			error:    true,
-		},
-		{
-			name:     "nonexistent_element",
-			path:     "/store/nonexistent",
-			expected: []XMLNode{},
-			error:    true,
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(testXML, tt.path)
-			if err != nil {
-				if !tt.error {
-					t.Errorf("Get() returned error: %v", err)
-				}
-				return
-			}
-
-			// Special handling for the "//*" test case
-			if tt.path == "//*" {
-				// Just check that we got multiple elements, not the specific count
-				if len(result) < 10 { // We expect at least 10 elements
-					t.Errorf("Expected multiple elements for '//*', got %d", len(result))
-				}
-				return
-			}
-
-			if len(result) != len(tt.expected) {
-				t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
-				return
-			}
-
-			// Validate both values and paths
-			for i, e := range tt.expected {
-				if i < len(result) {
-					if !reflect.DeepEqual(result[i].Value, e.Value) {
-						t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
-					}
-					if result[i].Path != e.Path {
-						t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
-					}
-				}
-			}
-		})
-	}
-}
-
-func TestEdgeCases(t *testing.T) {
-	t.Run("empty_data", func(t *testing.T) {
-		result, err := Get("", "/store/book")
-		if err == nil {
-			t.Errorf("Expected error for empty data")
-			return
-		}
-		if len(result) > 0 {
-			t.Errorf("Expected empty result, got %v", result)
-		}
-	})
-
-	t.Run("empty_path", func(t *testing.T) {
-		_, err := ParseXPath("")
-		if err == nil {
-			t.Error("Expected error for empty path")
-		}
-	})
-
-	t.Run("invalid_xml", func(t *testing.T) {
-		_, err := Get("<invalid>xml", "/store")
-		if err == nil {
-			t.Error("Expected error for invalid XML")
-		}
-	})
-
-	t.Run("current_node", func(t *testing.T) {
-		result, err := Get(testXML, "/store/book[1]/.")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 1 {
-			t.Errorf("Expected 1 result, got %d", len(result))
-		}
-	})
-
-	t.Run("attributes", func(t *testing.T) {
-		result, err := Get(testXML, "/store/book[1]/title/@lang")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 1 || result[0].Value != "en" {
-			t.Errorf("Expected 'en', got %v", result)
-		}
-	})
-}
-
-func TestGetWithPaths(t *testing.T) {
-	tests := []struct {
-		name     string
-		path     string
-		expected []XMLNode
-	}{
-		{
-			name: "simple_element_access",
-			path: "/store/bicycle/color",
-			expected: []XMLNode{
-				{Value: "red", Path: "/store/bicycle/color"},
-			},
-		},
-		{
-			name: "indexed_element_access",
-			path: "/store/book[1]/title",
-			expected: []XMLNode{
-				{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
-			},
-		},
-		{
-			name: "recursive_element_access",
-			path: "//price",
-			expected: []XMLNode{
-				{Value: "22.99", Path: "/store/book[1]/price"},
-				{Value: "23.45", Path: "/store/book[2]/price"},
-				{Value: "39.95", Path: "/store/book[3]/price"},
-				{Value: "199.95", Path: "/store/bicycle/price"},
-			},
-		},
-		{
-			name: "attribute_access",
-			path: "/store/book[1]/title/@lang",
-			expected: []XMLNode{
-				{Value: "en", Path: "/store/book[1]/title/@lang"},
-			},
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(testXML, tt.path)
-			if err != nil {
-				t.Errorf("Get() returned error: %v", err)
-				return
-			}
-
-			// Check if lengths match
-			if len(result) != len(tt.expected) {
-				t.Errorf("Get() returned %d items, expected %d", len(result), len(tt.expected))
-				return
-			}
-
-			// For each expected item, find its match in the results and verify both value and path
-			for _, expected := range tt.expected {
-				found := false
-				for _, r := range result {
-					// First verify the value matches
-					if reflect.DeepEqual(r.Value, expected.Value) {
-						found = true
-						// Then verify the path matches
-						if r.Path != expected.Path {
-							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
-						}
-						break
-					}
-				}
-				if !found {
-					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
-				}
-			}
-		})
-	}
-}
-
-func TestSet(t *testing.T) {
-	t.Run("simple element", func(t *testing.T) {
-		xmlData := `<root><name>John</name></root>`
-		newXML, err := Set(xmlData, "/root/name", "Jane")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		// Verify the change
-		result, err := Get(newXML, "/root/name")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 1 || result[0].Value != "Jane" {
-			t.Errorf("Set() failed: expected name to be 'Jane', got %v", result)
-		}
-	})
-
-	t.Run("attribute", func(t *testing.T) {
-		xmlData := `<root><element id="123"></element></root>`
-		newXML, err := Set(xmlData, "/root/element/@id", "456")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		// Verify the change
-		result, err := Get(newXML, "/root/element/@id")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 1 || result[0].Value != "456" {
-			t.Errorf("Set() failed: expected id to be '456', got %v", result)
-		}
-	})
-
-	t.Run("indexed element", func(t *testing.T) {
-		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
-		newXML, err := Set(xmlData, "/root/items/item[1]", "changed")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		// Verify the change
-		result, err := Get(newXML, "/root/items/item[1]")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 1 || result[0].Value != "changed" {
-			t.Errorf("Set() failed: expected item to be 'changed', got %v", result)
-		}
-	})
-}
-
-func TestSetAll(t *testing.T) {
-	t.Run("multiple elements", func(t *testing.T) {
-		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
-		newXML, err := SetAll(xmlData, "//item", "changed")
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-
-		// Verify all items are changed
-		result, err := Get(newXML, "//item")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 2 {
-			t.Errorf("Expected 2 results, got %d", len(result))
-			return
-		}
-
-		for i, node := range result {
-			if node.Value != "changed" {
-				t.Errorf("Item %d not changed, got %v", i+1, node.Value)
-			}
-		}
-	})
-
-	t.Run("attributes", func(t *testing.T) {
-		xmlData := `<root><item id="1"/><item id="2"/></root>`
-		newXML, err := SetAll(xmlData, "//item/@id", "new")
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-
-		// Verify all attributes are changed
-		result, err := Get(newXML, "//item/@id")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 2 {
-			t.Errorf("Expected 2 results, got %d", len(result))
-			return
-		}
-
-		for i, node := range result {
-			if node.Value != "new" {
-				t.Errorf("Attribute %d not changed, got %v", i+1, node.Value)
-			}
-		}
-	})
-}

regression/regression_test.go

@@ -0,0 +1,137 @@
+package regression
+
+import (
+	"cook/processor"
+	"cook/utils"
+	"os"
+	"path/filepath"
+	"testing"
+)
+
+func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
+	command := utils.ModifyCommand{
+		Regex:    regex,
+		Lua:      lua,
+		LogLevel: "TRACE",
+	}
+
+	commands, err := processor.ProcessRegex(content, command, "test")
+	if err != nil {
+		return "", 0, 0, err
+	}
+
+	result, modifications := utils.ExecuteModifications(commands, content)
+	return result, modifications, len(commands), nil
+}
+
+func TestTalentsMechanicOutOfRange(t *testing.T) {
+	given := `<Talent identifier="quickfixer">
+    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
+    <Description tag="talentdescription.quickfixer">
+      <Replace tag="[amount]" value="20" color="gui.green"/>
+      <Replace tag="[duration]" value="10" color="gui.green"/>
+    </Description>
+    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
+    <AbilityGroupEffect abilityeffecttype="None">
+      <Abilities>
+        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
+      </Abilities>
+    </AbilityGroupEffect>
+    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
+      <Conditions>
+        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
+      </Conditions>
+      <Abilities>
+        <CharacterAbilityApplyStatusEffects>
+          <StatusEffects>
+            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
+              <Affliction identifier="quickfixer" amount="10.0"/>
+            </StatusEffect>
+          </StatusEffects>
+        </CharacterAbilityApplyStatusEffects>
+      </Abilities>
+    </AbilityGroupEffect>
+  </Talent>`
+
+	actual := `<Talent identifier="quickfixer">
+    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
+    <Description tag="talentdescription.quickfixer">
+      <Replace tag="[amount]" value="30" color="gui.green"/>
+      <Replace tag="[duration]" value="20" color="gui.green"/>
+    </Description>
+    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
+    <AbilityGroupEffect abilityeffecttype="None">
+      <Abilities>
+        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
+      </Abilities>
+    </AbilityGroupEffect>
+    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
+      <Conditions>
+        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
+      </Conditions>
+      <Abilities>
+        <CharacterAbilityApplyStatusEffects>
+          <StatusEffects>
+            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
+              <Affliction identifier="quickfixer" amount="20"/>
+            </StatusEffect>
+          </StatusEffects>
+        </CharacterAbilityApplyStatusEffects>
+      </Abilities>
+    </AbilityGroupEffect>
+  </Talent>`
+
+	result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
+
+	if err != nil {
+		t.Fatalf("Error processing content: %v", err)
+	}
+
+	if matches != 4 {
+		t.Errorf("Expected 4 matches, got %d", matches)
+	}
+
+	if mods != 4 {
+		t.Errorf("Expected 4 modifications, got %d", mods)
+	}
+
+	if result != actual {
+		t.Errorf("expected %s, got %s", actual, result)
+	}
+}
+
+func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
+	cwd, err := os.Getwd()
+	if err != nil {
+		t.Fatalf("Error getting current working directory: %v", err)
+	}
+
+	given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
+	if err != nil {
+		t.Fatalf("Error reading file: %v", err)
+	}
+
+	expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
+	if err != nil {
+		t.Fatalf("Error reading file: %v", err)
+	}
+
+	result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
+
+	if err != nil {
+		t.Fatalf("Error processing content: %v", err)
+	}
+
+	// We don't really care how many god damn matches there are as long as the result is correct
+	// if matches != 45 {
+	// 	t.Errorf("Expected 45 match, got %d", matches)
+	// }
+	//
+	// if mods != 45 {
+	// 	t.Errorf("Expected 45 modification, got %d", mods)
+	// }
+
+	if string(result) != string(expected) {
+		t.Errorf("expected %s, got %s", expected, result)
+	}
+}

release.sh

@@ -17,6 +17,7 @@ echo "Tag: $TAG"
 
 echo "Building the thing..."
 go build -o chef.exe .
+go install .
 
 echo "Creating a release..."
 TOKEN="$GITEA_API_KEY"

test.xml

@@ -1 +0,0 @@
-<config><item><value>100</value></item></config>

test_complex.xml

@@ -1,12 +0,0 @@
-<config>
-  <item>
-    <value>75</value>
-    <multiplier>2</multiplier>
-    <divider>4</divider>
-  </item>
-  <item>
-    <value>150</value>
-    <multiplier>3</multiplier>
-    <divider>2</divider>
-  </item>
-</config>

test_data.xml

@@ -1,37 +0,0 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<testdata>
-    <!-- Numeric values -->
-    <item>
-        <id>1</id>
-        <value>200</value>
-        <price>24.99</price>
-        <quantity>5</quantity>
-    </item>
-    
-    <!-- Text values -->
-    <item>
-        <id>2</id>
-        <name>Test Product</name>
-        <description>This is a test product description</description>
-        <category>Test</category>
-    </item>
-    
-    <!-- Mixed content -->
-    <item>
-        <id>3</id>
-        <name>Mixed Product</name>
-        <price>19.99</price>
-        <code>PRD-123</code>
-        <tags>sale,discount,new</tags>
-    </item>
-    
-    <!-- Empty and special values -->
-    <item>
-        <id>4</id>
-        <value></value>
-        <specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
-        <multiline>Line 1
-Line 2
-Line 3</multiline>
-    </item>
-</testdata> 

testfiles/foo/bar/test.xml

@@ -1 +0,0 @@
-<config><item><value>100</value></item></config>

utils/flags.go

@@ -0,0 +1,15 @@
+package utils
+
+import (
+	"flag"
+)
+
+var (
+	// Deprecated
+	GitFlag       = flag.Bool("git", false, "Use git to manage files")
+	// Deprecated
+	ResetFlag     = flag.Bool("reset", false, "Reset files to their original state")
+	LogLevel      = flag.String("loglevel", "INFO", "Set log level: ERROR, WARNING, INFO, DEBUG, TRACE")
+	ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
+	Filter        = flag.String("filter", "", "Filter commands before running them")
+)

utils/git.go

@@ -0,0 +1,97 @@
+package utils
+
+import (
+	"cook/logger"
+	"fmt"
+	"os"
+	"path/filepath"
+	"time"
+
+	"github.com/go-git/go-git/v5"
+	"github.com/go-git/go-git/v5/plumbing/object"
+)
+
+var (
+	Repo     *git.Repository
+	Worktree *git.Worktree
+)
+
+func SetupGit() error {
+	cwd, err := os.Getwd()
+	if err != nil {
+		return fmt.Errorf("failed to get current working directory: %w", err)
+	}
+	logger.Debug("Current working directory obtained: %s", cwd)
+
+	logger.Debug("Attempting to open git repository at %s", cwd)
+	Repo, err = git.PlainOpen(cwd)
+	if err != nil {
+		logger.Debug("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
+		Repo, err = git.PlainInit(cwd, false)
+		if err != nil {
+			return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
+		}
+		logger.Info("Successfully initialized a new git repository at %s", cwd)
+	} else {
+		logger.Info("Successfully opened existing git repository at %s", cwd)
+	}
+
+	logger.Debug("Attempting to obtain worktree for repository at %s", cwd)
+	Worktree, err = Repo.Worktree()
+	if err != nil {
+		return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
+	}
+	logger.Debug("Successfully obtained worktree for repository at %s", cwd)
+	return nil
+}
+
+func CleanupGitFiles(files []string) error {
+	for _, file := range files {
+		logger.Debug("Checking git status for file: %s", file)
+		status, err := Worktree.Status()
+		if err != nil {
+			logger.Error("Error getting worktree status: %v", err)
+			fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
+			return fmt.Errorf("error getting worktree status: %w", err)
+		}
+		if status.IsUntracked(file) {
+			logger.Info("Detected untracked file: %s. Adding to git index.", file)
+			_, err = Worktree.Add(file)
+			if err != nil {
+				logger.Error("Error adding file to git: %v", err)
+				fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
+				return fmt.Errorf("error adding file to git: %w", err)
+			}
+
+			filename := filepath.Base(file)
+			logger.Info("File %s added successfully. Committing with message: 'Track %s'", filename, filename)
+			_, err = Worktree.Commit("Track "+filename, &git.CommitOptions{
+				Author: &object.Signature{
+					Name:  "Big Chef",
+					Email: "bigchef@bigchef.com",
+					When:  time.Now(),
+				},
+			})
+			if err != nil {
+				logger.Error("Error committing file: %v", err)
+				fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
+				return fmt.Errorf("error committing file: %w", err)
+			}
+			logger.Info("Successfully committed file: %s", filename)
+		} else {
+			logger.Info("File %s is already tracked. Restoring it to the working tree.", file)
+			err := Worktree.Restore(&git.RestoreOptions{
+				Files:    []string{file},
+				Staged:   true,
+				Worktree: true,
+			})
+			if err != nil {
+				logger.Error("Error restoring file: %v", err)
+				fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
+				return fmt.Errorf("error restoring file: %w", err)
+			}
+			logger.Info("File %s restored successfully", file)
+		}
+	}
+	return nil
+}

utils/modifycommand.go

@@ -0,0 +1,234 @@
+package utils
+
+import (
+	"cook/logger"
+	"fmt"
+	"os"
+	"path/filepath"
+	"strings"
+
+	"github.com/bmatcuk/doublestar/v4"
+	"gopkg.in/yaml.v3"
+)
+
+type ModifyCommand struct {
+	Name     string   `yaml:"name"`
+	Regex    string   `yaml:"regex"`
+	Lua      string   `yaml:"lua"`
+	Files    []string `yaml:"files"`
+	Git      bool     `yaml:"git"`
+	Reset    bool     `yaml:"reset"`
+	LogLevel string   `yaml:"loglevel"`
+	Isolate  bool     `yaml:"isolate"`
+	NoDedup  bool     `yaml:"nodedup"`
+}
+type CookFile []ModifyCommand
+
+func (c *ModifyCommand) Validate() error {
+	if c.Regex == "" {
+		return fmt.Errorf("pattern is required")
+	}
+	if c.Lua == "" {
+		return fmt.Errorf("lua expression is required")
+	}
+	if len(c.Files) == 0 {
+		return fmt.Errorf("at least one file is required")
+	}
+	if c.LogLevel == "" {
+		c.LogLevel = "INFO"
+	}
+	return nil
+}
+
+// Ehh.. Not much better... Guess this wasn't the big deal
+var matchesMemoTable map[string]bool = make(map[string]bool)
+
+func Matches(path string, glob string) (bool, error) {
+	key := fmt.Sprintf("%s:%s", path, glob)
+	if matches, ok := matchesMemoTable[key]; ok {
+		logger.Debug("Found match for file %q and glob %q in memo table", path, glob)
+		return matches, nil
+	}
+	matches, err := doublestar.Match(glob, path)
+	if err != nil {
+		return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
+	}
+	matchesMemoTable[key] = matches
+	return matches, nil
+}
+
+type FileCommandAssociation struct {
+	File            string
+	IsolateCommands []ModifyCommand
+	Commands        []ModifyCommand
+}
+
+func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
+	associationCount := 0
+	fileCommands := make(map[string]FileCommandAssociation)
+
+	for _, file := range files {
+		fileCommands[file] = FileCommandAssociation{
+			File:            file,
+			IsolateCommands: []ModifyCommand{},
+			Commands:        []ModifyCommand{},
+		}
+		for _, command := range commands {
+			for _, glob := range command.Files {
+				matches, err := Matches(file, glob)
+				if err != nil {
+					logger.Trace("Failed to match glob %s with file %s: %v", glob, file, err)
+					continue
+				}
+				if matches {
+					logger.Debug("Found match for file %q and command %q", file, command.Regex)
+					association := fileCommands[file]
+
+					if command.Isolate {
+						association.IsolateCommands = append(association.IsolateCommands, command)
+					} else {
+						association.Commands = append(association.Commands, command)
+					}
+					fileCommands[file] = association
+					associationCount++
+				}
+			}
+		}
+		logger.Debug("Found %d commands for file %q", len(fileCommands[file].Commands), file)
+		if len(fileCommands[file].Commands) == 0 {
+			logger.Info("No commands found for file %q", file)
+		}
+		if len(fileCommands[file].IsolateCommands) > 0 {
+			logger.Info("Found %d isolate commands for file %q", len(fileCommands[file].IsolateCommands), file)
+		}
+	}
+	logger.Info("Found %d associations between %d files and %d commands", associationCount, len(files), len(commands))
+	return fileCommands, nil
+}
+
+func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
+	logger.Info("Aggregating globs for %d commands", len(commands))
+	globs := make(map[string]struct{})
+	for _, command := range commands {
+		for _, glob := range command.Files {
+			glob = strings.Replace(glob, "~", os.Getenv("HOME"), 1)
+			glob = strings.ReplaceAll(glob, "\\", "/")
+			globs[glob] = struct{}{}
+		}
+	}
+	logger.Info("Found %d unique globs", len(globs))
+	return globs
+}
+
+func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
+	var files []string
+	filesMap := make(map[string]bool)
+
+	cwd, err := os.Getwd()
+	if err != nil {
+		return nil, fmt.Errorf("failed to get current working directory: %w", err)
+	}
+
+	logger.Debug("Expanding patterns from directory: %s", cwd)
+	for pattern := range patterns {
+		logger.Trace("Processing pattern: %s", pattern)
+		matches, _ := doublestar.Glob(os.DirFS(cwd), pattern)
+		logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
+		for _, m := range matches {
+			info, err := os.Stat(m)
+			if err != nil {
+				logger.Warning("Error getting file info for %s: %v", m, err)
+				continue
+			}
+			if !info.IsDir() && !filesMap[m] {
+				logger.Trace("Adding file to process list: %s", m)
+				filesMap[m], files = true, append(files, m)
+			}
+		}
+	}
+
+	if len(files) > 0 {
+		logger.Debug("Found %d files to process: %v", len(files), files)
+	}
+	return files, nil
+}
+
+func LoadCommands(args []string) ([]ModifyCommand, error) {
+	commands := []ModifyCommand{}
+
+	logger.Info("Loading commands from cook files: %s", args)
+	for _, arg := range args {
+		newcommands, err := LoadCommandsFromCookFiles(arg)
+		if err != nil {
+			return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
+		}
+		logger.Info("Successfully loaded %d commands from cook iles", len(newcommands))
+		commands = append(commands, newcommands...)
+		logger.Info("Now total commands: %d", len(commands))
+	}
+
+	logger.Info("Loaded %d commands from all cook f", len(commands))
+	return commands, nil
+}
+
+func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
+	cwd, err := os.Getwd()
+	if err != nil {
+		return nil, fmt.Errorf("failed to get current working directory: %w", err)
+	}
+
+	commands := []ModifyCommand{}
+	cookFiles, err := doublestar.Glob(os.DirFS(cwd), pattern)
+	if err != nil {
+		return nil, fmt.Errorf("failed to glob cook files: %w", err)
+	}
+
+	for _, cookFile := range cookFiles {
+		cookFile = filepath.Clean(cookFile)
+		cookFile = strings.ReplaceAll(cookFile, "\\", "/")
+		logger.Info("Loading commands from cook file: %s", cookFile)
+
+		cookFileData, err := os.ReadFile(cookFile)
+		if err != nil {
+			return nil, fmt.Errorf("failed to read cook file: %w", err)
+		}
+		newcommands, err := LoadCommandsFromCookFile(cookFileData)
+		if err != nil {
+			return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
+		}
+		commands = append(commands, newcommands...)
+	}
+
+	return commands, nil
+}
+
+func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
+	commands := []ModifyCommand{}
+	err := yaml.Unmarshal(cookFileData, &commands)
+	if err != nil {
+		return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
+	}
+	return commands, nil
+}
+
+// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
+func CountGlobsBeforeDedup(commands []ModifyCommand) int {
+	count := 0
+	for _, cmd := range commands {
+		count += len(cmd.Files)
+	}
+	return count
+}
+
+func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
+	filteredCommands := []ModifyCommand{}
+	filters := strings.Split(filter, ",")
+	for _, cmd := range commands {
+		for _, filter := range filters {
+			if strings.Contains(cmd.Name, filter) {
+				filteredCommands = append(filteredCommands, cmd)
+			}
+		}
+	}
+	return filteredCommands
+}

utils/replacecommand.go

@@ -0,0 +1,57 @@
+package utils
+
+import (
+	"cook/logger"
+	"fmt"
+	"sort"
+)
+
+type ReplaceCommand struct {
+	From int
+	To   int
+	With string
+}
+
+func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
+	var err error
+
+	sort.Slice(modifications, func(i, j int) bool {
+		return modifications[i].From > modifications[j].From
+	})
+	logger.Trace("Preparing to apply %d replacement commands in reverse order", len(modifications))
+
+	executed := 0
+	for _, modification := range modifications {
+		fileData, err = modification.Execute(fileData)
+		if err != nil {
+			logger.Error("Failed to execute replacement: %v", err)
+			continue
+		}
+		executed++
+	}
+	logger.Info("Successfully applied %d text replacements", executed)
+	return fileData, executed
+}
+
+func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
+	err := m.Validate(len(fileDataStr))
+	if err != nil {
+		return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
+	}
+
+	logger.Trace("Replace pos %d-%d with %q", m.From, m.To, m.With)
+	return fileDataStr[:m.From] + m.With + fileDataStr[m.To:], nil
+}
+
+func (m *ReplaceCommand) Validate(maxsize int) error {
+	if m.To < m.From {
+		return fmt.Errorf("command to is less than from: %v", m)
+	}
+	if m.From > maxsize || m.To > maxsize {
+		return fmt.Errorf("command from or to is greater than replacement length: %v", m)
+	}
+	if m.From < 0 || m.To < 0 {
+		return fmt.Errorf("command from or to is less than 0: %v", m)
+	}
+	return nil
+}

utils/replacecommand_test.go

@@ -0,0 +1,504 @@
+package utils
+
+import (
+	"testing"
+
+	"github.com/stretchr/testify/assert"
+)
+
+func TestReplaceCommandExecute(t *testing.T) {
+	tests := []struct {
+		name        string
+		input       string
+		command     ReplaceCommand
+		expected    string
+		shouldError bool
+	}{
+		{
+			name:        "Simple replacement",
+			input:       "This is a test string",
+			command:     ReplaceCommand{From: 5, To: 7, With: "was"},
+			expected:    "This was a test string",
+			shouldError: false,
+		},
+		{
+			name:        "Replace at beginning",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 0, To: 5, With: "Hi"},
+			expected:    "Hi world",
+			shouldError: false,
+		},
+		{
+			name:        "Replace at end",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 6, To: 11, With: "everyone"},
+			expected:    "Hello everyone",
+			shouldError: false,
+		},
+		{
+			name:        "Replace entire string",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
+			expected:    "Goodbye!",
+			shouldError: false,
+		},
+		{
+			name:        "Error: From > To",
+			input:       "Test string",
+			command:     ReplaceCommand{From: 7, To: 5, With: "fail"},
+			expected:    "Test string",
+			shouldError: true,
+		},
+		{
+			name:        "Error: From > string length",
+			input:       "Test",
+			command:     ReplaceCommand{From: 10, To: 12, With: "fail"},
+			expected:    "Test",
+			shouldError: true,
+		},
+		{
+			name:        "Error: To > string length",
+			input:       "Test",
+			command:     ReplaceCommand{From: 2, To: 10, With: "fail"},
+			expected:    "Test",
+			shouldError: true,
+		},
+	}
+
+	for _, tc := range tests {
+		t.Run(tc.name, func(t *testing.T) {
+			result, err := tc.command.Execute(tc.input)
+
+			if tc.shouldError {
+				if err == nil {
+					t.Errorf("Expected an error for command %+v but got none", tc.command)
+				}
+			} else {
+				if err != nil {
+					t.Errorf("Unexpected error: %v", err)
+				}
+				if result != tc.expected {
+					t.Errorf("Expected %q, got %q", tc.expected, result)
+				}
+			}
+		})
+	}
+}
+
+func TestExecuteModifications(t *testing.T) {
+	tests := []struct {
+		name          string
+		input         string
+		modifications []ReplaceCommand
+		expected      string
+		expectedCount int
+	}{
+		{
+			name:  "Single modification",
+			input: "Hello world",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 5, With: "Hi"},
+			},
+			expected:      "Hi world",
+			expectedCount: 1,
+		},
+		{
+			name:  "Multiple modifications",
+			input: "This is a test string",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 4, With: "That"},
+				{From: 8, To: 14, With: "sample"},
+			},
+			expected:      "That is sample string",
+			expectedCount: 2,
+		},
+		{
+			name:  "Overlapping modifications",
+			input: "ABCDEF",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 3, With: "123"}, // ABC -> 123
+				{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
+			},
+			// The actual behavior with the current implementation
+			expected:      "123yzF",
+			expectedCount: 2,
+		},
+		{
+			name:  "Sequential modifications",
+			input: "Hello world",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 5, With: "Hi"},
+				{From: 5, To: 6, With: ""}, // Remove the space
+				{From: 6, To: 11, With: "everyone"},
+			},
+			expected:      "Hieveryone",
+			expectedCount: 3,
+		},
+	}
+
+	for _, tc := range tests {
+		t.Run(tc.name, func(t *testing.T) {
+			// Make a copy of the modifications to avoid modifying the test case
+			mods := make([]ReplaceCommand, len(tc.modifications))
+			copy(mods, tc.modifications)
+
+			result, count := ExecuteModifications(mods, tc.input)
+
+			if count != tc.expectedCount {
+				t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
+			}
+
+			if result != tc.expected {
+				t.Errorf("Expected %q, got %q", tc.expected, result)
+			}
+		})
+	}
+}
+
+func TestReverseOrderExecution(t *testing.T) {
+	// This test verifies the current behavior of modification application
+	input := "Original text with multiple sections"
+
+	// Modifications in specific positions
+	modifications := []ReplaceCommand{
+		{From: 0, To: 8, With: "Modified"},  // Original -> Modified
+		{From: 9, To: 13, With: "document"}, // text -> document
+		{From: 14, To: 22, With: "without"}, // with -> without
+		{From: 23, To: 31, With: "any"},     // multiple -> any
+	}
+
+	// The actual current behavior of our implementation
+	expected := "Modified document withouttanytions"
+
+	result, count := ExecuteModifications(modifications, input)
+
+	if count != 4 {
+		t.Errorf("Expected 4 modifications, got %d", count)
+	}
+
+	if result != expected {
+		t.Errorf("Expected %q, got %q", expected, result)
+	}
+}
+
+// Replace text in the middle of a string with new content
+func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello replaced, how are you?", result)
+}
+
+// Replace with empty string (deletion)
+func TestReplaceCommandExecute_DeletesText(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello , how are you?", result)
+}
+
+// Replace with longer string than original segment
+func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "longerreplacement",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello longerreplacement, how are you?", result)
+}
+
+// From and To values are the same (zero-length replacement)
+func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 5,
+		To:   5,
+		With: "inserted",
+	}
+
+	fileContent := "Hello world"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Helloinserted world", result)
+}
+
+// From value is greater than To value
+func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 10,
+		To:   5,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world, how are you?", result)
+}
+
+// From or To values exceed string length
+func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 5,
+		To:   50, // Exceeds the length of the fileContent
+		With: "replaced",
+	}
+
+	fileContent := "Hello world"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world", result)
+}
+
+// From or To values are negative
+func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: -1,
+		To:   10,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world, how are you?", result)
+}
+
+// Modifications are applied in reverse order (from highest to lowest 'From' value)
+func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 4, With: "That"},
+		{From: 10, To: 14, With: "sample"},
+		{From: 26, To: 38, With: "modifications"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "That is a sample string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// One or more modifications fail but others succeed
+func TestExecuteModificationsWithPartialFailures(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	// Create a custom ReplaceCommand implementation that will fail
+	failingCommand := ReplaceCommand{
+		From: 15,
+		To:   10, // Invalid range (To < From) to cause failure
+		With: "will fail",
+	}
+
+	// Valid commands
+	validCommand1 := ReplaceCommand{
+		From: 0,
+		To:   4,
+		With: "That",
+	}
+
+	validCommand2 := ReplaceCommand{
+		From: 26,
+		To:   38,
+		With: "modifications",
+	}
+
+	modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "That is a test string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	// Only 2 out of 3 modifications should succeed
+	if executed != 2 {
+		t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
+	}
+}
+
+// All valid modifications are executed and the modified string is returned
+func TestExecuteModificationsAllValid(t *testing.T) {
+	// Setup test data
+	fileData := "Hello world, this is a test"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 5, With: "Hi"},
+		{From: 18, To: 20, With: "was"},
+		{From: 21, To: 27, With: "an example"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "Hi world, this was an example"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// The count of successfully executed modifications is returned
+func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
+	// Setup test data
+	fileData := "Initial text for testing"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 7, With: "Final"},
+		{From: 12, To: 16, With: "example"},
+		{From: 17, To: 24, With: "process"},
+	}
+
+	// Execute the function
+	_, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify the count of executed modifications
+	expectedExecuted := 3
+	if executed != expectedExecuted {
+		t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
+	}
+}
+
+// Empty modifications list returns the original string with zero executed count
+func TestExecuteModificationsWithEmptyList(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	if result != fileData {
+		t.Errorf("Expected result to be %q, but got %q", fileData, result)
+	}
+
+	if executed != 0 {
+		t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
+	}
+}
+
+// Modifications with identical 'From' values
+func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{
+		{From: 10, To: 14, With: "sample"},
+		{From: 10, To: 14, With: "example"},
+		{From: 26, To: 38, With: "modifications"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	// Yes, it's mangled, yes, it's intentional
+	// Every subsequent command works with the modified contents of the previous command
+	// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
+	// So we prepend "example" and end up with "examplele"
+	// Whether sample or example goes first here is irrelevant to us
+	// But it just so happens that sample goes first, so we end up with "examplele"
+	expectedResult := "This is a examplele string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// Modifications that would affect each other if not sorted properly
+func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
+	// Setup test data
+	fileData := "The quick brown fox jumps over the lazy dog"
+
+	modifications := []ReplaceCommand{
+		{From: 4, To: 9, With: "slow"},
+		{From: 10, To: 15, With: "red"},
+		{From: 16, To: 19, With: "cat"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "The slow red cat jumps over the lazy dog"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}