85 Commits

Author SHA1 Message Date
5a31703840 Implement per command logger 2025-03-29 17:29:21 +01:00
162d0c758d Fix some tests 2025-03-29 17:29:21 +01:00
14d64495b6 Add deduplicate flag 2025-03-29 17:29:21 +01:00
fe6e97e832 Don't deduplicate (yet) 2025-03-29 17:23:21 +01:00
35b3d8b099 Reduce some of the reads and writes
It's really not necessary
2025-03-28 23:39:11 +01:00
2e3e958e15 Fix some tests and add some logs 2025-03-28 23:31:44 +01:00
955afc4295 Refactor running commands to separate functions 2025-03-28 16:59:22 +01:00
2c487bc443 Implement "Isolate" commands
Commands that run alone one by one on reading and writing the file
This should be used on commands that will modify a large part of the
file (or generally large parts)
Since that can fuck up the indices of other commands when ran together
2025-03-28 16:56:39 +01:00
b77224176b Add file lua value 2025-03-28 16:47:21 +01:00
a2201053c5 Remove some random ass fmt printf 2025-03-28 13:24:12 +01:00
04cedf5ece Fix the concurrent map writes 2025-03-28 11:35:38 +01:00
ebb07854cc Memoize the match table 2025-03-28 11:31:27 +01:00
8a86ae2f40 Add filter flag 2025-03-28 11:20:44 +01:00
e8f16dda2b Housekeeping 2025-03-28 02:14:27 +01:00
513773f641 Again 2025-03-28 01:26:26 +01:00
22914fe243 Add a lil log 2025-03-28 01:24:23 +01:00
2d523dfe64 Rename pattern to regex 2025-03-28 01:08:48 +01:00
2629722f67 Minor fixes and tweaks 2025-03-28 01:03:27 +01:00
1f6c4e4976 Fix up the tests and some minor bugs 2025-03-28 00:51:26 +01:00
bfd08e754e Replace old tests with asserts 2025-03-28 00:40:53 +01:00
750010b71a Add more tests to regex 2025-03-28 00:28:51 +01:00
9064a53820 Add more tests (and fix some things) for replacecommand 2025-03-28 00:23:42 +01:00
294c04a11a Add more tests for modifycommand 2025-03-28 00:03:23 +01:00
ba7ac07001 Fix up the logs a little 2025-03-27 23:36:56 +01:00
5d10178bf9 Update old and add new tests 2025-03-27 23:33:57 +01:00
f91c2b4795 More cleaning up 2025-03-27 23:07:22 +01:00
057db23d09 Implement panic recovery :?? 2025-03-27 23:06:46 +01:00
bf72734b90 Clean up regex.go a little 2025-03-27 23:04:39 +01:00
cc30c2bdcb Cleanup 2025-03-27 22:56:42 +01:00
f453079c72 Fix up regex.go 2025-03-27 22:50:15 +01:00
e634fe28bd Clean up processor 2025-03-27 22:24:59 +01:00
4e4b7bbd19 Implement parallel file processing 2025-03-27 22:22:43 +01:00
89eed3f847 Refactor git shit to its own module 2025-03-27 22:20:22 +01:00
f008efd5e1 Refactor modify and replace to their own files 2025-03-27 22:18:12 +01:00
f6def1e5a5 Refactor entirety of replace command to main for now 2025-03-27 22:11:03 +01:00
867b188718 Work out file reading and writing 2025-03-27 22:02:36 +01:00
aac29a4074 Refactor more stuff around 2025-03-27 21:58:52 +01:00
8a40f463f7 Implement file command association 2025-03-27 21:54:46 +01:00
8d4db1da91 Clean up code add some log lines and tidy up expandglobs 2025-03-27 21:49:28 +01:00
d41e2afe17 Update 2025-03-27 21:43:36 +01:00
76457d22cf Partially rework reading args to modify command loading 2025-03-27 21:39:16 +01:00
912950d463 Remove the vestiges of xml and json 2025-03-27 21:31:45 +01:00
25326ea11b Remove xml and json
They are simply not as useful as regex at all
There is nothing they can do regex cannot
And they have one massive penalty: the encoding
Which often results in MASSIVE diffs
2025-03-27 21:28:20 +01:00
df212b7fcc Remove jsonpath and xpath 2025-03-27 21:27:47 +01:00
f4a963760a Add dumptable helper function 2025-03-27 20:07:59 +01:00
d236811cb9 Introduce a new logging level for lua values 2025-03-27 20:06:50 +01:00
da93770334 Add strsplit lua helper 2025-03-27 19:56:31 +01:00
d9f54a8354 Fix test again 2025-03-27 19:49:57 +01:00
dc8da8ab63 Fix overlapping capture groups 2025-03-27 19:43:06 +01:00
24262a7dca Remove old unused xml files 2025-03-27 19:31:54 +01:00
d77b13c363 Update regression test 2025-03-27 19:31:20 +01:00
a9c60a3698 Neatly align log columns 2025-03-27 19:26:14 +01:00
66bcf21d79 Add goroutine numbers to log lines 2025-03-27 19:19:39 +01:00
e847e5c3ce Make little better logging 2025-03-27 18:53:02 +01:00
9a70c9696e Fix logger 2025-03-27 18:46:28 +01:00
9cea103042 Implement a more better logging solution 2025-03-27 17:53:43 +01:00
81d8259dfc Comment out some xml tests for now
We're not working on it for now
2025-03-27 17:46:43 +01:00
5c5fbac63f Make doublestar a little cleaner 2025-03-27 17:21:13 +01:00
3e818e61c7 Add string.format shortcut to lua 2025-03-27 15:38:07 +01:00
001470ffe4 Fix up regression tests 2025-03-27 15:37:57 +01:00
d88a76c4e2 Fix logging of groups 2025-03-26 22:26:02 +01:00
d3a1f1bd96 Rework regex grouping to avoid changing the same area twice 2025-03-26 22:24:19 +01:00
07a5f3f1a4 Add replaceCommands to avoid index suicide 2025-03-26 21:55:34 +01:00
e2257e082a Add a regression test 2025-03-26 21:55:17 +01:00
b3fce4244d Fix regex for numbers to support negative numbers 2025-03-26 18:30:21 +01:00
bd443067b6 Add support for !num inside of named capture groups 2025-03-26 14:04:39 +01:00
a9b6f7f984 Implement printing from lua 2025-03-26 13:37:39 +01:00
10c39b02a0 Fix some regex tests 2025-03-26 13:13:53 +01:00
7f4392b10e Implement "replacement" variable that simply replaces the match 2025-03-26 13:00:52 +01:00
7e19cf4e2c Rework named captures to be array
To comply with the whole reverse replacing
2025-03-26 12:50:55 +01:00
c5fb20e96a Implement named capture groups 2025-03-26 12:28:28 +01:00
a8c2257f20 Add named capture group tests 2025-03-26 12:17:01 +01:00
b63b4d1352 Add some more shorthands for regex 2025-03-26 12:06:04 +01:00
6a3d44ccd0 Redo what claude removed 2025-03-26 11:42:00 +01:00
c22e6ff41f Code polish 2025-03-26 11:40:23 +01:00
068c64d714 Fix up file reseting 2025-03-26 11:10:43 +01:00
2c7a4f5d97 Add a lot more logs to regex
What the fuck is going on?
2025-03-26 03:30:08 +01:00
0d7d251e76 Implement git reset 2025-03-26 03:23:16 +01:00
0d8c447ff6 Add support for git ie. automatically resetting changes to ensure clean slate 2025-03-26 03:22:05 +01:00
bb14087598 Fix oopsie 2025-03-26 02:52:28 +01:00
66a522aa12 Try to include xml node children in lua table 2025-03-26 02:50:33 +01:00
1a4b4f76f2 Map the weird numeric escapes to textual ones 2025-03-26 02:34:21 +01:00
2bfd9f951e Fix up some more xml tests and other small bugs 2025-03-26 02:17:42 +01:00
e5092edf53 Implement parsing xml to and from lua
A lot more complex than json.........
2025-03-26 01:36:49 +01:00
e31c0e4e8f Implement xpath (by calling library) 2025-03-26 01:19:41 +01:00
37 changed files with 7189 additions and 7012 deletions

1
.gitignore vendored
View File

@@ -1 +1,2 @@
*.exe
.qodo

39
.vscode/launch.json vendored
View File

@@ -5,16 +5,45 @@
"version": "0.2.0",
"configurations": [
{
"name": "Launch Package",
"name": "Launch Package (Barotrauma)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"*.yml",
]
},
{
"name": "Launch Package (Barotrauma cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"cookassistant.yml",
]
},
{
"name": "Launch Package (Workspace)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"args": [
"-mode=json",
"$..name",
"v='pero'",
"test.json"
"-loglevel",
"trace",
"(?-s)LightComponent!anyrange=\"(!num)\"",
"*4",
"**/Outpost*.xml"
]
}
]

View File

@@ -1,651 +0,0 @@
<?xml version="1.0" encoding="utf-8"?>
<Talents>
<Talent identifier="powerarmor">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.powerarmor">
<Replace tag="[bonusmovement]" value="25" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHasItem tags="deepdivinglarge" />
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
</Abilities>
</AbilityGroupInterval>
<AddedRecipe itemidentifier="exosuit"/>
</Talent>
<Talent identifier="foolhardy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="foolhardy" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="berserker">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="berserker" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="mudraptorwrestler">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.mudraptorwrestler">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattypeself">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData weapontype="NoWeapon,Melee" />
<AbilityConditionCharacter>
<Conditional group="eq mudraptor" />
</AbilityConditionCharacter>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="heavylifting">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.heavylifting">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHoldingItem tags="alienartifact,crate"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="iamthatguy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.iamthatguy">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.skillbonus">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
<Abilities>
<CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="heavywrench"/>
</Talent>
<Talent identifier="robotics">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.robotics"/>
<Description tag="talentdescription.roboticsreminder">
<Replace tag="[amount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="defensebotspawner"/>
<AddedRecipe itemidentifier="defensebotammobox"/>
</Talent>
<Talent identifier="ironstorm">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.ironstorm">
<Replace tag="[chance]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="scrapcannon"/>
</Talent>
<Talent identifier="residualwaste">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.residualwaste">
<Replace tag="[chance]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomChance="0.2"/>
<!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
<AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="massproduction">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.massproduction">
<Replace tag="[chance]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
<Conditions>
<AbilityConditionServerRandom randomChance="0.4" />
</Conditions>
<Abilities>
<CharacterAbilityRemoveRandomIngredient>
<AbilityConditionItem category="Material"/>
</CharacterAbilityRemoveRandomIngredient>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="toolmaintenance">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.toolmaintenance">
<Replace tag="[amount]" value="1" color="gui.green"/>
</Description>
<!-- Give once when unlocking the talent -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupEffect>
<!-- Give every 60 seconds for late comers -->
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="miner">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
<Description tag="talentdescription.miner">
<Replace tag="[probability]" value="320" color="gui.green"/>
</Description>
<Description tag="talentdescription.gainoredetachspeed">
<Replace tag="[amount]" value="1600" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomchance="12.8"/>
<AbilityConditionItem tags="ore"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="retrofit">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.retrofit" />
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ironman">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="ironhelmet"/>
<AddedRecipe itemidentifier="makeshiftarmor"/>
</Talent>
<Talent identifier="oiledmachinery">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.oiledmachinery">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="pumpndump">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.pumpndump">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<conditions>
<AbilityConditionItem tags="pump"/>
</conditions>
<Abilities>
<CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ballastdenizen">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.ballastdenizen">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="engineengineer">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.engineengineer">
<Replace tag="[amount]" value="2.5" color="gui.green"/>
<Replace tag="[max]" value="5" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="1" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="2" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="3" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="4" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="5" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="6" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="7" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel minlevel="8" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="multifunctional">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.multifunctional">
<Replace tag="[powerincrease]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="wrenchitem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="crowbaritem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="salvagecrew">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.bonusxponmission">
<Replace tag="[xpbonus]" value="30" color="gui.green"/>
<Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
</Description>
<Description tag="talentdescription.salvagecrew">
<Replace tag="[swimbonus]" value="50" color="gui.green"/>
<Replace tag="[resistanceamount]" value="10" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
<Conditions>
<AbilityConditionMission missiontype="Salvage"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="1.3"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionInSubmarine submarinetype="Wreck" />
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="This" disabledeltatime="true">
<Affliction identifier="salvagecrew" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.machinemaniac">
<Replace tag="[bonus]" value="80" color="gui.green"/>
<Replace tag="[amount]" value="3" color="gui.orange"/>
</Description>
<Description tag="talentdescription.machinemaniac.30">
<Replace tag="[requirement]" value="12" color="gui.green"/>
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
<Replace tag="[xpamount]" value="500" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.50">
<Replace tag="[requirement]" value="20" color="gui.green"/>
<Replace tag="[level]" value="1" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.100">
<Replace tag="[requirement]" value="40" color="gui.green"/>
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<!-- Give the player stats that tracks if the rewards should be given -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
</Conditions>
<Abilities>
<CharacterAbilityGiveExperience amount="2000"/>
<CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
</Conditions>
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="tinkerer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.increasemaxrepairmechanical">
<Replace tag="[percentage]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="modularrepairs">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
</Description>
<Description tag="talentdescription.freeupgrade">
<Replace tag="[level]" value="1" color="gui.green"/>
<Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="repairpack"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="hullfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="25" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="fixfoamgrenade"/>
<AddedRecipe itemidentifier="handheldstatusmonitor"/>
</Talent>
<Talent identifier="letitdrain">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.letitdrain"/>
<Description tag="talentdescription.letitdrainreminder">
<Replace tag="[itemcount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="portablepump"/>
</Talent>
<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="scrapsavant">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
<Description tag="talentdescription.doublescrapoutput" />
<Description tag="talentdescription.findadditionalscrap">
<Replace tag="[probability]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionItem tags="scrap"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
<Conditions>
<AbilityConditionItemInSubmarine submarinetype="Wreck"/>
<AbilityConditionItem tags="container"/>
</Conditions>
<Abilities>
<CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
<StatusEffects>
<StatusEffect type="OnAbility" target="UseTarget" >
<SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
</StatusEffect>
</StatusEffects>
</CharacterAbilitySpawnItemsToContainer>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="safetyfirst">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="safetyharness"/>
</Talent>
</Talents>

View File

@@ -0,0 +1,27 @@
package main
import (
"modify/logger"
"time"
)
func main() {
// Initialize logger with DEBUG level
logger.Init(logger.LevelDebug)
// Test different log levels
logger.Info("This is an info message")
logger.Debug("This is a debug message")
logger.Warning("This is a warning message")
logger.Error("This is an error message")
logger.Trace("This is a trace message (not visible at DEBUG level)")
// Test with a goroutine
logger.SafeGo(func() {
time.Sleep(10 * time.Millisecond)
logger.Info("Message from goroutine")
})
// Wait for goroutine to complete
time.Sleep(20 * time.Millisecond)
}

View File

@@ -1,6 +1,7 @@
package main
import (
"modify/utils"
"os"
"path/filepath"
"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
files, err := expandFilePatterns(tc.patterns)
// Convert string patterns to map[string]struct{} for ExpandGLobs
patternMap := make(map[string]struct{})
for _, pattern := range tc.patterns {
patternMap[pattern] = struct{}{}
}
files, err := utils.ExpandGLobs(patternMap)
if err != nil {
t.Fatalf("expandFilePatterns failed: %v", err)
t.Fatalf("ExpandGLobs failed: %v", err)
}
if len(files) != tc.expected {

34
go.mod
View File

@@ -3,16 +3,36 @@ module modify
go 1.24.1
require (
github.com/PaesslerAG/jsonpath v0.1.1
github.com/antchfx/xmlquery v1.4.4
github.com/bmatcuk/doublestar/v4 v4.8.1
github.com/stretchr/testify v1.10.0
github.com/yuin/gopher-lua v1.1.1
gopkg.in/yaml.v3 v3.0.1
)
require (
github.com/PaesslerAG/gval v1.0.0 // indirect
github.com/antchfx/xpath v1.3.3 // indirect
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da // indirect
golang.org/x/net v0.33.0 // indirect
golang.org/x/text v0.21.0 // indirect
dario.cat/mergo v1.0.0 // indirect
github.com/Microsoft/go-winio v0.6.2 // indirect
github.com/ProtonMail/go-crypto v1.1.5 // indirect
github.com/cloudflare/circl v1.6.0 // indirect
github.com/cyphar/filepath-securejoin v0.4.1 // indirect
github.com/davecgh/go-spew v1.1.1 // indirect
github.com/emirpasic/gods v1.18.1 // indirect
github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
github.com/go-git/go-billy/v5 v5.6.2 // indirect
github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect
github.com/kevinburke/ssh_config v1.2.0 // indirect
github.com/pjbgf/sha1cd v0.3.2 // indirect
github.com/pmezard/go-difflib v1.0.0 // indirect
github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect
github.com/skeema/knownhosts v1.3.1 // indirect
github.com/xanzy/ssh-agent v0.3.3 // indirect
golang.org/x/crypto v0.35.0 // indirect
golang.org/x/sys v0.30.0 // indirect
gopkg.in/warnings.v0 v0.1.2 // indirect
)
require (
github.com/go-git/go-git/v5 v5.14.0
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect
golang.org/x/net v0.35.0 // indirect
)

172
go.sum
View File

@@ -1,82 +1,106 @@
github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
dario.cat/mergo v1.0.0 h1:AGCNq9Evsj31mOgNPcLyXc+4PNABt905YmuqPYYpBWk=
dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk=
github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY=
github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY=
github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU=
github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4=
github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE=
github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8=
github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4=
github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio=
github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs=
github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da h1:oI5xCqsCo564l8iNU+DwB5epxmsaqB+rhGL0m5jtYqE=
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
github.com/cloudflare/circl v1.6.0 h1:cr5JKic4HI+LkINy2lg3W2jF8sHCVTBncJr5gIIq7qk=
github.com/cloudflare/circl v1.6.0/go.mod h1:uddAzsPgqdMAYatqJ0lsjX1oECcQLIlRpzZh3pJrofs=
github.com/cyphar/filepath-securejoin v0.4.1 h1:JyxxyPEaktOD+GAnqIqTf9A8tHyAG22rowi7HkoSU1s=
github.com/cyphar/filepath-securejoin v0.4.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI=
github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/elazarl/goproxy v1.7.2 h1:Y2o6urb7Eule09PjlhQRGNsqRfPmYI3KKQLFpCAV3+o=
github.com/elazarl/goproxy v1.7.2/go.mod h1:82vkLNir0ALaW14Rc399OTTjyNREgmdL2cVoIbS6XaE=
github.com/emirpasic/gods v1.18.1 h1:FXtiHYKDGKCW2KzwZKx0iC0PQmdlorYgdFG9jPXJ1Bc=
github.com/emirpasic/gods v1.18.1/go.mod h1:8tpGGwCnJ5H4r6BWwaV6OrWmMoPhUl5jm/FMNAnJvWQ=
github.com/gliderlabs/ssh v0.3.8 h1:a4YXD1V7xMF9g5nTkdfnja3Sxy1PVDCj1Zg4Wb8vY6c=
github.com/gliderlabs/ssh v0.3.8/go.mod h1:xYoytBv1sV0aL3CavoDuJIQNURXkkfPA/wxQ1pL1fAU=
github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI=
github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic=
github.com/go-git/go-billy/v5 v5.6.2 h1:6Q86EsPXMa7c3YZ3aLAQsMA0VlWmy43r6FHqa/UNbRM=
github.com/go-git/go-billy/v5 v5.6.2/go.mod h1:rcFC2rAsp/erv7CMz9GczHcuD0D32fWzH+MJAU+jaUU=
github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4=
github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60=
github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k=
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ=
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw=
github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8=
github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU=
github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A=
github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99/go.mod h1:1lJo3i6rXxKeerYnT8Nvf0QmHCRC1n8sfWVwXF2Frvo=
github.com/kevinburke/ssh_config v1.2.0 h1:x584FjTGwHzMwvHx18PXxbBVzfnxogHaAReU4gf13a4=
github.com/kevinburke/ssh_config v1.2.0/go.mod h1:CT57kijsi8u/K/BOFA39wgDQJ9CxiF4nAY/ojJ6r6mM=
github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
github.com/onsi/gomega v1.34.1 h1:EUMJIKUjM8sKjYbtxQI9A4z2o+rruxnzNvpknOXie6k=
github.com/onsi/gomega v1.34.1/go.mod h1:kU1QgUvBDLXBJq618Xvm2LUX6rSAfRaFRTcdOeDLwwY=
github.com/pjbgf/sha1cd v0.3.2 h1:a9wb0bp1oC2TGwStyn0Umc/IGKQnEgF0vVaZ8QF8eo4=
github.com/pjbgf/sha1cd v0.3.2/go.mod h1:zQWigSxVmsHEZow5qaLtPYxpcKMMQpa09ixqBxuCS6A=
github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 h1:n661drycOFuPLCN3Uc8sB6B/s6Z4t2xvBgU1htSHuq8=
github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3/go.mod h1:A0bzQcvG0E7Rwjx0REVgAGH58e96+X0MeOfepqsbeW4=
github.com/sirupsen/logrus v1.7.0/go.mod h1:yWOB1SBYBC5VeMP7gHvWumXLIWorT60ONWic61uBYv0=
github.com/skeema/knownhosts v1.3.1 h1:X2osQ+RAjK76shCbvhHHHVl3ZlgDm8apHEHFqRjnBY8=
github.com/skeema/knownhosts v1.3.1/go.mod h1:r7KTdC8l4uxWRyK2TpQZ/1o5HaSzh06ePQNxPwTcfiY=
github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM=
github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw=
github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
golang.org/x/net v0.33.0 h1:74SYHlV8BIgHIFC/LrYkOGIwL19eTYXQ5wc6TBuO36I=
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs=
golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ=
golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8=
golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY=
golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc=
golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo=
golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU=
golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s=
golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
gopkg.in/warnings.v0 v0.1.2 h1:wFXVbFY8DY5/xOe1ECiWdKCzZlxgshcYVNkBHstARME=
gopkg.in/warnings.v0 v0.1.2/go.mod h1:jksf8JmL6Qr/oQM2OXTHunEvvTAsrWBLb6OOjuVWRNI=
gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=

465
logger/logger.go Normal file
View File

@@ -0,0 +1,465 @@
package logger
import (
"bytes"
"fmt"
"io"
"log"
"os"
"path/filepath"
"runtime"
"strconv"
"strings"
"sync"
"time"
)
// LogLevel defines the severity of log messages
type LogLevel int
const (
// LevelError is for critical errors that should always be displayed
LevelError LogLevel = iota
// LevelWarning is for important warnings
LevelWarning
// LevelInfo is for informational messages
LevelInfo
// LevelDebug is for detailed debugging information
LevelDebug
// LevelTrace is for very detailed tracing information
LevelTrace
// LevelLua is specifically for output from Lua scripts
LevelLua
)
var levelNames = map[LogLevel]string{
LevelError: "ERROR",
LevelWarning: "WARNING",
LevelInfo: "INFO",
LevelDebug: "DEBUG",
LevelTrace: "TRACE",
LevelLua: "LUA",
}
var levelColors = map[LogLevel]string{
LevelError: "\033[1;31m", // Bold Red
LevelWarning: "\033[1;33m", // Bold Yellow
LevelInfo: "\033[1;32m", // Bold Green
LevelDebug: "\033[1;36m", // Bold Cyan
LevelTrace: "\033[1;35m", // Bold Magenta
LevelLua: "\033[1;34m", // Bold Blue
}
// ResetColor is the ANSI code to reset text color
const ResetColor = "\033[0m"
// Logger is our custom logger with level support
type Logger struct {
mu sync.Mutex
out io.Writer
currentLevel LogLevel
prefix string
flag int
useColors bool
callerOffset int
defaultFields map[string]interface{}
showGoroutine bool
}
var (
// DefaultLogger is the global logger instance
DefaultLogger *Logger
// defaultLogLevel is the default log level if not specified
defaultLogLevel = LevelInfo
// Global mutex for DefaultLogger initialization
initMutex sync.Mutex
)
// ParseLevel converts a string log level to LogLevel
func ParseLevel(levelStr string) LogLevel {
switch strings.ToUpper(levelStr) {
case "ERROR":
return LevelError
case "WARNING", "WARN":
return LevelWarning
case "INFO":
return LevelInfo
case "DEBUG":
return LevelDebug
case "TRACE":
return LevelTrace
case "LUA":
return LevelLua
default:
return defaultLogLevel
}
}
// String returns the string representation of the log level
func (l LogLevel) String() string {
if name, ok := levelNames[l]; ok {
return name
}
return fmt.Sprintf("Level(%d)", l)
}
// New creates a new Logger instance
func New(out io.Writer, prefix string, flag int) *Logger {
return &Logger{
out: out,
currentLevel: defaultLogLevel,
prefix: prefix,
flag: flag,
useColors: true,
callerOffset: 0,
defaultFields: make(map[string]interface{}),
showGoroutine: true,
}
}
// Init initializes the DefaultLogger
func Init(level LogLevel) {
initMutex.Lock()
defer initMutex.Unlock()
if DefaultLogger == nil {
DefaultLogger = New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
}
DefaultLogger.SetLevel(level)
}
// SetLevel sets the current log level
func (l *Logger) SetLevel(level LogLevel) {
l.mu.Lock()
defer l.mu.Unlock()
l.currentLevel = level
}
// GetLevel returns the current log level
func (l *Logger) GetLevel() LogLevel {
l.mu.Lock()
defer l.mu.Unlock()
return l.currentLevel
}
// SetCallerOffset sets the caller offset for correct file and line reporting
func (l *Logger) SetCallerOffset(offset int) {
l.mu.Lock()
defer l.mu.Unlock()
l.callerOffset = offset
}
// SetShowGoroutine sets whether to include goroutine ID in log messages
func (l *Logger) SetShowGoroutine(show bool) {
l.mu.Lock()
defer l.mu.Unlock()
l.showGoroutine = show
}
// ShowGoroutine returns whether goroutine ID is included in log messages
func (l *Logger) ShowGoroutine() bool {
l.mu.Lock()
defer l.mu.Unlock()
return l.showGoroutine
}
// WithField adds a field to the logger's context
func (l *Logger) WithField(key string, value interface{}) *Logger {
newLogger := &Logger{
out: l.out,
currentLevel: l.currentLevel,
prefix: l.prefix,
flag: l.flag,
useColors: l.useColors,
callerOffset: l.callerOffset,
defaultFields: make(map[string]interface{}),
showGoroutine: l.showGoroutine,
}
// Copy existing fields
for k, v := range l.defaultFields {
newLogger.defaultFields[k] = v
}
// Add new field
newLogger.defaultFields[key] = value
return newLogger
}
// WithFields adds multiple fields to the logger's context
func (l *Logger) WithFields(fields map[string]interface{}) *Logger {
newLogger := &Logger{
out: l.out,
currentLevel: l.currentLevel,
prefix: l.prefix,
flag: l.flag,
useColors: l.useColors,
callerOffset: l.callerOffset,
defaultFields: make(map[string]interface{}),
showGoroutine: l.showGoroutine,
}
// Copy existing fields
for k, v := range l.defaultFields {
newLogger.defaultFields[k] = v
}
// Add new fields
for k, v := range fields {
newLogger.defaultFields[k] = v
}
return newLogger
}
// GetGoroutineID extracts the goroutine ID from the runtime stack
func GetGoroutineID() string {
buf := make([]byte, 64)
n := runtime.Stack(buf, false)
// Format of first line is "goroutine N [state]:"
// We only need the N part
buf = buf[:n]
idField := bytes.Fields(bytes.Split(buf, []byte{':'})[0])[1]
return string(idField)
}
// formatMessage formats a log message with level, time, file, and line information
func (l *Logger) formatMessage(level LogLevel, format string, args ...interface{}) string {
var msg string
if len(args) > 0 {
msg = fmt.Sprintf(format, args...)
} else {
msg = format
}
// Format default fields if any
var fields string
if len(l.defaultFields) > 0 {
var pairs []string
for k, v := range l.defaultFields {
pairs = append(pairs, fmt.Sprintf("%s=%v", k, v))
}
fields = " " + strings.Join(pairs, " ")
}
var levelColor, resetColor string
if l.useColors {
levelColor = levelColors[level]
resetColor = ResetColor
}
var caller string
if l.flag&log.Lshortfile != 0 || l.flag&log.Llongfile != 0 {
// Find the actual caller by scanning up the stack
// until we find a function outside the logger package
var file string
var line int
var ok bool
// Start at a reasonable depth and scan up to 10 frames
for depth := 4; depth < 15; depth++ {
_, file, line, ok = runtime.Caller(depth)
if !ok {
break
}
// If the caller is not in the logger package, we found our caller
if !strings.Contains(file, "logger/logger.go") {
break
}
}
if !ok {
file = "???"
line = 0
}
if l.flag&log.Lshortfile != 0 {
file = filepath.Base(file)
}
caller = fmt.Sprintf("%-25s ", file+":"+strconv.Itoa(line))
}
// Format the timestamp with fixed width
var timeStr string
if l.flag&(log.Ldate|log.Ltime|log.Lmicroseconds) != 0 {
t := time.Now()
if l.flag&log.Ldate != 0 {
timeStr += fmt.Sprintf("%04d/%02d/%02d ", t.Year(), t.Month(), t.Day())
}
if l.flag&(log.Ltime|log.Lmicroseconds) != 0 {
timeStr += fmt.Sprintf("%02d:%02d:%02d", t.Hour(), t.Minute(), t.Second())
if l.flag&log.Lmicroseconds != 0 {
timeStr += fmt.Sprintf(".%06d", t.Nanosecond()/1000)
}
}
timeStr = fmt.Sprintf("%-15s ", timeStr)
}
// Add goroutine ID if enabled, with fixed width
var goroutineStr string
if l.showGoroutine {
goroutineID := GetGoroutineID()
goroutineStr = fmt.Sprintf("[g:%-4s] ", goroutineID)
}
// Create a colored level indicator with both brackets colored
levelStr := fmt.Sprintf("%s[%s]%s", levelColor, levelNames[level], levelColor)
// Add a space after the level and before the reset color
levelColumn := fmt.Sprintf("%s %s", levelStr, resetColor)
return fmt.Sprintf("%s%s%s%s%s%s%s\n",
l.prefix, timeStr, caller, goroutineStr, levelColumn, msg, fields)
}
// log logs a message at the specified level
func (l *Logger) log(level LogLevel, format string, args ...interface{}) {
// Always show LUA level logs regardless of the current log level
if level != LevelLua && level > l.currentLevel {
return
}
l.mu.Lock()
defer l.mu.Unlock()
msg := l.formatMessage(level, format, args...)
fmt.Fprint(l.out, msg)
}
// Error logs an error message
func (l *Logger) Error(format string, args ...interface{}) {
l.log(LevelError, format, args...)
}
// Warning logs a warning message
func (l *Logger) Warning(format string, args ...interface{}) {
l.log(LevelWarning, format, args...)
}
// Info logs an informational message
func (l *Logger) Info(format string, args ...interface{}) {
l.log(LevelInfo, format, args...)
}
// Debug logs a debug message
func (l *Logger) Debug(format string, args ...interface{}) {
l.log(LevelDebug, format, args...)
}
// Trace logs a trace message
func (l *Logger) Trace(format string, args ...interface{}) {
l.log(LevelTrace, format, args...)
}
// Lua logs a Lua message
func (l *Logger) Lua(format string, args ...interface{}) {
l.log(LevelLua, format, args...)
}
// Global log functions that use DefaultLogger
// Error logs an error message using the default logger
func Error(format string, args ...interface{}) {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
DefaultLogger.Error(format, args...)
}
// Warning logs a warning message using the default logger
func Warning(format string, args ...interface{}) {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
DefaultLogger.Warning(format, args...)
}
// Info logs an informational message using the default logger
func Info(format string, args ...interface{}) {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
DefaultLogger.Info(format, args...)
}
// Debug logs a debug message using the default logger
func Debug(format string, args ...interface{}) {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
DefaultLogger.Debug(format, args...)
}
// Trace logs a trace message using the default logger
func Trace(format string, args ...interface{}) {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
DefaultLogger.Trace(format, args...)
}
// Lua logs a Lua message using the default logger
func Lua(format string, args ...interface{}) {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
DefaultLogger.Lua(format, args...)
}
// LogPanic logs a panic error and its stack trace
func LogPanic(r interface{}) {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
stack := make([]byte, 4096)
n := runtime.Stack(stack, false)
DefaultLogger.Error("PANIC: %v\n%s", r, stack[:n])
}
// SetLevel sets the log level for the default logger
func SetLevel(level LogLevel) {
if DefaultLogger == nil {
Init(level)
return
}
DefaultLogger.SetLevel(level)
}
// GetLevel gets the log level for the default logger
func GetLevel() LogLevel {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
return DefaultLogger.GetLevel()
}
// WithField returns a new logger with the field added to the default logger's context
func WithField(key string, value interface{}) *Logger {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
return DefaultLogger.WithField(key, value)
}
// WithFields returns a new logger with the fields added to the default logger's context
func WithFields(fields map[string]interface{}) *Logger {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
return DefaultLogger.WithFields(fields)
}
// SetShowGoroutine enables or disables goroutine ID display in the default logger
func SetShowGoroutine(show bool) {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
DefaultLogger.SetShowGoroutine(show)
}
// ShowGoroutine returns whether goroutine ID is included in default logger's messages
func ShowGoroutine() bool {
if DefaultLogger == nil {
Init(defaultLogLevel)
}
return DefaultLogger.ShowGoroutine()
}

49
logger/panic_handler.go Normal file
View File

@@ -0,0 +1,49 @@
package logger
import (
"fmt"
"runtime/debug"
)
// PanicHandler handles a panic and logs it
func PanicHandler() {
if r := recover(); r != nil {
goroutineID := GetGoroutineID()
stackTrace := debug.Stack()
Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
}
}
// SafeGo launches a goroutine with panic recovery
// Usage: logger.SafeGo(func() { ... your code ... })
func SafeGo(f func()) {
go func() {
defer PanicHandler()
f()
}()
}
// SafeGoWithArgs launches a goroutine with panic recovery and passes arguments
// Usage: logger.SafeGoWithArgs(func(arg1, arg2 interface{}) { ... }, "value1", 42)
func SafeGoWithArgs(f func(...interface{}), args ...interface{}) {
go func() {
defer PanicHandler()
f(args...)
}()
}
// SafeExec executes a function with panic recovery
// Useful for code that should not panic
func SafeExec(f func()) (err error) {
defer func() {
if r := recover(); r != nil {
goroutineID := GetGoroutineID()
stackTrace := debug.Stack()
Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
err = fmt.Errorf("panic recovered: %v", r)
}
}()
f()
return nil
}

371
main.go
View File

@@ -3,13 +3,17 @@ package main
import (
"flag"
"fmt"
"log"
"os"
"sort"
"sync"
"github.com/bmatcuk/doublestar/v4"
"time"
"modify/processor"
"modify/utils"
"github.com/go-git/go-git/v5"
"modify/logger"
)
type GlobalStats struct {
@@ -17,162 +21,307 @@ type GlobalStats struct {
TotalModifications int
ProcessedFiles int
FailedFiles int
ModificationsPerCommand sync.Map
}
var stats GlobalStats
var logger *log.Logger
var (
jsonFlag = flag.Bool("json", false, "Process JSON files")
xmlFlag = flag.Bool("xml", false, "Process XML files")
repo *git.Repository
worktree *git.Worktree
stats GlobalStats = GlobalStats{
ModificationsPerCommand: sync.Map{},
}
)
func init() {
log.SetFlags(log.Lmicroseconds | log.Lshortfile)
logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
stats = GlobalStats{}
}
func main() {
// TODO: Implement some sort of git integration
// Maybe use go-git
// Specify a -git flag
// If we are operating with git then:
// Inmitialize a repo if one doesn't exist (try to open right?)
// For each file matched by glob first figure out if it's already tracked
// If not tracked then track it and commit (either it alone or maybe multiple together somehow)
// Then reset the file (to undo previous modifications)
// THEN change the file
// In addition add a -undo flag that will ONLY reset the files without changing them
// Only for the ones matched by glob
// ^ important because binary files would fuck us up
flag.Usage = func() {
fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nOptions:\n")
fmt.Fprintf(os.Stderr, " -json\n")
fmt.Fprintf(os.Stderr, " Process JSON files\n")
fmt.Fprintf(os.Stderr, " -xml\n")
fmt.Fprintf(os.Stderr, " Process XML files\n")
fmt.Fprintf(os.Stderr, " -mode string\n")
fmt.Fprintf(os.Stderr, " Processing mode: regex, xml, json (default \"regex\")\n")
fmt.Fprintf(os.Stderr, " -git\n")
fmt.Fprintf(os.Stderr, " Use git to manage files\n")
fmt.Fprintf(os.Stderr, " -reset\n")
fmt.Fprintf(os.Stderr, " Reset files to their original state\n")
fmt.Fprintf(os.Stderr, " -loglevel string\n")
fmt.Fprintf(os.Stderr, " Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
fmt.Fprintf(os.Stderr, "\nExamples:\n")
fmt.Fprintf(os.Stderr, " Regex mode (default):\n")
fmt.Fprintf(os.Stderr, " %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " XML mode:\n")
fmt.Fprintf(os.Stderr, " %s -xml \"//value\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " JSON mode:\n")
fmt.Fprintf(os.Stderr, " %s -json \"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
fmt.Fprintf(os.Stderr, " s1, s2, etc. are used to refer to capture groups as strings.\n")
fmt.Fprintf(os.Stderr, " Helper functions: num(str) converts string to number, str(num) converts number to string\n")
fmt.Fprintf(os.Stderr, " is_number(str) checks if a string is numeric\n")
fmt.Fprintf(os.Stderr, " For XML and JSON, the captured values are exposed as 'v', which can be of any type we capture (string, number, table).\n")
fmt.Fprintf(os.Stderr, " If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n")
fmt.Fprintf(os.Stderr, " You can use any valid Lua code, including if statements, loops, etc.\n")
fmt.Fprintf(os.Stderr, " Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
}
// TODO: Fix bed shitting when doing *.yml in barotrauma directory
flag.Parse()
args := flag.Args()
if len(args) < 3 {
log.Printf("At least %d arguments are required", 3)
level := logger.ParseLevel(*utils.LogLevel)
logger.Init(level)
logger.Info("Initializing with log level: %s", level.String())
// The plan is:
// Load all commands
commands, err := utils.LoadCommands(args)
if err != nil {
logger.Error("Failed to load commands: %v", err)
flag.Usage()
return
}
// Get the appropriate pattern and expression based on mode
var pattern, luaExpr string
var filePatterns []string
pattern = args[0]
luaExpr = args[1]
filePatterns = args[2:]
// Prepare the Lua expression
originalLuaExpr := luaExpr
luaExpr = processor.BuildLuaScript(luaExpr)
if originalLuaExpr != luaExpr {
logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
if *utils.Filter != "" {
logger.Info("Filtering commands by name: %s", *utils.Filter)
commands = utils.FilterCommands(commands, *utils.Filter)
logger.Info("Filtered %d commands", len(commands))
}
// Expand file patterns with glob support
files, err := expandFilePatterns(filePatterns)
// Then aggregate all the globs and deduplicate them
globs := utils.AggregateGlobs(commands)
logger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
for _, command := range commands {
logger.Trace("Command: %s", command.Name)
logger.Trace("Regex: %s", command.Regex)
logger.Trace("Files: %v", command.Files)
logger.Trace("Lua: %s", command.Lua)
logger.Trace("Git: %t", command.Git)
logger.Trace("Reset: %t", command.Reset)
logger.Trace("Isolate: %t", command.Isolate)
logger.Trace("LogLevel: %s", command.LogLevel)
}
// Resolve all the files for all the globs
logger.Info("Found %d unique file patterns", len(globs))
files, err := utils.ExpandGLobs(globs)
if err != nil {
fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
logger.Error("Failed to expand file patterns: %v", err)
return
}
logger.Info("Found %d files to process", len(files))
// Somehow connect files to commands via globs..
// For each file check every glob of every command
// Maybe memoize this part
// That way we know what commands affect what files
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
logger.Error("Failed to associate files with commands: %v", err)
return
}
if len(files) == 0 {
fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
return
}
// Then for each file run all commands associated with the file
workers := make(chan struct{}, *utils.ParallelFiles)
wg := sync.WaitGroup{}
// Create the processor based on mode
var proc processor.Processor
switch {
case *xmlFlag:
proc = &processor.XMLProcessor{}
logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
pattern, luaExpr, len(files))
case *jsonFlag:
proc = &processor.JSONProcessor{}
logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
pattern, luaExpr, len(files))
default:
proc = &processor.RegexProcessor{}
logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
pattern, luaExpr, len(files))
}
// Add performance tracking
startTime := time.Now()
var fileMutex sync.Mutex
var wg sync.WaitGroup
// Process each file
for _, file := range files {
wg.Add(1)
go func(file string) {
defer wg.Done()
logger.Printf("Processing file: %s", file)
// It's a bit fucked, maybe I could do better to call it from proc... But it'll do for now
modCount, matchCount, err := processor.Process(proc, file, pattern, luaExpr)
if err != nil {
fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
stats.FailedFiles++
// Create a map to store loggers for each command
commandLoggers := make(map[string]*logger.Logger)
for _, command := range commands {
// Create a named logger for each command
cmdName := command.Name
if cmdName == "" {
// If no name is provided, use a short version of the regex pattern
if len(command.Regex) > 20 {
cmdName = command.Regex[:17] + "..."
} else {
logger.Printf("Successfully processed file: %s", file)
stats.ProcessedFiles++
stats.TotalMatches += matchCount
stats.TotalModifications += modCount
cmdName = command.Regex
}
}(file)
}
// Parse the log level for this specific command
cmdLogLevel := logger.ParseLevel(command.LogLevel)
// Create a logger with the command name as a field
commandLoggers[command.Name] = logger.WithField("command", cmdName)
commandLoggers[command.Name].SetLevel(cmdLogLevel)
logger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
}
// This aggregation is great but what if one modification replaces the whole entire file?
// Shit......
// TODO: Add "Isolate" field to modifications which makes them run alone
for file, association := range associations {
workers <- struct{}{}
wg.Add(1)
logger.SafeGoWithArgs(func(args ...interface{}) {
defer func() { <-workers }()
defer wg.Done()
// Track per-file processing time
fileStartTime := time.Now()
fileData, err := os.ReadFile(file)
if err != nil {
logger.Error("Failed to read file %q: %v", file, err)
return
}
fileDataStr := string(fileData)
fileDataStr, err = RunIsolateCommands(association, file, fileDataStr, &fileMutex)
if err != nil {
logger.Error("Failed to run isolate commands for file %q: %v", file, err)
return
}
fileDataStr, err = RunOtherCommands(file, fileDataStr, association, &fileMutex, commandLoggers)
if err != nil {
logger.Error("Failed to run other commands for file %q: %v", file, err)
return
}
err = os.WriteFile(file, []byte(fileDataStr), 0644)
if err != nil {
logger.Error("Failed to write file %q: %v", file, err)
return
}
logger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
}, file, commands)
}
wg.Wait()
processingTime := time.Since(startTime)
logger.Info("Processing completed in %v", processingTime)
if stats.ProcessedFiles > 0 {
logger.Info("Average time per file: %v", processingTime/time.Duration(stats.ProcessedFiles))
}
// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
// Do that with logger.WithField("loglevel", level.String())
// Since each command also has its own log level
// TODO: Maybe even figure out how to run individual commands...?
// TODO: What to do with git? Figure it out ....
// if *gitFlag {
// logger.Info("Git integration enabled, setting up git repository")
// err := setupGit()
// if err != nil {
// logger.Error("Failed to setup git: %v", err)
// fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
// return
// }
// }
// logger.Debug("Expanding file patterns")
// files, err := expandFilePatterns(filePatterns)
// if err != nil {
// logger.Error("Failed to expand file patterns: %v", err)
// fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
// return
// }
// if *gitFlag {
// logger.Info("Cleaning up git files before processing")
// err := cleanupGitFiles(files)
// if err != nil {
// logger.Error("Failed to cleanup git files: %v", err)
// fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
// return
// }
// }
// if *resetFlag {
// logger.Info("Files reset to their original state, nothing more to do")
// log.Printf("Files reset to their original state, nothing more to do")
// return
// }
// Print summary
if stats.TotalModifications == 0 {
fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
logger.Warning("No modifications were made in any files")
} else {
fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
logger.Info("Operation complete! Modified %d values in %d/%d files",
stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
sortedCommands := []string{}
stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
sortedCommands = append(sortedCommands, key.(string))
return true
})
sort.Strings(sortedCommands)
for _, command := range sortedCommands {
count, _ := stats.ModificationsPerCommand.Load(command)
if count.(int) > 0 {
logger.Info("\tCommand %q made %d modifications", command, count)
} else {
logger.Warning("\tCommand %q made no modifications", command)
}
}
}
}
func expandFilePatterns(patterns []string) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
for _, pattern := range patterns {
matches, _ := doublestar.Glob(os.DirFS("."), pattern)
for _, m := range matches {
if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
filesMap[m], files = true, append(files, m)
}
}
func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, fileMutex *sync.Mutex, commandLoggers map[string]*logger.Logger) (string, error) {
// Aggregate all the modifications and execute them
modifications := []utils.ReplaceCommand{}
for _, command := range association.Commands {
// Use command-specific logger if available, otherwise fall back to default logger
cmdLogger := logger.DefaultLogger
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
}
if len(files) > 0 {
logger.Printf("Found %d files to process", len(files))
cmdLogger.Info("Processing file %q with command %q", file, command.Regex)
newModifications, err := processor.ProcessRegex(fileDataStr, command, file)
if err != nil {
return fileDataStr, fmt.Errorf("failed to process file %q with command %q: %w", file, command.Regex, err)
}
return files, nil
modifications = append(modifications, newModifications...)
// It is not guranteed that all the commands will be executed...
// TODO: Make this better
// We'd have to pass the map to executemodifications or something...
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
cmdLogger.Debug("Command %q generated %d modifications", command.Name, len(newModifications))
}
if len(modifications) == 0 {
logger.Info("No modifications found for file %q", file)
return fileDataStr, nil
}
// Sort commands in reverse order for safe replacements
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
fileMutex.Lock()
stats.ProcessedFiles++
stats.TotalModifications += count
fileMutex.Unlock()
logger.Info("Executed %d modifications for file %q", count, file)
return fileDataStr, nil
}
func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string, fileMutex *sync.Mutex) (string, error) {
for _, isolateCommand := range association.IsolateCommands {
logger.Info("Processing file %q with isolate command %q", file, isolateCommand.Regex)
modifications, err := processor.ProcessRegex(fileDataStr, isolateCommand, file)
if err != nil {
return fileDataStr, fmt.Errorf("failed to process file %q with isolate command %q: %w", file, isolateCommand.Regex, err)
}
if len(modifications) == 0 {
logger.Warning("No modifications found for file %q", file)
return fileDataStr, nil
}
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
fileMutex.Lock()
stats.ProcessedFiles++
stats.TotalModifications += count
fileMutex.Unlock()
logger.Info("Executed %d isolate modifications for file %q", count, file)
}
return fileDataStr, nil
}

View File

@@ -1,182 +0,0 @@
package processor
import (
"encoding/json"
"fmt"
"log"
"modify/processor/jsonpath"
lua "github.com/yuin/gopher-lua"
)
// JSONProcessor implements the Processor interface for JSON documents
type JSONProcessor struct{}
// ProcessContent implements the Processor interface for JSONProcessor
func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse JSON document
var jsonData interface{}
err := json.Unmarshal([]byte(content), &jsonData)
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
}
// Find nodes matching the JSONPath pattern
nodes, err := jsonpath.Get(jsonData, pattern)
if err != nil {
return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
modCount := 0
for _, node := range nodes {
log.Printf("Processing node at path: %s with value: %v", node.Path, node.Value)
// Initialize Lua
L, err := NewLuaState()
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
log.Println("Lua state initialized successfully.")
err = p.ToLua(L, node.Value)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
}
log.Printf("Converted node value to Lua: %v", node.Value)
originalScript := luaExpr
fullScript := BuildLuaScript(luaExpr)
log.Printf("Original script: %q, Full script: %q", originalScript, fullScript)
// Execute Lua script
log.Printf("Executing Lua script: %q", fullScript)
if err := L.DoString(fullScript); err != nil {
return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
}
log.Println("Lua script executed successfully.")
// Get modified value
result, err := p.FromLua(L)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
}
log.Printf("Retrieved modified value from Lua: %v", result)
modified := false
modified = L.GetGlobal("modified").String() == "true"
if !modified {
log.Printf("No changes made to node at path: %s", node.Path)
continue
}
// Apply the modification to the JSON data
err = p.updateJSONValue(jsonData, node.Path, result)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
}
log.Printf("Updated JSON at path: %s with new value: %v", node.Path, result)
modCount++
}
// Convert the modified JSON back to a string with same formatting
var jsonBytes []byte
jsonBytes, err = json.MarshalIndent(jsonData, "", " ")
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
}
return string(jsonBytes), modCount, matchCount, nil
}
// / Selects from the root node
// // Selects nodes in the document from the current node that match the selection no matter where they are
// . Selects the current node
// @ Selects attributes
// /bookstore/* Selects all the child element nodes of the bookstore element
// //* Selects all elements in the document
// /bookstore/book[1] Selects the first book element that is the child of the bookstore element.
// /bookstore/book[last()] Selects the last book element that is the child of the bookstore element
// /bookstore/book[last()-1] Selects the last but one book element that is the child of the bookstore element
// /bookstore/book[position()<3] Selects the first two book elements that are children of the bookstore element
// //title[@lang] Selects all the title elements that have an attribute named lang
// //title[@lang='en'] Selects all the title elements that have a "lang" attribute with a value of "en"
// /bookstore/book[price>35.00] Selects all the book elements of the bookstore element that have a price element with a value greater than 35.00
// /bookstore/book[price>35.00]/title Selects all the title elements of the book elements of the bookstore element that have a price element with a value greater than 35.00
// updateJSONValue updates a value in the JSON structure based on its JSONPath
func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
// Special handling for root node
if path == "$" {
// For the root node, we'll copy the value to the jsonData reference
// This is a special case since we can't directly replace the interface{} variable
// We need to handle different types of root elements
switch rootValue := newValue.(type) {
case map[string]interface{}:
// For objects, we need to copy over all keys
rootMap, ok := jsonData.(map[string]interface{})
if !ok {
// If the original wasn't a map, completely replace it with the new map
// This is handled by the jsonpath.Set function
return jsonpath.Set(jsonData, path, newValue)
}
// Clear the original map
for k := range rootMap {
delete(rootMap, k)
}
// Copy all keys from the new map
for k, v := range rootValue {
rootMap[k] = v
}
return nil
case []interface{}:
// For arrays, we need to handle similarly
rootArray, ok := jsonData.([]interface{})
if !ok {
// If the original wasn't an array, use jsonpath.Set
return jsonpath.Set(jsonData, path, newValue)
}
// Clear and recreate the array
*&rootArray = rootValue
return nil
default:
// For other types, use jsonpath.Set
return jsonpath.Set(jsonData, path, newValue)
}
}
// For non-root paths, use the regular Set method
err := jsonpath.Set(jsonData, path, newValue)
if err != nil {
return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
}
return nil
}
// ToLua converts JSON values to Lua variables
func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
table, err := ToLua(L, data)
if err != nil {
return err
}
L.SetGlobal("v", table)
return nil
}
// FromLua retrieves values from Lua
func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
luaValue := L.GetGlobal("v")
return FromLua(L, luaValue)
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,490 +0,0 @@
package jsonpath
import (
"fmt"
"strconv"
)
// JSONStep represents a single step in a JSONPath query
type JSONStep struct {
Type StepType
Key string // For Child/RecursiveDescent
Index int // For Index (use -1 for wildcard "*")
}
// JSONNode represents a value in the JSON data with its path
type JSONNode struct {
Value interface{} // The value found at the path
Path string // The exact JSONPath where the value was found
}
// StepType defines the types of steps in a JSONPath
type StepType int
const (
RootStep StepType = iota // $ - The root element
ChildStep // .key - Direct child access
RecursiveDescentStep // ..key - Recursive search for key
WildcardStep // .* - All children of an object
IndexStep // [n] - Array index access (or [*] for all elements)
)
// TraversalMode determines how the traversal behaves
type TraversalMode int
const (
CollectMode TraversalMode = iota // Just collect matched nodes
ModifyFirstMode // Modify first matching node
ModifyAllMode // Modify all matching nodes
)
// ParseJSONPath parses a JSONPath string into a sequence of steps
func ParseJSONPath(path string) ([]JSONStep, error) {
if len(path) == 0 || path[0] != '$' {
return nil, fmt.Errorf("path must start with $; received: %q", path)
}
steps := []JSONStep{}
i := 0
for i < len(path) {
switch path[i] {
case '$':
steps = append(steps, JSONStep{Type: RootStep})
i++
case '.':
i++
if i < len(path) && path[i] == '.' {
// Recursive descent
i++
key, nextPos := readKey(path, i)
steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
i = nextPos
} else {
// Child step or wildcard
key, nextPos := readKey(path, i)
if key == "*" {
steps = append(steps, JSONStep{Type: WildcardStep})
} else {
steps = append(steps, JSONStep{Type: ChildStep, Key: key})
}
i = nextPos
}
case '[':
// Index step
i++
indexStr, nextPos := readIndex(path, i)
if indexStr == "*" {
steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
} else {
index, err := strconv.Atoi(indexStr)
if err != nil {
return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
}
steps = append(steps, JSONStep{Type: IndexStep, Index: index})
}
i = nextPos + 1 // Skip closing ]
default:
return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
}
}
return steps, nil
}
// readKey extracts a key name from the path
func readKey(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == '.' || path[i] == '[' {
break
}
}
return path[start:i], i
}
// readIndex extracts an array index or wildcard from the path
func readIndex(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == ']' {
break
}
}
return path[start:i], i
}
// Get retrieves values with their paths from data at the specified JSONPath
// Each returned JSONNode contains both the value and its exact path in the data structure
func Get(data interface{}, path string) ([]JSONNode, error) {
steps, err := ParseJSONPath(path)
if err != nil {
return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
results := []JSONNode{}
err = traverseWithPaths(data, steps, &results, "$")
if err != nil {
return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
}
return results, nil
}
// Set updates the value at the specified JSONPath in the original data structure.
// It only modifies the first matching node.
func Set(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// SetAll updates all matching values at the specified JSONPath.
func SetAll(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// setWithPath modifies values while tracking paths
func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
if node == nil || *success && mode == ModifyFirstMode {
return nil
}
// Skip root step
actualSteps := steps
if len(steps) > 0 && steps[0].Type == RootStep {
actualSteps = steps[1:]
}
// If we have no steps left, we're setting the root value
if len(actualSteps) == 0 {
// For the root node, we need to handle it differently depending on what's passed in
// since we can't directly replace the interface{} variable
// We'll signal success and let the JSONProcessor handle updating the root
*success = true
return nil
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
childPath := currentPath + "." + step.Key
if isLastStep {
// We've reached the target, set the value
m[step.Key] = value
*success = true
return nil
}
// Create intermediate nodes if necessary
child, exists := m[step.Key]
if !exists {
// Create missing intermediate node
if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
child = []interface{}{}
} else {
child = map[string]interface{}{}
}
m[step.Key] = child
}
err := setWithPath(child, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
arr[i] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
arr[step.Index] = value
*success = true
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
}
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
m[step.Key] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(val, remainingSteps, success, value, directPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
// Skip keys we've already processed directly
if step.Key != "*" && k == step.Key {
continue
}
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
m[k] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(v, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
return nil
}
// traverseWithPaths tracks both nodes and their paths during traversal
func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
if len(steps) == 0 || node == nil {
return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
}
// Skip root step
actualSteps := steps
if steps[0].Type == RootStep {
if len(steps) == 1 {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
return nil
}
actualSteps = steps[1:]
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
child, exists := m[step.Key]
if !exists {
return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
}
childPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: child, Path: childPath})
} else {
err := traverseWithPaths(child, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node is not an array; actual type: %T", node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
} else {
return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: val, Path: directPath})
} else {
err := traverseWithPaths(val, remainingSteps, results, directPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
}
}
}
}
// For wildcard, collect this node
if step.Key == "*" && isLastStep {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
*results = append(*results, JSONNode{Value: v, Path: childPath})
} else {
err := traverseWithPaths(v, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
}
return nil
}

View File

@@ -1,577 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
func TestGetWithPathsBasic(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
error bool
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
{
name: "nonexistent path",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
},
path: "$.user.email",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
if !tt.error {
t.Errorf("GetWithPaths() returned error: %v", err)
}
return
}
// For nonexistent path, we expect empty slice
if tt.name == "nonexistent path" {
if len(result) > 0 {
t.Errorf("GetWithPaths() returned %v, expected empty result", result)
}
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For wildcard results, we need to check containment rather than exact order
if tt.name == "wildcard" || tt.name == "recursive descent" {
// For each expected item, check if it exists in the results by both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
found = true
break
}
}
if !found {
t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
}
}
} else {
// Otherwise check exact equality of both values and paths
for i, expected := range tt.expected {
if !reflect.DeepEqual(result[i].Value, expected.Value) {
t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
}
if result[i].Path != expected.Path {
t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := Set(data, "$.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("nested property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
}
err := Set(data, "$.user.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
user, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user["name"] != "Jane" {
t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
}
})
t.Run("array element", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
}
err := Set(data, "$.users[0].name", "Bob")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user0["name"] != "Bob" {
t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
}
})
t.Run("complex value", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
}
newProfile := map[string]interface{}{
"email": "john.doe@example.com",
"phone": "123-456-7890",
}
err := Set(data, "$.user.profile", newProfile)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
profile, ok := userMap["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Profile is not a map")
}
if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
t.Errorf("Set() failed: expected profile to be updated with new values")
}
})
t.Run("create new property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if email, exists := userMap["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
}
})
t.Run("create nested properties", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.contact.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
contact, ok := userMap["contact"].(map[string]interface{})
if !ok {
t.Fatalf("Contact is not a map")
}
if email, exists := contact["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
}
})
t.Run("create array and element", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
// This should create an empty addresses array, but won't be able to set index 0
// since the array is empty
err := Set(data, "$.user.addresses[0].street", "123 Main St")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
})
t.Run("multiple targets (should only update first)", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := Set(data, "$.users[*].active", false)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User0 is not a map")
}
user1, ok := users[1].(map[string]interface{})
if !ok {
t.Fatalf("User1 is not a map")
}
// Only the first one should be changed
if active, exists := user0["active"]; !exists || active != false {
t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
}
// The second one should remain unchanged
if active, exists := user1["active"]; !exists || active != true {
t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
}
})
t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
}
err := Set(data, "$", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Data should be unchanged
if data["name"] != "John" {
t.Errorf("Data was modified when setting on root")
}
})
}
func TestSetAll(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := SetAll(data, "$.name", "Jane")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("all array elements", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := SetAll(data, "$.users[*].active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
// Both elements should be updated
for i, user := range users {
userMap, ok := user.(map[string]interface{})
if !ok {
t.Fatalf("User%d is not a map", i)
}
if active, exists := userMap["active"]; !exists || active != false {
t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
}
}
})
t.Run("recursive descent", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
"admin": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
}
err := SetAll(data, "$..active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Check user profile
userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access user.profile")
}
if active, exists := userProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
}
// Check admin profile
adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access admin.profile")
}
if active, exists := adminProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
}
})
}
func TestGetWithPathsExtended(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
t.Errorf("GetWithPaths() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// Check if value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Check if path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -1,318 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
var testData = map[string]interface{}{
"store": map[string]interface{}{
"book": []interface{}{
map[string]interface{}{
"title": "The Fellowship of the Ring",
"price": 22.99,
},
map[string]interface{}{
"title": "The Two Towers",
"price": 23.45,
},
},
"bicycle": map[string]interface{}{
"color": "red",
"price": 199.95,
},
},
}
func TestParser(t *testing.T) {
tests := []struct {
path string
steps []JSONStep
wantErr bool
}{
{
path: "$.store.bicycle.color",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "bicycle"},
{Type: ChildStep, Key: "color"},
},
},
{
path: "$..price",
steps: []JSONStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Key: "price"},
},
},
{
path: "$.store.book[*].title",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: -1}, // Wildcard
{Type: ChildStep, Key: "title"},
},
},
{
path: "$.store.book[0]",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: 0},
},
},
{
path: "invalid.path",
wantErr: true,
},
{
path: "$.store.book[abc]",
wantErr: true,
},
}
for _, tt := range tests {
t.Run(tt.path, func(t *testing.T) {
steps, err := ParseJSONPath(tt.path)
if (err != nil) != tt.wantErr {
t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
}
if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
}
})
}
}
func TestEvaluator(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
error bool
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
{
name: "wildcard_recursive",
path: "$..*",
expected: []JSONNode{
// These will be compared by value only, paths will be validated separately
{Value: testData["store"].(map[string]interface{})["book"]},
{Value: testData["store"].(map[string]interface{})["bicycle"]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
{Value: "The Fellowship of the Ring"},
{Value: 22.99},
{Value: "The Two Towers"},
{Value: 23.45},
{Value: "red"},
{Value: 199.95},
},
},
{
name: "invalid_index",
path: "$.store.book[5]",
expected: []JSONNode{},
error: true,
},
{
name: "nonexistent_property",
path: "$.store.nonexistent",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Use GetWithPaths directly
result, err := Get(testData, tt.path)
if err != nil {
if !tt.error {
t.Errorf("Get() returned error: %v", err)
}
return
}
// Special handling for wildcard recursive test
if tt.name == "wildcard_recursive" {
// Skip length check for wildcard recursive since it might vary
// Just verify that each expected item is in the results
// Validate values match and paths are filled in
for _, e := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, e.Value) {
found = true
break
}
}
if !found {
t.Errorf("Expected value %v not found in results", e.Value)
}
}
return
}
if len(result) != len(tt.expected) {
t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
}
// Validate both values and paths
for i, e := range tt.expected {
if i < len(result) {
if !reflect.DeepEqual(result[i].Value, e.Value) {
t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
}
if result[i].Path != e.Path {
t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
}
}
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("empty_data", func(t *testing.T) {
result, err := Get(nil, "$.a.b")
if err == nil {
t.Errorf("Expected error for empty data")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("empty_path", func(t *testing.T) {
_, err := ParseJSONPath("")
if err == nil {
t.Error("Expected error for empty path")
}
})
t.Run("numeric_keys", func(t *testing.T) {
data := map[string]interface{}{
"42": "answer",
}
result, err := Get(data, "$.42")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) == 0 || result[0].Value != "answer" {
t.Errorf("Expected 'answer', got %v", result)
}
})
}
func TestGetWithPaths(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(testData, tt.path)
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// First verify the value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Then verify the path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -2,125 +2,106 @@ package processor
import (
"fmt"
"os"
"path/filepath"
"strings"
lua "github.com/yuin/gopher-lua"
"modify/logger"
)
// Processor defines the interface for all file processors
type Processor interface {
// Process handles processing a file with the given pattern and Lua expression
// Now implemented as a base function in processor.go
// Process(filename string, pattern string, luaExpr string) (int, int, error)
// ProcessContent handles processing a string content directly with the given pattern and Lua expression
// Returns the modified content, modification count, match count, and any error
ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
// ToLua converts processor-specific data to Lua variables
ToLua(L *lua.LState, data interface{}) error
// FromLua retrieves modified data from Lua
FromLua(L *lua.LState) (interface{}, error)
}
// ModificationRecord tracks a single value modification
type ModificationRecord struct {
File string
OldValue string
NewValue string
Operation string
Context string
}
// Maybe we make this an interface again for the shits and giggles
// We will see, it could easily be...
func NewLuaState() (*lua.LState, error) {
L := lua.NewState()
// defer L.Close()
// Load math library
logger.Debug("Loading Lua math library")
L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil {
logger.Error("Failed to load Lua math library: %v", err)
return nil, fmt.Errorf("error loading Lua math library: %v", err)
}
// Initialize helper functions
logger.Debug("Initializing Lua helper functions")
if err := InitLuaHelpers(L); err != nil {
logger.Error("Failed to initialize Lua helper functions: %v", err)
return nil, err
}
return L, nil
}
func Process(p Processor, filename string, pattern string, luaExpr string) (int, int, error) {
// Read file content
cwd, err := os.Getwd()
if err != nil {
return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
}
fullPath := filepath.Join(cwd, filename)
content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ToLua converts a struct or map to a Lua table recursively
func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
switch v := data.(type) {
case map[string]interface{}:
luaTable := L.NewTable()
for key, value := range v {
luaValue, err := ToLua(L, value)
if err != nil {
return nil, err
}
luaTable.RawSetString(key, luaValue)
}
return luaTable, nil
case []interface{}:
luaTable := L.NewTable()
for i, value := range v {
luaValue, err := ToLua(L, value)
if err != nil {
return nil, err
}
luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
}
return luaTable, nil
case string:
return lua.LString(v), nil
case bool:
return lua.LBool(v), nil
case float64:
return lua.LNumber(v), nil
case nil:
return lua.LNil, nil
default:
return nil, fmt.Errorf("unsupported data type: %T", data)
}
}
// func Process(filename string, pattern string, luaExpr string) (int, int, error) {
// logger.Debug("Processing file %q with pattern %q", filename, pattern)
//
// // Read file content
// cwd, err := os.Getwd()
// if err != nil {
// logger.Error("Failed to get current working directory: %v", err)
// return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
// }
//
// fullPath := filepath.Join(cwd, filename)
// logger.Trace("Reading file from: %s", fullPath)
//
// stat, err := os.Stat(fullPath)
// if err != nil {
// logger.Error("Failed to stat file %s: %v", fullPath, err)
// return 0, 0, fmt.Errorf("error getting file info: %v", err)
// }
// logger.Debug("File size: %d bytes, modified: %s", stat.Size(), stat.ModTime().Format(time.RFC3339))
//
// content, err := os.ReadFile(fullPath)
// if err != nil {
// logger.Error("Failed to read file %s: %v", fullPath, err)
// return 0, 0, fmt.Errorf("error reading file: %v", err)
// }
//
// fileContent := string(content)
// logger.Trace("File read successfully: %d bytes, hash: %x", len(content), md5sum(content))
//
// // Detect and log file type
// fileType := detectFileType(filename, fileContent)
// if fileType != "" {
// logger.Debug("Detected file type: %s", fileType)
// }
//
// // Process the content
// logger.Debug("Starting content processing")
// modifiedContent, modCount, matchCount, err := ProcessContent(fileContent, pattern, luaExpr)
// if err != nil {
// logger.Error("Processing error: %v", err)
// return 0, 0, err
// }
//
// logger.Debug("Processing results: %d matches, %d modifications", matchCount, modCount)
//
// // If we made modifications, save the file
// if modCount > 0 {
// // Calculate changes summary
// changePercent := float64(len(modifiedContent)) / float64(len(fileContent)) * 100
// logger.Info("File size change: %d → %d bytes (%.1f%%)",
// len(fileContent), len(modifiedContent), changePercent)
//
// logger.Debug("Writing modified content to %s", fullPath)
// err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
// if err != nil {
// logger.Error("Failed to write to file %s: %v", fullPath, err)
// return 0, 0, fmt.Errorf("error writing file: %v", err)
// }
// logger.Debug("File written successfully, new hash: %x", md5sum([]byte(modifiedContent)))
// } else if matchCount > 0 {
// logger.Debug("No content modifications needed for %d matches", matchCount)
// } else {
// logger.Debug("No matches found in file")
// }
//
// return modCount, matchCount, nil
// }
// FromLua converts a Lua table to a struct or map recursively
func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
@@ -162,25 +143,28 @@ func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
}
func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
logger.Trace("Checking if Lua table is an array")
L.SetGlobal("table_to_check", v)
// Use our predefined helper function from InitLuaHelpers
err := L.DoString(`is_array = isArray(table_to_check)`)
if err != nil {
logger.Error("Error determining if table is an array: %v", err)
return false, fmt.Errorf("error determining if table is array: %w", err)
}
// Check the result of our Lua function
isArray := L.GetGlobal("is_array")
// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
if !lua.LVIsFalse(isArray) {
return true, nil
}
return false, nil
result := !lua.LVIsFalse(isArray)
logger.Trace("Lua table is array: %v", result)
return result, nil
}
// InitLuaHelpers initializes common Lua helper functions
func InitLuaHelpers(L *lua.LState) error {
logger.Debug("Loading Lua helper functions")
helperScript := `
-- Custom Lua helpers for math operations
function min(a, b) return math.min(a, b) end
@@ -193,6 +177,39 @@ function floor(x) return math.floor(x) end
function ceil(x) return math.ceil(x) end
function upper(s) return string.upper(s) end
function lower(s) return string.lower(s) end
function format(s, ...) return string.format(s, ...) end
-- String split helper
function strsplit(inputstr, sep)
if sep == nil then
sep = "%s"
end
local t = {}
for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
table.insert(t, str)
end
return t
end
---@param table table
---@param depth number?
function DumpTable(table, depth)
if depth == nil then
depth = 0
end
if (depth > 200) then
print("Error: Depth > 200 in dumpTable()")
return
end
for k, v in pairs(table) do
if (type(v) == "table") then
print(string.rep(" ", depth) .. k .. ":")
DumpTable(v, depth + 1)
else
print(string.rep(" ", depth) .. k .. ": ", v)
end
end
end
-- String to number conversion helper
function num(str)
@@ -226,13 +243,15 @@ end
modified = false
`
if err := L.DoString(helperScript); err != nil {
logger.Error("Failed to load Lua helper functions: %v", err)
return fmt.Errorf("error loading helper functions: %v", err)
}
logger.Debug("Setting up Lua print function to Go")
L.SetGlobal("print", L.NewFunction(printToGo))
return nil
}
// Helper utility functions
// LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string {
s = strings.ReplaceAll(s, "\n", "\\n")
@@ -265,6 +284,8 @@ func PrependLuaAssignment(luaExpr string) string {
// BuildLuaScript prepares a Lua expression from shorthand notation
func BuildLuaScript(luaExpr string) string {
logger.Debug("Building Lua script from expression: %s", luaExpr)
luaExpr = PrependLuaAssignment(luaExpr)
// This allows the user to specify whether or not they modified a value
@@ -284,18 +305,22 @@ func BuildLuaScript(luaExpr string) string {
return fullScript
}
// Max returns the maximum of two integers
func Max(a, b int) int {
if a > b {
return a
}
return b
}
func printToGo(L *lua.LState) int {
top := L.GetTop()
// Min returns the minimum of two integers
func Min(a, b int) int {
if a < b {
return a
args := make([]interface{}, top)
for i := 1; i <= top; i++ {
args[i-1] = L.Get(i)
}
return b
// Format the message with proper spacing between arguments
var parts []string
for _, arg := range args {
parts = append(parts, fmt.Sprintf("%v", arg))
}
message := strings.Join(parts, " ")
// Use the LUA log level with a script tag
logger.Lua("%s", message)
return 0
}

View File

@@ -5,100 +5,89 @@ import (
"regexp"
"strconv"
"strings"
"time"
lua "github.com/yuin/gopher-lua"
"modify/logger"
"modify/utils"
)
// RegexProcessor implements the Processor interface using regex patterns
type RegexProcessor struct{}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
captures, ok := data.([]string)
if !ok {
return fmt.Errorf("expected []string for captures, got %T", data)
}
// Set variables for each capture group, starting from v1/s1 for the first capture
for i := 0; i < len(captures); i++ {
// Set string version (always available as s1, s2, etc.)
L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
// Try to convert to number and set v1, v2, etc.
if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
}
}
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Get the modified values after Lua execution
modifications := make(map[int]string)
// Check for modifications to v1-v12 and s1-s12
for i := 0; i < 12; i++ {
// Check both v and s variables to see if any were modified
vVarName := fmt.Sprintf("v%d", i+1)
sVarName := fmt.Sprintf("s%d", i+1)
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
// If our value is a number then it's very likely we want it to be a number
// And not a string
// If we do want it to be a string we will cast it into a string in lua
// wait that wouldn't work... Casting v to a string would not load it here
if vLuaVal.Type() == lua.LTNumber {
modifications[i] = vLuaVal.String()
continue
}
if sLuaVal.Type() == lua.LTString {
modifications[i] = sLuaVal.String()
continue
}
}
return modifications, nil
type CaptureGroup struct {
Name string
Value string
Updated string
Range [2]int
}
// ProcessContent applies regex replacement with Lua processing
func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
}
// The filename here exists ONLY so we can pass it to the lua environment
// It's not used for anything else
func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
var commands []utils.ReplaceCommand
logger.Trace("Processing regex: %q", command.Regex)
// Start timing the regex processing
startTime := time.Now()
// We don't HAVE to do this multiple times for a pattern
// But it's quick enough for us to not care
pattern := resolveRegexPlaceholders(command.Regex)
logger.Debug("Compiling regex pattern: %s", pattern)
patternCompileStart := time.Now()
compiledPattern, err := regexp.Compile(pattern)
if err != nil {
return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
logger.Error("Error compiling pattern: %v", err)
return commands, fmt.Errorf("error compiling pattern: %v", err)
}
logger.Debug("Compiled pattern successfully in %v: %s", time.Since(patternCompileStart), pattern)
previous := luaExpr
luaExpr = BuildLuaScript(luaExpr)
fmt.Printf("Changing Lua expression from: %s to: %s\n", previous, luaExpr)
L, err := NewLuaState()
if err != nil {
return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
// Initialize Lua environment
modificationCount := 0
// Same here, it's just string concatenation, it won't kill us
// More important is that we don't fuck up the command
// But we shouldn't be able to since it's passed by value
previous := command.Lua
luaExpr := BuildLuaScript(command.Lua)
logger.Debug("Transformed Lua expression: %q → %q", previous, luaExpr)
// Process all regex matches
result := content
matchFindStart := time.Now()
indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
matchFindDuration := time.Since(matchFindStart)
logger.Debug("Found %d matches in content of length %d (search took %v)",
len(indices), len(content), matchFindDuration)
// Log pattern complexity metrics
patternComplexity := estimatePatternComplexity(pattern)
logger.Debug("Pattern complexity estimate: %d", patternComplexity)
if len(indices) == 0 {
logger.Warning("No matches found for regex: %q", pattern)
logger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
// We walk backwards because we're replacing something with something else that might be longer
// And in the case it is longer than the original all indicces past that change will be fucked up
// By going backwards we fuck up all the indices to the end of the file that we don't care about
// Because there either aren't any (last match) or they're already modified (subsequent matches)
for i := len(indices) - 1; i >= 0; i-- {
matchIndices := indices[i]
for i, matchIndices := range indices {
logger.Debug("Processing match %d of %d", i+1, len(indices))
logger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
L, err := NewLuaState()
if err != nil {
logger.Error("Error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
}
L.SetGlobal("file", lua.LString(filename))
// Hmm... Maybe we don't want to defer this..
// Maybe we want to close them every iteration
// We'll leave it as is for now
defer L.Close()
logger.Trace("Lua state created successfully for match %d", i+1)
// Why we're doing this whole song and dance of indices is to properly handle empty matches
// Plus it's a little cleaner to surgically replace our matches
// If we were to use string.replace and encountered an empty match there'd be nothing to replace
@@ -107,60 +96,292 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
// As if concatenating in the middle of the array
// Plus it supports lookarounds
match := content[matchIndices[0]:matchIndices[1]]
matchPreview := match
if len(match) > 50 {
matchPreview = match[:47] + "..."
}
logger.Trace("Matched content: %q (length: %d)", matchPreview, len(match))
groups := matchIndices[2:]
if len(groups) <= 0 {
fmt.Println("No capture groups for lua to chew on")
logger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
continue
}
if len(groups)%2 == 1 {
fmt.Println("Odd number of indices of groups, what the fuck?")
logger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
continue
}
captures := make([]string, 0, len(groups)/2)
// Count how many valid groups we have
validGroups := 0
for j := 0; j < len(groups); j += 2 {
captures = append(captures, content[groups[j]:groups[j+1]])
if groups[j] != -1 && groups[j+1] != -1 {
validGroups++
}
}
logger.Debug("Found %d valid capture groups in match", validGroups)
if err := p.ToLua(L, captures); err != nil {
fmt.Println("Error setting Lua variables:", err)
for _, index := range groups {
if index == -1 {
logger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
continue
}
}
// We have to use array to preserve order
// Very important for the reconstruction step
// Because we must overwrite the values in reverse order
// See comments a few dozen lines above for more details
captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
groupNames := compiledPattern.SubexpNames()[1:]
for i, name := range groupNames {
start := groups[i*2]
end := groups[i*2+1]
if start == -1 || end == -1 {
continue
}
value := content[start:end]
captureGroups = append(captureGroups, &CaptureGroup{
Name: name,
Value: value,
Range: [2]int{start, end},
})
// Include name info in log if available
if name != "" {
logger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
} else {
logger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
}
}
// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
if !command.NoDedup {
logger.Debug("Deduplicating capture groups as specified in command settings")
captureGroups = deduplicateGroups(captureGroups)
}
if err := toLua(L, captureGroups); err != nil {
logger.Error("Failed to set Lua variables: %v", err)
continue
}
logger.Trace("Set %d capture groups as Lua variables", len(captureGroups))
if err := L.DoString(luaExpr); err != nil {
fmt.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
logger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
err, luaExpr, captureGroups)
continue
}
logger.Trace("Lua script executed successfully")
// Get modifications from Lua
modResult, err := p.FromLua(L)
captureGroups, err = fromLua(L, captureGroups)
if err != nil {
fmt.Println("Error getting modifications:", err)
continue
}
// Apply modifications to the matched text
modsMap, ok := modResult.(map[int]string)
if !ok || len(modsMap) == 0 {
fmt.Println("No modifications to apply")
logger.Error("Failed to retrieve modifications from Lua: %v", err)
continue
}
logger.Trace("Retrieved updated values from Lua")
replacement := ""
replacementVar := L.GetGlobal("replacement")
if replacementVar.Type() != lua.LTNil {
replacement = replacementVar.String()
logger.Debug("Using global replacement: %q", replacement)
}
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
logger.Debug("Skipping match - no modifications made by Lua script")
continue
}
if replacement == "" {
// Apply the modifications to the original match
replacement := match
for i := len(modsMap) - 1; i >= 0; i-- {
newVal := modsMap[i]
replacement = match
// Count groups that were actually modified
modifiedGroups := 0
for _, capture := range captureGroups {
if capture.Value != capture.Updated {
modifiedGroups++
}
}
logger.Info("%d of %d capture groups identified for modification", modifiedGroups, len(captureGroups))
for _, capture := range captureGroups {
if capture.Value == capture.Updated {
logger.Info("Capture group unchanged: %s", LimitString(capture.Value, 50))
continue
}
// Log what changed with context
logger.Debug("Capture group %s scheduled for modification: %q → %q",
capture.Name, capture.Value, capture.Updated)
// Indices of the group are relative to content
// To relate them to match we have to subtract the match start index
groupStart := groups[i*2] - matchIndices[0]
groupEnd := groups[i*2+1] - matchIndices[0]
replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
commands = append(commands, utils.ReplaceCommand{
From: capture.Range[0],
To: capture.Range[1],
With: capture.Updated,
})
}
} else {
commands = append(commands, utils.ReplaceCommand{
From: matchIndices[0],
To: matchIndices[1],
With: replacement,
})
}
}
modificationCount++
result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
}
return result, modificationCount, len(indices), nil
logger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
deduplicatedGroups := make([]*CaptureGroup, 0)
for _, group := range captureGroups {
overlaps := false
logger.Debug("Checking capture group: %s with range %v", group.Name, group.Range)
for _, existingGroup := range deduplicatedGroups {
logger.Debug("Comparing with existing group: %s with range %v", existingGroup.Name, existingGroup.Range)
if group.Range[0] < existingGroup.Range[1] && group.Range[1] > existingGroup.Range[0] {
overlaps = true
logger.Warning("Detected overlap between capture group '%s' and existing group '%s' in range %v-%v and %v-%v", group.Name, existingGroup.Name, group.Range[0], group.Range[1], existingGroup.Range[0], existingGroup.Range[1])
break
}
}
if overlaps {
// We CAN just continue despite this fuckup
logger.Warning("Overlapping capture group: %s", group.Name)
continue
}
logger.Debug("No overlap detected for capture group: %s. Adding to deduplicated groups.", group.Name)
deduplicatedGroups = append(deduplicatedGroups, group)
}
return deduplicatedGroups
}
// The order of these replaces is important
// This one handles !num-s inside of named capture groups
// If it were not here our !num in a named capture group would
// Expand to another capture group in the capture group
// We really only want one (our named) capture group
func resolveRegexPlaceholders(pattern string) string {
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
}
namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
parts := namedGroupNum.FindStringSubmatch(match)
if len(parts) != 3 {
return match
}
replacement := `-?\d*\.?\d+`
return parts[1] + replacement
})
pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
// !rep(pattern, count) repeats the pattern n times
// Inserting !any between each repetition
pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
parts := repPattern.FindStringSubmatch(match)
if len(parts) != 3 {
return match
}
repeatedPattern := parts[1]
count := parts[2]
repetitions, _ := strconv.Atoi(count)
return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
})
return pattern
}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func toLua(L *lua.LState, data interface{}) error {
captureGroups, ok := data.([]*CaptureGroup)
if !ok {
return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
}
groupindex := 0
for _, capture := range captureGroups {
if capture.Name == "" {
// We don't want to change the name of the capture group
// Even if it's empty
tempName := fmt.Sprintf("%d", groupindex+1)
groupindex++
L.SetGlobal("s"+tempName, lua.LString(capture.Value))
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal("v"+tempName, lua.LNumber(val))
}
} else {
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal(capture.Name, lua.LNumber(val))
} else {
L.SetGlobal(capture.Name, lua.LString(capture.Value))
}
}
}
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
captureIndex := 0
for _, capture := range captureGroups {
if capture.Name == "" {
capture.Name = fmt.Sprintf("%d", captureIndex+1)
vVarName := fmt.Sprintf("v%s", capture.Name)
sVarName := fmt.Sprintf("s%s", capture.Name)
captureIndex++
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
if sLuaVal.Type() == lua.LTString {
capture.Updated = sLuaVal.String()
}
// Numbers have priority
if vLuaVal.Type() == lua.LTNumber {
capture.Updated = vLuaVal.String()
}
} else {
// Easy shit
capture.Updated = L.GetGlobal(capture.Name).String()
}
}
return captureGroups, nil
}
// estimatePatternComplexity gives a rough estimate of regex pattern complexity
// This can help identify potentially problematic patterns
func estimatePatternComplexity(pattern string) int {
complexity := len(pattern)
// Add complexity for potentially expensive operations
complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
complexity += strings.Count(pattern, "[^") * 3 // Negated character class
complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
complexity += strings.Count(pattern, "(") * 2 // Capture groups
complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
complexity += strings.Count(pattern, "{") * 2 // Counted repetition
return complexity
}

File diff suppressed because it is too large Load Diff

26
processor/test_helper.go Normal file
View File

@@ -0,0 +1,26 @@
package processor
import (
"io"
"modify/logger"
"os"
)
func init() {
// Only modify logger in test mode
// This checks if we're running under 'go test'
if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
// Initialize logger with ERROR level for tests
// to minimize noise in test output
logger.Init(logger.LevelError)
// Optionally redirect logger output to discard
// This prevents logger output from interfering with test output
disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
if disableTestLogs {
// Create a new logger that writes to nowhere
silentLogger := logger.New(io.Discard, "", 0)
logger.DefaultLogger = silentLogger
}
}
}

View File

@@ -1,187 +0,0 @@
package processor
import (
"fmt"
"strings"
"github.com/antchfx/xmlquery"
lua "github.com/yuin/gopher-lua"
)
// XMLProcessor implements the Processor interface for XML documents
type XMLProcessor struct{}
// ProcessContent implements the Processor interface for XMLProcessor
func (p *XMLProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse XML document
doc, err := xmlquery.Parse(strings.NewReader(content))
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
}
// Find nodes matching the XPath pattern
nodes, err := xmlquery.QueryAll(doc, pattern)
if err != nil {
return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
// Initialize Lua
L := lua.NewState()
defer L.Close()
// Load math library
L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil {
return content, 0, 0, fmt.Errorf("error loading Lua math library: %v", err)
}
// Load helper functions
if err := InitLuaHelpers(L); err != nil {
return content, 0, 0, err
}
// Apply modifications to each node
modCount := 0
for _, node := range nodes {
// Reset Lua state for each node
L.SetGlobal("v1", lua.LNil)
L.SetGlobal("s1", lua.LNil)
// Get the node value
var originalValue string
if node.Type == xmlquery.AttributeNode {
originalValue = node.InnerText()
} else if node.Type == xmlquery.TextNode {
originalValue = node.Data
} else {
originalValue = node.InnerText()
}
// Convert to Lua variables
err = p.ToLua(L, originalValue)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
}
// Execute Lua script
if err := L.DoString(luaExpr); err != nil {
return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
}
// Get modified value
result, err := p.FromLua(L)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
}
newValue, ok := result.(string)
if !ok {
return content, modCount, matchCount, fmt.Errorf("expected string result from Lua, got %T", result)
}
// Skip if no change
if newValue == originalValue {
continue
}
// Apply modification
if node.Type == xmlquery.AttributeNode {
// For attribute nodes, update the attribute value
node.Parent.Attr = append([]xmlquery.Attr{}, node.Parent.Attr...)
for i, attr := range node.Parent.Attr {
if attr.Name.Local == node.Data {
node.Parent.Attr[i].Value = newValue
break
}
}
} else if node.Type == xmlquery.TextNode {
// For text nodes, update the text content
node.Data = newValue
} else {
// For element nodes, replace inner text
// Simple approach: set the InnerText directly if there are no child elements
if node.FirstChild == nil || (node.FirstChild != nil && node.FirstChild.Type == xmlquery.TextNode && node.FirstChild.NextSibling == nil) {
if node.FirstChild != nil {
node.FirstChild.Data = newValue
} else {
// Create a new text node and add it as the first child
textNode := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: newValue,
}
node.FirstChild = textNode
}
} else {
// Complex case: node has mixed content or child elements
// Replace just the text content while preserving child elements
// This is a simplified approach - more complex XML may need more robust handling
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type == xmlquery.TextNode {
child.Data = newValue
break // Update only the first text node
}
}
}
}
modCount++
}
// Serialize the modified XML document to string
if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
// If we have an XML declaration, start with it
declaration := doc.FirstChild.OutputXML(true)
// Remove the firstChild (declaration) before serializing the rest of the document
doc.FirstChild = doc.FirstChild.NextSibling
return declaration + doc.OutputXML(true), modCount, matchCount, nil
}
return doc.OutputXML(true), modCount, matchCount, nil
}
// ToLua converts XML node values to Lua variables
func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
value, ok := data.(string)
if !ok {
return fmt.Errorf("expected string value, got %T", data)
}
// Set as string variable
L.SetGlobal("s1", lua.LString(value))
// Try to convert to number if possible
L.SetGlobal("v1", lua.LNumber(0)) // Default to 0
if err := L.DoString(fmt.Sprintf("v1 = tonumber(%q) or 0", value)); err != nil {
return fmt.Errorf("error converting value to number: %v", err)
}
return nil
}
// FromLua gets modified values from Lua
func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Check if string variable was modified
s1 := L.GetGlobal("s1")
if s1 != lua.LNil {
if s1Str, ok := s1.(lua.LString); ok {
return string(s1Str), nil
}
}
// Check if numeric variable was modified
v1 := L.GetGlobal("v1")
if v1 != lua.LNil {
if v1Num, ok := v1.(lua.LNumber); ok {
return fmt.Sprintf("%v", v1Num), nil
}
}
// Default return empty string
return "", nil
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,98 +0,0 @@
package xpath
import "errors"
// XPathStep represents a single step in an XPath expression
type XPathStep struct {
Type StepType
Name string
Predicate *Predicate
}
// StepType defines the type of XPath step
type StepType int
const (
// RootStep represents the root step (/)
RootStep StepType = iota
// ChildStep represents a child element step (element)
ChildStep
// RecursiveDescentStep represents a recursive descent step (//)
RecursiveDescentStep
// WildcardStep represents a wildcard step (*)
WildcardStep
// PredicateStep represents a predicate condition step ([...])
PredicateStep
)
// PredicateType defines the type of XPath predicate
type PredicateType int
const (
// IndexPredicate represents an index predicate [n]
IndexPredicate PredicateType = iota
// LastPredicate represents a last() function predicate
LastPredicate
// LastMinusPredicate represents a last()-n predicate
LastMinusPredicate
// PositionPredicate represents position()-based predicates
PositionPredicate
// AttributeExistsPredicate represents [@attr] predicate
AttributeExistsPredicate
// AttributeEqualsPredicate represents [@attr='value'] predicate
AttributeEqualsPredicate
// ComparisonPredicate represents element comparison predicates
ComparisonPredicate
)
// Predicate represents a condition in XPath
type Predicate struct {
Type PredicateType
Index int
Offset int
Attribute string
Value string
Expression string
}
// XMLNode represents a node in the result set with its value and path
type XMLNode struct {
Value interface{}
Path string
}
// ParseXPath parses an XPath expression into a series of steps
func ParseXPath(path string) ([]XPathStep, error) {
if path == "" {
return nil, errors.New("empty path")
}
// This is just a placeholder implementation for the tests
// The actual implementation would parse the XPath expression
return nil, errors.New("not implemented")
}
// Get retrieves nodes from XML data using an XPath expression
func Get(data interface{}, path string) ([]XMLNode, error) {
if data == "" {
return nil, errors.New("empty XML data")
}
// This is just a placeholder implementation for the tests
// The actual implementation would evaluate the XPath against the XML
return nil, errors.New("not implemented")
}
// Set updates a node in the XML data using an XPath expression
func Set(xmlData string, path string, value interface{}) (string, error) {
// This is just a placeholder implementation for the tests
// The actual implementation would modify the XML based on the XPath
return "", errors.New("not implemented")
}
// SetAll updates all nodes matching an XPath expression in the XML data
func SetAll(xmlData string, path string, value interface{}) (string, error) {
// This is just a placeholder implementation for the tests
// The actual implementation would modify all matching nodes
return "", errors.New("not implemented")
}

View File

@@ -1,545 +0,0 @@
package xpath
import (
"reflect"
"testing"
)
// XML test data as a string for our tests
var testXML = `
<store>
<book category="fiction">
<title lang="en">The Fellowship of the Ring</title>
<author>J.R.R. Tolkien</author>
<year>1954</year>
<price>22.99</price>
</book>
<book category="fiction">
<title lang="en">The Two Towers</title>
<author>J.R.R. Tolkien</author>
<year>1954</year>
<price>23.45</price>
</book>
<book category="technical">
<title lang="en">Learning XML</title>
<author>Erik T. Ray</author>
<year>2003</year>
<price>39.95</price>
</book>
<bicycle>
<color>red</color>
<price>199.95</price>
</bicycle>
</store>
`
func TestParser(t *testing.T) {
tests := []struct {
path string
steps []XPathStep
wantErr bool
}{
{
path: "/store/bicycle/color",
steps: []XPathStep{
{Type: RootStep},
{Type: ChildStep, Name: "store"},
{Type: ChildStep, Name: "bicycle"},
{Type: ChildStep, Name: "color"},
},
},
{
path: "//price",
steps: []XPathStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Name: "price"},
},
},
{
path: "/store/book/*",
steps: []XPathStep{
{Type: RootStep},
{Type: ChildStep, Name: "store"},
{Type: ChildStep, Name: "book"},
{Type: WildcardStep},
},
},
{
path: "/store/book[1]/title",
steps: []XPathStep{
{Type: RootStep},
{Type: ChildStep, Name: "store"},
{Type: ChildStep, Name: "book"},
{Type: PredicateStep, Predicate: &Predicate{Type: IndexPredicate, Index: 1}},
{Type: ChildStep, Name: "title"},
},
},
{
path: "//title[@lang]",
steps: []XPathStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Name: "title"},
{Type: PredicateStep, Predicate: &Predicate{Type: AttributeExistsPredicate, Attribute: "lang"}},
},
},
{
path: "//title[@lang='en']",
steps: []XPathStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Name: "title"},
{Type: PredicateStep, Predicate: &Predicate{
Type: AttributeEqualsPredicate,
Attribute: "lang",
Value: "en",
}},
},
},
{
path: "/store/book[price>35.00]/title",
steps: []XPathStep{
{Type: RootStep},
{Type: ChildStep, Name: "store"},
{Type: ChildStep, Name: "book"},
{Type: PredicateStep, Predicate: &Predicate{
Type: ComparisonPredicate,
Expression: "price>35.00",
}},
{Type: ChildStep, Name: "title"},
},
},
{
path: "/store/book[last()]",
steps: []XPathStep{
{Type: RootStep},
{Type: ChildStep, Name: "store"},
{Type: ChildStep, Name: "book"},
{Type: PredicateStep, Predicate: &Predicate{Type: LastPredicate}},
},
},
{
path: "/store/book[last()-1]",
steps: []XPathStep{
{Type: RootStep},
{Type: ChildStep, Name: "store"},
{Type: ChildStep, Name: "book"},
{Type: PredicateStep, Predicate: &Predicate{
Type: LastMinusPredicate,
Offset: 1,
}},
},
},
{
path: "/store/book[position()<3]",
steps: []XPathStep{
{Type: RootStep},
{Type: ChildStep, Name: "store"},
{Type: ChildStep, Name: "book"},
{Type: PredicateStep, Predicate: &Predicate{
Type: PositionPredicate,
Expression: "position()<3",
}},
},
},
{
path: "invalid/path",
wantErr: true,
},
}
for _, tt := range tests {
t.Run(tt.path, func(t *testing.T) {
steps, err := ParseXPath(tt.path)
if (err != nil) != tt.wantErr {
t.Fatalf("ParseXPath() error = %v, wantErr %v", err, tt.wantErr)
}
if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
t.Errorf("ParseXPath() steps = %+v, want %+v", steps, tt.steps)
}
})
}
}
func TestEvaluator(t *testing.T) {
tests := []struct {
name string
path string
expected []XMLNode
error bool
}{
{
name: "simple_element_access",
path: "/store/bicycle/color",
expected: []XMLNode{
{Value: "red", Path: "/store/bicycle/color"},
},
},
{
name: "recursive_element_access",
path: "//price",
expected: []XMLNode{
{Value: "22.99", Path: "/store/book[1]/price"},
{Value: "23.45", Path: "/store/book[2]/price"},
{Value: "39.95", Path: "/store/book[3]/price"},
{Value: "199.95", Path: "/store/bicycle/price"},
},
},
{
name: "wildcard_element_access",
path: "/store/book[1]/*",
expected: []XMLNode{
{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
{Value: "J.R.R. Tolkien", Path: "/store/book[1]/author"},
{Value: "1954", Path: "/store/book[1]/year"},
{Value: "22.99", Path: "/store/book[1]/price"},
},
},
{
name: "indexed_element_access",
path: "/store/book[1]/title",
expected: []XMLNode{
{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
},
},
{
name: "attribute_exists_predicate",
path: "//title[@lang]",
expected: []XMLNode{
{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
{Value: "The Two Towers", Path: "/store/book[2]/title"},
{Value: "Learning XML", Path: "/store/book[3]/title"},
},
},
{
name: "attribute_equals_predicate",
path: "//title[@lang='en']",
expected: []XMLNode{
{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
{Value: "The Two Towers", Path: "/store/book[2]/title"},
{Value: "Learning XML", Path: "/store/book[3]/title"},
},
},
{
name: "value_comparison_predicate",
path: "/store/book[price>35.00]/title",
expected: []XMLNode{
{Value: "Learning XML", Path: "/store/book[3]/title"},
},
},
{
name: "last_predicate",
path: "/store/book[last()]/title",
expected: []XMLNode{
{Value: "Learning XML", Path: "/store/book[3]/title"},
},
},
{
name: "last_minus_predicate",
path: "/store/book[last()-1]/title",
expected: []XMLNode{
{Value: "The Two Towers", Path: "/store/book[2]/title"},
},
},
{
name: "position_predicate",
path: "/store/book[position()<3]/title",
expected: []XMLNode{
{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
{Value: "The Two Towers", Path: "/store/book[2]/title"},
},
},
{
name: "all_elements",
path: "//*",
expected: []XMLNode{
// For brevity, we'll just check the count, not all values
},
},
{
name: "invalid_index",
path: "/store/book[10]/title",
expected: []XMLNode{},
error: true,
},
{
name: "nonexistent_element",
path: "/store/nonexistent",
expected: []XMLNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(testXML, tt.path)
if err != nil {
if !tt.error {
t.Errorf("Get() returned error: %v", err)
}
return
}
// Special handling for the "//*" test case
if tt.path == "//*" {
// Just check that we got multiple elements, not the specific count
if len(result) < 10 { // We expect at least 10 elements
t.Errorf("Expected multiple elements for '//*', got %d", len(result))
}
return
}
if len(result) != len(tt.expected) {
t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
return
}
// Validate both values and paths
for i, e := range tt.expected {
if i < len(result) {
if !reflect.DeepEqual(result[i].Value, e.Value) {
t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
}
if result[i].Path != e.Path {
t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
}
}
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("empty_data", func(t *testing.T) {
result, err := Get("", "/store/book")
if err == nil {
t.Errorf("Expected error for empty data")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("empty_path", func(t *testing.T) {
_, err := ParseXPath("")
if err == nil {
t.Error("Expected error for empty path")
}
})
t.Run("invalid_xml", func(t *testing.T) {
_, err := Get("<invalid>xml", "/store")
if err == nil {
t.Error("Expected error for invalid XML")
}
})
t.Run("current_node", func(t *testing.T) {
result, err := Get(testXML, "/store/book[1]/.")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 {
t.Errorf("Expected 1 result, got %d", len(result))
}
})
t.Run("attributes", func(t *testing.T) {
result, err := Get(testXML, "/store/book[1]/title/@lang")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 || result[0].Value != "en" {
t.Errorf("Expected 'en', got %v", result)
}
})
}
func TestGetWithPaths(t *testing.T) {
tests := []struct {
name string
path string
expected []XMLNode
}{
{
name: "simple_element_access",
path: "/store/bicycle/color",
expected: []XMLNode{
{Value: "red", Path: "/store/bicycle/color"},
},
},
{
name: "indexed_element_access",
path: "/store/book[1]/title",
expected: []XMLNode{
{Value: "The Fellowship of the Ring", Path: "/store/book[1]/title"},
},
},
{
name: "recursive_element_access",
path: "//price",
expected: []XMLNode{
{Value: "22.99", Path: "/store/book[1]/price"},
{Value: "23.45", Path: "/store/book[2]/price"},
{Value: "39.95", Path: "/store/book[3]/price"},
{Value: "199.95", Path: "/store/bicycle/price"},
},
},
{
name: "attribute_access",
path: "/store/book[1]/title/@lang",
expected: []XMLNode{
{Value: "en", Path: "/store/book[1]/title/@lang"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(testXML, tt.path)
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("Get() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// First verify the value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Then verify the path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple element", func(t *testing.T) {
xmlData := `<root><name>John</name></root>`
newXML, err := Set(xmlData, "/root/name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(newXML, "/root/name")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 || result[0].Value != "Jane" {
t.Errorf("Set() failed: expected name to be 'Jane', got %v", result)
}
})
t.Run("attribute", func(t *testing.T) {
xmlData := `<root><element id="123"></element></root>`
newXML, err := Set(xmlData, "/root/element/@id", "456")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(newXML, "/root/element/@id")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 || result[0].Value != "456" {
t.Errorf("Set() failed: expected id to be '456', got %v", result)
}
})
t.Run("indexed element", func(t *testing.T) {
xmlData := `<root><items><item>first</item><item>second</item></items></root>`
newXML, err := Set(xmlData, "/root/items/item[1]", "changed")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(newXML, "/root/items/item[1]")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 || result[0].Value != "changed" {
t.Errorf("Set() failed: expected item to be 'changed', got %v", result)
}
})
}
func TestSetAll(t *testing.T) {
t.Run("multiple elements", func(t *testing.T) {
xmlData := `<root><items><item>first</item><item>second</item></items></root>`
newXML, err := SetAll(xmlData, "//item", "changed")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Verify all items are changed
result, err := Get(newXML, "//item")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 2 {
t.Errorf("Expected 2 results, got %d", len(result))
return
}
for i, node := range result {
if node.Value != "changed" {
t.Errorf("Item %d not changed, got %v", i+1, node.Value)
}
}
})
t.Run("attributes", func(t *testing.T) {
xmlData := `<root><item id="1"/><item id="2"/></root>`
newXML, err := SetAll(xmlData, "//item/@id", "new")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Verify all attributes are changed
result, err := Get(newXML, "//item/@id")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 2 {
t.Errorf("Expected 2 results, got %d", len(result))
return
}
for i, node := range result {
if node.Value != "new" {
t.Errorf("Attribute %d not changed, got %v", i+1, node.Value)
}
}
})
}

View File

@@ -0,0 +1,137 @@
package regression
import (
"modify/processor"
"modify/utils"
"os"
"path/filepath"
"testing"
)
func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
command := utils.ModifyCommand{
Regex: regex,
Lua: lua,
LogLevel: "TRACE",
}
commands, err := processor.ProcessRegex(content, command, "test")
if err != nil {
return "", 0, 0, err
}
result, modifications := utils.ExecuteModifications(commands, content)
return result, modifications, len(commands), nil
}
func TestTalentsMechanicOutOfRange(t *testing.T) {
given := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
actual := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="30" color="gui.green"/>
<Replace tag="[duration]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="20"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
if matches != 4 {
t.Errorf("Expected 4 matches, got %d", matches)
}
if mods != 4 {
t.Errorf("Expected 4 modifications, got %d", mods)
}
if result != actual {
t.Errorf("expected %s, got %s", actual, result)
}
}
func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
cwd, err := os.Getwd()
if err != nil {
t.Fatalf("Error getting current working directory: %v", err)
}
given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
// We don't really care how many god damn matches there are as long as the result is correct
// if matches != 45 {
// t.Errorf("Expected 45 match, got %d", matches)
// }
//
// if mods != 45 {
// t.Errorf("Expected 45 modification, got %d", mods)
// }
if string(result) != string(expected) {
t.Errorf("expected %s, got %s", expected, result)
}
}

View File

@@ -17,6 +17,7 @@ echo "Tag: $TAG"
echo "Building the thing..."
go build -o chef.exe .
go install .
echo "Creating a release..."
TOKEN="$GITEA_API_KEY"

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

View File

@@ -1,12 +0,0 @@
<config>
<item>
<value>75</value>
<multiplier>2</multiplier>
<divider>4</divider>
</item>
<item>
<value>150</value>
<multiplier>3</multiplier>
<divider>2</divider>
</item>
</config>

View File

@@ -1,37 +0,0 @@
<?xml version="1.0" encoding="UTF-8"?>
<testdata>
<!-- Numeric values -->
<item>
<id>1</id>
<value>200</value>
<price>24.99</price>
<quantity>5</quantity>
</item>
<!-- Text values -->
<item>
<id>2</id>
<name>Test Product</name>
<description>This is a test product description</description>
<category>Test</category>
</item>
<!-- Mixed content -->
<item>
<id>3</id>
<name>Mixed Product</name>
<price>19.99</price>
<code>PRD-123</code>
<tags>sale,discount,new</tags>
</item>
<!-- Empty and special values -->
<item>
<id>4</id>
<value></value>
<specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
<multiline>Line 1
Line 2
Line 3</multiline>
</item>
</testdata>

1252
testfiles/OutpostItems.xml Normal file

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

16
utils/flags.go Normal file
View File

@@ -0,0 +1,16 @@
package utils
import (
"flag"
)
var (
// Deprecated
GitFlag = flag.Bool("git", false, "Use git to manage files")
// Deprecated
ResetFlag = flag.Bool("reset", false, "Reset files to their original state")
LogLevel = flag.String("loglevel", "INFO", "Set log level: ERROR, WARNING, INFO, DEBUG, TRACE")
Cookfile = flag.String("cook", "**/cook.yml", "Path to cook config files, can be globbed")
ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
Filter = flag.String("filter", "", "Filter commands before running them")
)

97
utils/git.go Normal file
View File

@@ -0,0 +1,97 @@
package utils
import (
"fmt"
"modify/logger"
"os"
"path/filepath"
"time"
"github.com/go-git/go-git/v5/plumbing/object"
"github.com/go-git/go-git/v5"
)
var (
Repo *git.Repository
Worktree *git.Worktree
)
func SetupGit() error {
cwd, err := os.Getwd()
if err != nil {
return fmt.Errorf("failed to get current working directory: %w", err)
}
logger.Debug("Current working directory obtained: %s", cwd)
logger.Debug("Attempting to open git repository at %s", cwd)
Repo, err = git.PlainOpen(cwd)
if err != nil {
logger.Debug("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
Repo, err = git.PlainInit(cwd, false)
if err != nil {
return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
}
logger.Info("Successfully initialized a new git repository at %s", cwd)
} else {
logger.Info("Successfully opened existing git repository at %s", cwd)
}
logger.Debug("Attempting to obtain worktree for repository at %s", cwd)
Worktree, err = Repo.Worktree()
if err != nil {
return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
}
logger.Debug("Successfully obtained worktree for repository at %s", cwd)
return nil
}
func CleanupGitFiles(files []string) error {
for _, file := range files {
logger.Debug("Checking git status for file: %s", file)
status, err := Worktree.Status()
if err != nil {
logger.Error("Error getting worktree status: %v", err)
fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
return fmt.Errorf("error getting worktree status: %w", err)
}
if status.IsUntracked(file) {
logger.Info("Detected untracked file: %s. Adding to git index.", file)
_, err = Worktree.Add(file)
if err != nil {
logger.Error("Error adding file to git: %v", err)
fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
return fmt.Errorf("error adding file to git: %w", err)
}
filename := filepath.Base(file)
logger.Info("File %s added successfully. Committing with message: 'Track %s'", filename, filename)
_, err = Worktree.Commit("Track "+filename, &git.CommitOptions{
Author: &object.Signature{
Name: "Big Chef",
Email: "bigchef@bigchef.com",
When: time.Now(),
},
})
if err != nil {
logger.Error("Error committing file: %v", err)
fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
return fmt.Errorf("error committing file: %w", err)
}
logger.Info("Successfully committed file: %s", filename)
} else {
logger.Info("File %s is already tracked. Restoring it to the working tree.", file)
err := Worktree.Restore(&git.RestoreOptions{
Files: []string{file},
Staged: true,
Worktree: true,
})
if err != nil {
logger.Error("Error restoring file: %v", err)
fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
return fmt.Errorf("error restoring file: %w", err)
}
logger.Info("File %s restored successfully", file)
}
}
return nil
}

262
utils/modifycommand.go Normal file
View File

@@ -0,0 +1,262 @@
package utils
import (
"fmt"
"modify/logger"
"os"
"strings"
"github.com/bmatcuk/doublestar/v4"
"gopkg.in/yaml.v3"
)
type ModifyCommand struct {
Name string `yaml:"name"`
Regex string `yaml:"regex"`
Lua string `yaml:"lua"`
Files []string `yaml:"files"`
Git bool `yaml:"git"`
Reset bool `yaml:"reset"`
LogLevel string `yaml:"loglevel"`
Isolate bool `yaml:"isolate"`
NoDedup bool `yaml:"nodedup"`
}
type CookFile []ModifyCommand
func (c *ModifyCommand) Validate() error {
if c.Regex == "" {
return fmt.Errorf("pattern is required")
}
if c.Lua == "" {
return fmt.Errorf("lua expression is required")
}
if len(c.Files) == 0 {
return fmt.Errorf("at least one file is required")
}
if c.LogLevel == "" {
c.LogLevel = "INFO"
}
return nil
}
// Ehh.. Not much better... Guess this wasn't the big deal
var matchesMemoTable map[string]bool = make(map[string]bool)
func Matches(path string, glob string) (bool, error) {
key := fmt.Sprintf("%s:%s", path, glob)
if matches, ok := matchesMemoTable[key]; ok {
logger.Debug("Found match for file %q and glob %q in memo table", path, glob)
return matches, nil
}
matches, err := doublestar.Match(glob, path)
if err != nil {
return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
}
matchesMemoTable[key] = matches
return matches, nil
}
type FileCommandAssociation struct {
File string
IsolateCommands []ModifyCommand
Commands []ModifyCommand
}
func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
associationCount := 0
fileCommands := make(map[string]FileCommandAssociation)
for _, file := range files {
fileCommands[file] = FileCommandAssociation{
File: file,
IsolateCommands: []ModifyCommand{},
Commands: []ModifyCommand{},
}
for _, command := range commands {
for _, glob := range command.Files {
matches, err := Matches(file, glob)
if err != nil {
logger.Trace("Failed to match glob %s with file %s: %v", glob, file, err)
continue
}
if matches {
logger.Debug("Found match for file %q and command %q", file, command.Regex)
association := fileCommands[file]
if command.Isolate {
association.IsolateCommands = append(association.IsolateCommands, command)
} else {
association.Commands = append(association.Commands, command)
}
fileCommands[file] = association
associationCount++
}
}
}
logger.Debug("Found %d commands for file %q", len(fileCommands[file].Commands), file)
if len(fileCommands[file].Commands) == 0 {
logger.Info("No commands found for file %q", file)
}
if len(fileCommands[file].IsolateCommands) > 0 {
logger.Info("Found %d isolate commands for file %q", len(fileCommands[file].IsolateCommands), file)
}
}
logger.Info("Found %d associations between %d files and %d commands", associationCount, len(files), len(commands))
return fileCommands, nil
}
func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
logger.Info("Aggregating globs for %d commands", len(commands))
globs := make(map[string]struct{})
for _, command := range commands {
for _, glob := range command.Files {
globs[glob] = struct{}{}
}
}
logger.Info("Found %d unique globs", len(globs))
return globs
}
func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
cwd, err := os.Getwd()
if err != nil {
return nil, fmt.Errorf("failed to get current working directory: %w", err)
}
logger.Debug("Expanding patterns from directory: %s", cwd)
for pattern := range patterns {
logger.Trace("Processing pattern: %s", pattern)
matches, _ := doublestar.Glob(os.DirFS(cwd), pattern)
logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
for _, m := range matches {
info, err := os.Stat(m)
if err != nil {
logger.Warning("Error getting file info for %s: %v", m, err)
continue
}
if !info.IsDir() && !filesMap[m] {
logger.Trace("Adding file to process list: %s", m)
filesMap[m], files = true, append(files, m)
}
}
}
if len(files) > 0 {
logger.Debug("Found %d files to process: %v", len(files), files)
}
return files, nil
}
func LoadCommands(args []string) ([]ModifyCommand, error) {
commands := []ModifyCommand{}
logger.Info("Loading commands from cook files: %s", *Cookfile)
newcommands, err := LoadCommandsFromCookFiles(*Cookfile)
if err != nil {
return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
}
logger.Info("Successfully loaded %d commands from cook files", len(newcommands))
commands = append(commands, newcommands...)
logger.Info("Now total commands: %d", len(commands))
logger.Info("Loading commands from arguments: %v", args)
newcommands, err = LoadCommandFromArgs(args)
if err != nil {
if len(commands) == 0 {
return nil, fmt.Errorf("failed to load commands from args: %w", err)
}
logger.Warning("Failed to load commands from args: %v", err)
}
logger.Info("Successfully loaded %d commands from args", len(newcommands))
commands = append(commands, newcommands...)
logger.Info("Now total commands: %d", len(commands))
return commands, nil
}
func LoadCommandFromArgs(args []string) ([]ModifyCommand, error) {
// Cannot reset without git, right?
if *ResetFlag {
*GitFlag = true
}
if len(args) < 3 {
return nil, fmt.Errorf("at least %d arguments are required", 3)
}
command := ModifyCommand{
Regex: args[0],
Lua: args[1],
Files: args[2:],
Git: *GitFlag,
Reset: *ResetFlag,
LogLevel: *LogLevel,
}
if err := command.Validate(); err != nil {
return nil, fmt.Errorf("invalid command: %w", err)
}
return []ModifyCommand{command}, nil
}
func LoadCommandsFromCookFiles(s string) ([]ModifyCommand, error) {
cwd, err := os.Getwd()
if err != nil {
return nil, fmt.Errorf("failed to get current working directory: %w", err)
}
commands := []ModifyCommand{}
cookFiles, err := doublestar.Glob(os.DirFS(cwd), *Cookfile)
if err != nil {
return nil, fmt.Errorf("failed to glob cook files: %w", err)
}
for _, cookFile := range cookFiles {
cookFileData, err := os.ReadFile(cookFile)
if err != nil {
return nil, fmt.Errorf("failed to read cook file: %w", err)
}
newcommands, err := LoadCommandsFromCookFile(cookFileData)
if err != nil {
return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
}
commands = append(commands, newcommands...)
}
return commands, nil
}
func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
commands := []ModifyCommand{}
err := yaml.Unmarshal(cookFileData, &commands)
if err != nil {
return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
}
return commands, nil
}
// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
func CountGlobsBeforeDedup(commands []ModifyCommand) int {
count := 0
for _, cmd := range commands {
count += len(cmd.Files)
}
return count
}
func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
filteredCommands := []ModifyCommand{}
filters := strings.Split(filter, ",")
for _, cmd := range commands {
for _, filter := range filters {
if strings.Contains(cmd.Name, filter) {
filteredCommands = append(filteredCommands, cmd)
}
}
}
return filteredCommands
}

1271
utils/modifycommand_test.go Normal file

File diff suppressed because it is too large Load Diff

57
utils/replacecommand.go Normal file
View File

@@ -0,0 +1,57 @@
package utils
import (
"fmt"
"modify/logger"
"sort"
)
type ReplaceCommand struct {
From int
To int
With string
}
func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
var err error
sort.Slice(modifications, func(i, j int) bool {
return modifications[i].From > modifications[j].From
})
logger.Trace("Preparing to apply %d replacement commands in reverse order", len(modifications))
executed := 0
for _, modification := range modifications {
fileData, err = modification.Execute(fileData)
if err != nil {
logger.Error("Failed to execute replacement: %v", err)
continue
}
executed++
}
logger.Info("Successfully applied %d text replacements", executed)
return fileData, executed
}
func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
err := m.Validate(len(fileDataStr))
if err != nil {
return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
}
logger.Trace("Replace pos %d-%d with %q", m.From, m.To, m.With)
return fileDataStr[:m.From] + m.With + fileDataStr[m.To:], nil
}
func (m *ReplaceCommand) Validate(maxsize int) error {
if m.To < m.From {
return fmt.Errorf("command to is less than from: %v", m)
}
if m.From > maxsize || m.To > maxsize {
return fmt.Errorf("command from or to is greater than replacement length: %v", m)
}
if m.From < 0 || m.To < 0 {
return fmt.Errorf("command from or to is less than 0: %v", m)
}
return nil
}

View File

@@ -0,0 +1,504 @@
package utils
import (
"testing"
"github.com/stretchr/testify/assert"
)
func TestReplaceCommandExecute(t *testing.T) {
tests := []struct {
name string
input string
command ReplaceCommand
expected string
shouldError bool
}{
{
name: "Simple replacement",
input: "This is a test string",
command: ReplaceCommand{From: 5, To: 7, With: "was"},
expected: "This was a test string",
shouldError: false,
},
{
name: "Replace at beginning",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 5, With: "Hi"},
expected: "Hi world",
shouldError: false,
},
{
name: "Replace at end",
input: "Hello world",
command: ReplaceCommand{From: 6, To: 11, With: "everyone"},
expected: "Hello everyone",
shouldError: false,
},
{
name: "Replace entire string",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
expected: "Goodbye!",
shouldError: false,
},
{
name: "Error: From > To",
input: "Test string",
command: ReplaceCommand{From: 7, To: 5, With: "fail"},
expected: "Test string",
shouldError: true,
},
{
name: "Error: From > string length",
input: "Test",
command: ReplaceCommand{From: 10, To: 12, With: "fail"},
expected: "Test",
shouldError: true,
},
{
name: "Error: To > string length",
input: "Test",
command: ReplaceCommand{From: 2, To: 10, With: "fail"},
expected: "Test",
shouldError: true,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
result, err := tc.command.Execute(tc.input)
if tc.shouldError {
if err == nil {
t.Errorf("Expected an error for command %+v but got none", tc.command)
}
} else {
if err != nil {
t.Errorf("Unexpected error: %v", err)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
}
})
}
}
func TestExecuteModifications(t *testing.T) {
tests := []struct {
name string
input string
modifications []ReplaceCommand
expected string
expectedCount int
}{
{
name: "Single modification",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
},
expected: "Hi world",
expectedCount: 1,
},
{
name: "Multiple modifications",
input: "This is a test string",
modifications: []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 8, To: 14, With: "sample"},
},
expected: "That is sample string",
expectedCount: 2,
},
{
name: "Overlapping modifications",
input: "ABCDEF",
modifications: []ReplaceCommand{
{From: 0, To: 3, With: "123"}, // ABC -> 123
{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
},
// The actual behavior with the current implementation
expected: "123yzF",
expectedCount: 2,
},
{
name: "Sequential modifications",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 5, To: 6, With: ""}, // Remove the space
{From: 6, To: 11, With: "everyone"},
},
expected: "Hieveryone",
expectedCount: 3,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
// Make a copy of the modifications to avoid modifying the test case
mods := make([]ReplaceCommand, len(tc.modifications))
copy(mods, tc.modifications)
result, count := ExecuteModifications(mods, tc.input)
if count != tc.expectedCount {
t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
})
}
}
func TestReverseOrderExecution(t *testing.T) {
// This test verifies the current behavior of modification application
input := "Original text with multiple sections"
// Modifications in specific positions
modifications := []ReplaceCommand{
{From: 0, To: 8, With: "Modified"}, // Original -> Modified
{From: 9, To: 13, With: "document"}, // text -> document
{From: 14, To: 22, With: "without"}, // with -> without
{From: 23, To: 31, With: "any"}, // multiple -> any
}
// The actual current behavior of our implementation
expected := "Modified document withouttanytions"
result, count := ExecuteModifications(modifications, input)
if count != 4 {
t.Errorf("Expected 4 modifications, got %d", count)
}
if result != expected {
t.Errorf("Expected %q, got %q", expected, result)
}
}
// Replace text in the middle of a string with new content
func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello replaced, how are you?", result)
}
// Replace with empty string (deletion)
func TestReplaceCommandExecute_DeletesText(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello , how are you?", result)
}
// Replace with longer string than original segment
func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "longerreplacement",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello longerreplacement, how are you?", result)
}
// From and To values are the same (zero-length replacement)
func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 5,
With: "inserted",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Helloinserted world", result)
}
// From value is greater than To value
func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 10,
To: 5,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// From or To values exceed string length
func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 50, // Exceeds the length of the fileContent
With: "replaced",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world", result)
}
// From or To values are negative
func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: -1,
To: 10,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// Modifications are applied in reverse order (from highest to lowest 'From' value)
func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 10, To: 14, With: "sample"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a sample string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// One or more modifications fail but others succeed
func TestExecuteModificationsWithPartialFailures(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
// Create a custom ReplaceCommand implementation that will fail
failingCommand := ReplaceCommand{
From: 15,
To: 10, // Invalid range (To < From) to cause failure
With: "will fail",
}
// Valid commands
validCommand1 := ReplaceCommand{
From: 0,
To: 4,
With: "That",
}
validCommand2 := ReplaceCommand{
From: 26,
To: 38,
With: "modifications",
}
modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a test string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
// Only 2 out of 3 modifications should succeed
if executed != 2 {
t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
}
}
// All valid modifications are executed and the modified string is returned
func TestExecuteModificationsAllValid(t *testing.T) {
// Setup test data
fileData := "Hello world, this is a test"
modifications := []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 18, To: 20, With: "was"},
{From: 21, To: 27, With: "an example"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "Hi world, this was an example"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// The count of successfully executed modifications is returned
func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
// Setup test data
fileData := "Initial text for testing"
modifications := []ReplaceCommand{
{From: 0, To: 7, With: "Final"},
{From: 12, To: 16, With: "example"},
{From: 17, To: 24, With: "process"},
}
// Execute the function
_, executed := ExecuteModifications(modifications, fileData)
// Verify the count of executed modifications
expectedExecuted := 3
if executed != expectedExecuted {
t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
}
}
// Empty modifications list returns the original string with zero executed count
func TestExecuteModificationsWithEmptyList(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
if result != fileData {
t.Errorf("Expected result to be %q, but got %q", fileData, result)
}
if executed != 0 {
t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
}
}
// Modifications with identical 'From' values
func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 10, To: 14, With: "sample"},
{From: 10, To: 14, With: "example"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
// Yes, it's mangled, yes, it's intentional
// Every subsequent command works with the modified contents of the previous command
// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
// So we prepend "example" and end up with "examplele"
// Whether sample or example goes first here is irrelevant to us
// But it just so happens that sample goes first, so we end up with "examplele"
expectedResult := "This is a examplele string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// Modifications that would affect each other if not sorted properly
func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
// Setup test data
fileData := "The quick brown fox jumps over the lazy dog"
modifications := []ReplaceCommand{
{From: 4, To: 9, With: "slow"},
{From: 10, To: 15, With: "red"},
{From: 16, To: 19, With: "cat"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "The slow red cat jumps over the lazy dog"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}