77 Commits

Author SHA1 Message Date
3424fea8ad Dump a basic "config" to example usage on failed command 2025-07-19 01:15:48 +02:00
ddc1d83d58 Fix file associations
It was fucked because we were removing the static path and then cramming
that into assications
2025-04-22 10:53:25 +02:00
4b0a85411d From cook FILE - F I L E - FILEEEEE
This is the 4th time I make the SAME fix
2025-04-22 10:46:03 +02:00
46e871b626 Fix flag collision with logger 2025-04-22 10:45:11 +02:00
258dcc88e7 Fix reference to utils 2025-04-18 12:48:24 +02:00
75bf449bed Remove logger and replace it with a library 2025-04-18 12:47:47 +02:00
58586395fb Add file util for later 2025-04-13 21:31:19 +02:00
c5a68af5e6 PROPERLY implement doublestar 2025-04-13 21:29:18 +02:00
b4c0284734 Add rimworld cook file 2025-04-09 09:47:53 +02:00
c5d1dad8de Rename project to "cook" and ditch loading fgrom args, now files exclusively 2025-04-09 09:47:53 +02:00
4ff2ee80ee And fix the god damn backslashes fuck windows 2025-04-01 11:29:57 +02:00
633eebfd2a Support ~ in globs 2025-04-01 11:29:02 +02:00
5a31703840 Implement per command logger 2025-03-29 17:29:21 +01:00
162d0c758d Fix some tests 2025-03-29 17:29:21 +01:00
14d64495b6 Add deduplicate flag 2025-03-29 17:29:21 +01:00
fe6e97e832 Don't deduplicate (yet) 2025-03-29 17:23:21 +01:00
35b3d8b099 Reduce some of the reads and writes
It's really not necessary
2025-03-28 23:39:11 +01:00
2e3e958e15 Fix some tests and add some logs 2025-03-28 23:31:44 +01:00
955afc4295 Refactor running commands to separate functions 2025-03-28 16:59:22 +01:00
2c487bc443 Implement "Isolate" commands
Commands that run alone one by one on reading and writing the file
This should be used on commands that will modify a large part of the
file (or generally large parts)
Since that can fuck up the indices of other commands when ran together
2025-03-28 16:56:39 +01:00
b77224176b Add file lua value 2025-03-28 16:47:21 +01:00
a2201053c5 Remove some random ass fmt printf 2025-03-28 13:24:12 +01:00
04cedf5ece Fix the concurrent map writes 2025-03-28 11:35:38 +01:00
ebb07854cc Memoize the match table 2025-03-28 11:31:27 +01:00
8a86ae2f40 Add filter flag 2025-03-28 11:20:44 +01:00
e8f16dda2b Housekeeping 2025-03-28 02:14:27 +01:00
513773f641 Again 2025-03-28 01:26:26 +01:00
22914fe243 Add a lil log 2025-03-28 01:24:23 +01:00
2d523dfe64 Rename pattern to regex 2025-03-28 01:08:48 +01:00
2629722f67 Minor fixes and tweaks 2025-03-28 01:03:27 +01:00
1f6c4e4976 Fix up the tests and some minor bugs 2025-03-28 00:51:26 +01:00
bfd08e754e Replace old tests with asserts 2025-03-28 00:40:53 +01:00
750010b71a Add more tests to regex 2025-03-28 00:28:51 +01:00
9064a53820 Add more tests (and fix some things) for replacecommand 2025-03-28 00:23:42 +01:00
294c04a11a Add more tests for modifycommand 2025-03-28 00:03:23 +01:00
ba7ac07001 Fix up the logs a little 2025-03-27 23:36:56 +01:00
5d10178bf9 Update old and add new tests 2025-03-27 23:33:57 +01:00
f91c2b4795 More cleaning up 2025-03-27 23:07:22 +01:00
057db23d09 Implement panic recovery :?? 2025-03-27 23:06:46 +01:00
bf72734b90 Clean up regex.go a little 2025-03-27 23:04:39 +01:00
cc30c2bdcb Cleanup 2025-03-27 22:56:42 +01:00
f453079c72 Fix up regex.go 2025-03-27 22:50:15 +01:00
e634fe28bd Clean up processor 2025-03-27 22:24:59 +01:00
4e4b7bbd19 Implement parallel file processing 2025-03-27 22:22:43 +01:00
89eed3f847 Refactor git shit to its own module 2025-03-27 22:20:22 +01:00
f008efd5e1 Refactor modify and replace to their own files 2025-03-27 22:18:12 +01:00
f6def1e5a5 Refactor entirety of replace command to main for now 2025-03-27 22:11:03 +01:00
867b188718 Work out file reading and writing 2025-03-27 22:02:36 +01:00
aac29a4074 Refactor more stuff around 2025-03-27 21:58:52 +01:00
8a40f463f7 Implement file command association 2025-03-27 21:54:46 +01:00
8d4db1da91 Clean up code add some log lines and tidy up expandglobs 2025-03-27 21:49:28 +01:00
d41e2afe17 Update 2025-03-27 21:43:36 +01:00
76457d22cf Partially rework reading args to modify command loading 2025-03-27 21:39:16 +01:00
912950d463 Remove the vestiges of xml and json 2025-03-27 21:31:45 +01:00
25326ea11b Remove xml and json
They are simply not as useful as regex at all
There is nothing they can do regex cannot
And they have one massive penalty: the encoding
Which often results in MASSIVE diffs
2025-03-27 21:28:20 +01:00
df212b7fcc Remove jsonpath and xpath 2025-03-27 21:27:47 +01:00
f4a963760a Add dumptable helper function 2025-03-27 20:07:59 +01:00
d236811cb9 Introduce a new logging level for lua values 2025-03-27 20:06:50 +01:00
da93770334 Add strsplit lua helper 2025-03-27 19:56:31 +01:00
d9f54a8354 Fix test again 2025-03-27 19:49:57 +01:00
dc8da8ab63 Fix overlapping capture groups 2025-03-27 19:43:06 +01:00
24262a7dca Remove old unused xml files 2025-03-27 19:31:54 +01:00
d77b13c363 Update regression test 2025-03-27 19:31:20 +01:00
a9c60a3698 Neatly align log columns 2025-03-27 19:26:14 +01:00
66bcf21d79 Add goroutine numbers to log lines 2025-03-27 19:19:39 +01:00
e847e5c3ce Make little better logging 2025-03-27 18:53:02 +01:00
9a70c9696e Fix logger 2025-03-27 18:46:28 +01:00
9cea103042 Implement a more better logging solution 2025-03-27 17:53:43 +01:00
81d8259dfc Comment out some xml tests for now
We're not working on it for now
2025-03-27 17:46:43 +01:00
5c5fbac63f Make doublestar a little cleaner 2025-03-27 17:21:13 +01:00
3e818e61c7 Add string.format shortcut to lua 2025-03-27 15:38:07 +01:00
001470ffe4 Fix up regression tests 2025-03-27 15:37:57 +01:00
d88a76c4e2 Fix logging of groups 2025-03-26 22:26:02 +01:00
d3a1f1bd96 Rework regex grouping to avoid changing the same area twice 2025-03-26 22:24:19 +01:00
07a5f3f1a4 Add replaceCommands to avoid index suicide 2025-03-26 21:55:34 +01:00
e2257e082a Add a regression test 2025-03-26 21:55:17 +01:00
b3fce4244d Fix regex for numbers to support negative numbers 2025-03-26 18:30:21 +01:00
37 changed files with 6016 additions and 8024 deletions

1
.gitignore vendored
View File

@@ -1 +1,2 @@
*.exe *.exe
.qodo

70
.vscode/launch.json vendored
View File

@@ -5,16 +5,76 @@
"version": "0.2.0", "version": "0.2.0",
"configurations": [ "configurations": [
{ {
"name": "Launch Package", "name": "Launch Package (Barotrauma)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"*.yml",
]
},
{
"name": "Launch Package (Payday 2)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
"args": [
"-loglevel",
"trace",
"*.yml",
]
},
{
"name": "Launch Package (Barotrauma cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"cookassistant.yml",
]
},
{
"name": "Launch Package (Quasimorph cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
"args": [
"cook.yml",
]
},
{
"name": "Launch Package (Rimworld cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
"args": [
"cookVehicles.yml",
]
},
{
"name": "Launch Package (Workspace)",
"type": "go", "type": "go",
"request": "launch", "request": "launch",
"mode": "auto", "mode": "auto",
"program": "${workspaceFolder}", "program": "${workspaceFolder}",
"args": [ "args": [
"-mode=json", "tester.yml",
"$..name",
"v='pero'",
"test.json"
] ]
} }
] ]

View File

@@ -1,651 +0,0 @@
<?xml version="1.0" encoding="utf-8"?>
<Talents>
<Talent identifier="powerarmor">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.powerarmor">
<Replace tag="[bonusmovement]" value="25" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHasItem tags="deepdivinglarge" />
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
</Abilities>
</AbilityGroupInterval>
<AddedRecipe itemidentifier="exosuit"/>
</Talent>
<Talent identifier="foolhardy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="foolhardy" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="berserker">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="berserker" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="mudraptorwrestler">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.mudraptorwrestler">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattypeself">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData weapontype="NoWeapon,Melee" />
<AbilityConditionCharacter>
<Conditional group="eq mudraptor" />
</AbilityConditionCharacter>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="heavylifting">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.heavylifting">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHoldingItem tags="alienartifact,crate"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="iamthatguy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.iamthatguy">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.skillbonus">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
<Abilities>
<CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="heavywrench"/>
</Talent>
<Talent identifier="robotics">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.robotics"/>
<Description tag="talentdescription.roboticsreminder">
<Replace tag="[amount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="defensebotspawner"/>
<AddedRecipe itemidentifier="defensebotammobox"/>
</Talent>
<Talent identifier="ironstorm">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.ironstorm">
<Replace tag="[chance]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="scrapcannon"/>
</Talent>
<Talent identifier="residualwaste">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.residualwaste">
<Replace tag="[chance]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomChance="0.2"/>
<!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
<AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="massproduction">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.massproduction">
<Replace tag="[chance]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
<Conditions>
<AbilityConditionServerRandom randomChance="0.4" />
</Conditions>
<Abilities>
<CharacterAbilityRemoveRandomIngredient>
<AbilityConditionItem category="Material"/>
</CharacterAbilityRemoveRandomIngredient>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="toolmaintenance">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.toolmaintenance">
<Replace tag="[amount]" value="1" color="gui.green"/>
</Description>
<!-- Give once when unlocking the talent -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupEffect>
<!-- Give every 60 seconds for late comers -->
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="miner">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
<Description tag="talentdescription.miner">
<Replace tag="[probability]" value="320" color="gui.green"/>
</Description>
<Description tag="talentdescription.gainoredetachspeed">
<Replace tag="[amount]" value="1600" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomchance="12.8"/>
<AbilityConditionItem tags="ore"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="retrofit">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.retrofit" />
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ironman">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="ironhelmet"/>
<AddedRecipe itemidentifier="makeshiftarmor"/>
</Talent>
<Talent identifier="oiledmachinery">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.oiledmachinery">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="pumpndump">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.pumpndump">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<conditions>
<AbilityConditionItem tags="pump"/>
</conditions>
<Abilities>
<CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ballastdenizen">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.ballastdenizen">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="engineengineer">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.engineengineer">
<Replace tag="[amount]" value="2.5" color="gui.green"/>
<Replace tag="[max]" value="5" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="1" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="2" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="3" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="4" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="5" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="6" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="7" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel minlevel="8" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="multifunctional">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.multifunctional">
<Replace tag="[powerincrease]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="wrenchitem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="crowbaritem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="salvagecrew">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.bonusxponmission">
<Replace tag="[xpbonus]" value="30" color="gui.green"/>
<Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
</Description>
<Description tag="talentdescription.salvagecrew">
<Replace tag="[swimbonus]" value="50" color="gui.green"/>
<Replace tag="[resistanceamount]" value="10" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
<Conditions>
<AbilityConditionMission missiontype="Salvage"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="1.3"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionInSubmarine submarinetype="Wreck" />
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="This" disabledeltatime="true">
<Affliction identifier="salvagecrew" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.machinemaniac">
<Replace tag="[bonus]" value="80" color="gui.green"/>
<Replace tag="[amount]" value="3" color="gui.orange"/>
</Description>
<Description tag="talentdescription.machinemaniac.30">
<Replace tag="[requirement]" value="12" color="gui.green"/>
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
<Replace tag="[xpamount]" value="500" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.50">
<Replace tag="[requirement]" value="20" color="gui.green"/>
<Replace tag="[level]" value="1" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.100">
<Replace tag="[requirement]" value="40" color="gui.green"/>
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<!-- Give the player stats that tracks if the rewards should be given -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
</Conditions>
<Abilities>
<CharacterAbilityGiveExperience amount="2000"/>
<CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
</Conditions>
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="tinkerer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.increasemaxrepairmechanical">
<Replace tag="[percentage]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="modularrepairs">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
</Description>
<Description tag="talentdescription.freeupgrade">
<Replace tag="[level]" value="1" color="gui.green"/>
<Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="repairpack"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="hullfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="25" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="fixfoamgrenade"/>
<AddedRecipe itemidentifier="handheldstatusmonitor"/>
</Talent>
<Talent identifier="letitdrain">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.letitdrain"/>
<Description tag="talentdescription.letitdrainreminder">
<Replace tag="[itemcount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="portablepump"/>
</Talent>
<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="scrapsavant">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
<Description tag="talentdescription.doublescrapoutput" />
<Description tag="talentdescription.findadditionalscrap">
<Replace tag="[probability]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionItem tags="scrap"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
<Conditions>
<AbilityConditionItemInSubmarine submarinetype="Wreck"/>
<AbilityConditionItem tags="container"/>
</Conditions>
<Abilities>
<CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
<StatusEffects>
<StatusEffect type="OnAbility" target="UseTarget" >
<SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
</StatusEffect>
</StatusEffects>
</CharacterAbilitySpawnItemsToContainer>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="safetyfirst">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="safetyharness"/>
</Talent>
</Talents>

View File

@@ -0,0 +1,28 @@
package main
import (
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
)
func main() {
// Initialize logger with DEBUG level
logger.Init(logger.LevelDebug)
// Test different log levels
logger.Info("This is an info message")
logger.Debug("This is a debug message")
logger.Warning("This is a warning message")
logger.Error("This is an error message")
logger.Trace("This is a trace message (not visible at DEBUG level)")
// Test with a goroutine
logger.SafeGo(func() {
time.Sleep(10 * time.Millisecond)
logger.Info("Message from goroutine")
})
// Wait for goroutine to complete
time.Sleep(20 * time.Millisecond)
}

View File

@@ -1,6 +1,7 @@
package main package main
import ( import (
"cook/utils"
"os" "os"
"path/filepath" "path/filepath"
"testing" "testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
for _, tc := range tests { for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) { t.Run(tc.name, func(t *testing.T) {
files, err := expandFilePatterns(tc.patterns) // Convert string patterns to map[string]struct{} for ExpandGLobs
patternMap := make(map[string]struct{})
for _, pattern := range tc.patterns {
patternMap[pattern] = struct{}{}
}
files, err := utils.ExpandGLobs(patternMap)
if err != nil { if err != nil {
t.Fatalf("expandFilePatterns failed: %v", err) t.Fatalf("ExpandGLobs failed: %v", err)
} }
if len(files) != tc.expected { if len(files) != tc.expected {

14
go.mod
View File

@@ -1,12 +1,13 @@
module modify module cook
go 1.24.1 go 1.24.2
require ( require (
github.com/PaesslerAG/jsonpath v0.1.1 git.site.quack-lab.dev/dave/cylogger v1.2.2
github.com/antchfx/xmlquery v1.4.4
github.com/bmatcuk/doublestar/v4 v4.8.1 github.com/bmatcuk/doublestar/v4 v4.8.1
github.com/stretchr/testify v1.10.0
github.com/yuin/gopher-lua v1.1.1 github.com/yuin/gopher-lua v1.1.1
gopkg.in/yaml.v3 v3.0.1
) )
require ( require (
@@ -15,12 +16,14 @@ require (
github.com/ProtonMail/go-crypto v1.1.5 // indirect github.com/ProtonMail/go-crypto v1.1.5 // indirect
github.com/cloudflare/circl v1.6.0 // indirect github.com/cloudflare/circl v1.6.0 // indirect
github.com/cyphar/filepath-securejoin v0.4.1 // indirect github.com/cyphar/filepath-securejoin v0.4.1 // indirect
github.com/davecgh/go-spew v1.1.1 // indirect
github.com/emirpasic/gods v1.18.1 // indirect github.com/emirpasic/gods v1.18.1 // indirect
github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
github.com/go-git/go-billy/v5 v5.6.2 // indirect github.com/go-git/go-billy/v5 v5.6.2 // indirect
github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect
github.com/kevinburke/ssh_config v1.2.0 // indirect github.com/kevinburke/ssh_config v1.2.0 // indirect
github.com/pjbgf/sha1cd v0.3.2 // indirect github.com/pjbgf/sha1cd v0.3.2 // indirect
github.com/pmezard/go-difflib v1.0.0 // indirect
github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect
github.com/skeema/knownhosts v1.3.1 // indirect github.com/skeema/knownhosts v1.3.1 // indirect
github.com/xanzy/ssh-agent v0.3.3 // indirect github.com/xanzy/ssh-agent v0.3.3 // indirect
@@ -30,10 +33,7 @@ require (
) )
require ( require (
github.com/PaesslerAG/gval v1.0.0 // indirect
github.com/antchfx/xpath v1.3.3 // indirect
github.com/go-git/go-git/v5 v5.14.0 github.com/go-git/go-git/v5 v5.14.0
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect
golang.org/x/net v0.35.0 // indirect golang.org/x/net v0.35.0 // indirect
golang.org/x/text v0.22.0 // indirect
) )

73
go.sum
View File

@@ -1,21 +1,14 @@
dario.cat/mergo v1.0.0 h1:AGCNq9Evsj31mOgNPcLyXc+4PNABt905YmuqPYYpBWk= dario.cat/mergo v1.0.0 h1:AGCNq9Evsj31mOgNPcLyXc+4PNABt905YmuqPYYpBWk=
dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk= dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk=
git.site.quack-lab.dev/dave/cylogger v1.2.2 h1:4xUXASEBlG9NiGxh7f57xHh9imW4unHzakIEpQoKC5E=
git.site.quack-lab.dev/dave/cylogger v1.2.2/go.mod h1:VS9MI4Y/cwjCBZgel7dSfCQlwtAgHmfvixOoBgBhtKg=
github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY= github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY=
github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY= github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY=
github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU= github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU=
github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4= github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4=
github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE= github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE=
github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8= github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8=
github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4= github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4=
github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio= github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio=
github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs= github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs=
github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38= github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
@@ -41,10 +34,8 @@ github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMj
github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII= github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60= github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60=
github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k= github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k=
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ= github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ=
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw= github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw=
github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8= github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8=
github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU= github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU=
github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A= github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A=
@@ -80,91 +71,31 @@ github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOf
github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY= github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM= github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM=
github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw= github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw=
github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M= github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw= github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs= golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs=
golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ= golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ=
golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8= golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8=
golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY= golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY=
golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8= golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk= golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc= golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc=
golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU= golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU=
golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s= golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM= golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY= golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk= gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=

485
main.go
View File

@@ -3,17 +3,18 @@ package main
import ( import (
"flag" "flag"
"fmt" "fmt"
"log"
"os" "os"
"path/filepath" "sort"
"sync" "sync"
"time" "time"
"github.com/bmatcuk/doublestar/v4" "cook/processor"
"github.com/go-git/go-git/v5" "cook/utils"
"github.com/go-git/go-git/v5/plumbing/object"
"modify/processor" "github.com/go-git/go-git/v5"
"gopkg.in/yaml.v3"
logger "git.site.quack-lab.dev/dave/cylogger"
) )
type GlobalStats struct { type GlobalStats struct {
@@ -21,269 +22,347 @@ type GlobalStats struct {
TotalModifications int TotalModifications int
ProcessedFiles int ProcessedFiles int
FailedFiles int FailedFiles int
ModificationsPerCommand sync.Map
} }
var stats GlobalStats
var logger *log.Logger
var ( var (
jsonFlag = flag.Bool("json", false, "Process JSON files")
xmlFlag = flag.Bool("xml", false, "Process XML files")
gitFlag = flag.Bool("git", false, "Use git to manage files")
resetFlag = flag.Bool("reset", false, "Reset files to their original state")
repo *git.Repository repo *git.Repository
worktree *git.Worktree worktree *git.Worktree
stats GlobalStats = GlobalStats{
ModificationsPerCommand: sync.Map{},
}
) )
func init() {
log.SetFlags(log.Lmicroseconds | log.Lshortfile)
logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
stats = GlobalStats{}
}
func main() { func main() {
// TODO: Implement some sort of git integration
// Maybe use go-git
// Specify a -git flag
// If we are operating with git then:
// Inmitialize a repo if one doesn't exist (try to open right?)
// For each file matched by glob first figure out if it's already tracked
// If not tracked then track it and commit (either it alone or maybe multiple together somehow)
// Then reset the file (to undo previous modifications)
// THEN change the file
// In addition add a -undo flag that will ONLY reset the files without changing them
// Only for the ones matched by glob
// ^ important because binary files would fuck us up
flag.Usage = func() { flag.Usage = func() {
fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0]) fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nOptions:\n") fmt.Fprintf(os.Stderr, "\nOptions:\n")
fmt.Fprintf(os.Stderr, " -json\n")
fmt.Fprintf(os.Stderr, " Process JSON files\n")
fmt.Fprintf(os.Stderr, " -xml\n")
fmt.Fprintf(os.Stderr, " Process XML files\n")
fmt.Fprintf(os.Stderr, " -git\n") fmt.Fprintf(os.Stderr, " -git\n")
fmt.Fprintf(os.Stderr, " Use git to manage files\n") fmt.Fprintf(os.Stderr, " Use git to manage files\n")
fmt.Fprintf(os.Stderr, " -reset\n") fmt.Fprintf(os.Stderr, " -reset\n")
fmt.Fprintf(os.Stderr, " Reset files to their original state\n") fmt.Fprintf(os.Stderr, " Reset files to their original state\n")
fmt.Fprintf(os.Stderr, " -mode string\n") fmt.Fprintf(os.Stderr, " -loglevel string\n")
fmt.Fprintf(os.Stderr, " Processing mode: regex, xml, json (default \"regex\")\n") fmt.Fprintf(os.Stderr, " Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
fmt.Fprintf(os.Stderr, "\nExamples:\n") fmt.Fprintf(os.Stderr, "\nExamples:\n")
fmt.Fprintf(os.Stderr, " Regex mode (default):\n") fmt.Fprintf(os.Stderr, " Regex mode (default):\n")
fmt.Fprintf(os.Stderr, " %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0]) fmt.Fprintf(os.Stderr, " %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " XML mode:\n")
fmt.Fprintf(os.Stderr, " %s -xml \"//value\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " JSON mode:\n")
fmt.Fprintf(os.Stderr, " %s -json \"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n") fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
fmt.Fprintf(os.Stderr, " s1, s2, etc. are used to refer to capture groups as strings.\n") fmt.Fprintf(os.Stderr, " s1, s2, etc. are used to refer to capture groups as strings.\n")
fmt.Fprintf(os.Stderr, " Helper functions: num(str) converts string to number, str(num) converts number to string\n") fmt.Fprintf(os.Stderr, " Helper functions: num(str) converts string to number, str(num) converts number to string\n")
fmt.Fprintf(os.Stderr, " is_number(str) checks if a string is numeric\n") fmt.Fprintf(os.Stderr, " is_number(str) checks if a string is numeric\n")
fmt.Fprintf(os.Stderr, " For XML and JSON, the captured values are exposed as 'v', which can be of any type we capture (string, number, table).\n")
fmt.Fprintf(os.Stderr, " If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n") fmt.Fprintf(os.Stderr, " If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n")
fmt.Fprintf(os.Stderr, " You can use any valid Lua code, including if statements, loops, etc.\n") fmt.Fprintf(os.Stderr, " You can use any valid Lua code, including if statements, loops, etc.\n")
fmt.Fprintf(os.Stderr, " Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n") fmt.Fprintf(os.Stderr, " Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
} }
// TODO: Fix bed shitting when doing *.yml in barotrauma directory
flag.Parse() flag.Parse()
args := flag.Args() args := flag.Args()
if *resetFlag {
*gitFlag = true
}
if len(args) < 3 { logger.InitFlag()
log.Printf("At least %d arguments are required", 3) logger.Info("Initializing with log level: %s", logger.GetLevel().String())
// The plan is:
// Load all commands
commands, err := utils.LoadCommands(args)
if err != nil || len(commands) == 0 {
logger.Error("Failed to load commands: %v", err)
CreateExampleConfig()
flag.Usage() flag.Usage()
return return
} }
// Get the appropriate pattern and expression based on mode if *utils.Filter != "" {
var pattern, luaExpr string logger.Info("Filtering commands by name: %s", *utils.Filter)
var filePatterns []string commands = utils.FilterCommands(commands, *utils.Filter)
logger.Info("Filtered %d commands", len(commands))
pattern = args[0]
luaExpr = args[1]
filePatterns = args[2:]
// Prepare the Lua expression
originalLuaExpr := luaExpr
luaExpr = processor.BuildLuaScript(luaExpr)
if originalLuaExpr != luaExpr {
logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
} }
if *gitFlag { // Then aggregate all the globs and deduplicate them
err := setupGit() globs := utils.AggregateGlobs(commands)
logger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
for _, command := range commands {
logger.Trace("Command: %s", command.Name)
logger.Trace("Regex: %s", command.Regex)
logger.Trace("Files: %v", command.Files)
logger.Trace("Lua: %s", command.Lua)
logger.Trace("Git: %t", command.Git)
logger.Trace("Reset: %t", command.Reset)
logger.Trace("Isolate: %t", command.Isolate)
logger.Trace("LogLevel: %s", command.LogLevel)
}
// Resolve all the files for all the globs
logger.Info("Found %d unique file patterns", len(globs))
files, err := utils.ExpandGLobs(globs)
if err != nil { if err != nil {
fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err) logger.Error("Failed to expand file patterns: %v", err)
return return
} }
} logger.Info("Found %d files to process", len(files))
// Expand file patterns with glob support // Somehow connect files to commands via globs..
files, err := expandFilePatterns(filePatterns) // For each file check every glob of every command
// Maybe memoize this part
// That way we know what commands affect what files
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil { if err != nil {
fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err) logger.Error("Failed to associate files with commands: %v", err)
return return
} }
if len(files) == 0 { // Then for each file run all commands associated with the file
fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n") workers := make(chan struct{}, *utils.ParallelFiles)
return wg := sync.WaitGroup{}
}
if *gitFlag { // Add performance tracking
err := cleanupGitFiles(files) startTime := time.Now()
if err != nil { var fileMutex sync.Mutex
fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
return
}
}
if *resetFlag {
log.Printf("Files reset to their original state, nothing more to do")
return
}
// Create the processor based on mode // Create a map to store loggers for each command
var proc processor.Processor commandLoggers := make(map[string]*logger.Logger)
switch { for _, command := range commands {
case *xmlFlag: // Create a named logger for each command
proc = &processor.XMLProcessor{} cmdName := command.Name
logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files", if cmdName == "" {
pattern, luaExpr, len(files)) // If no name is provided, use a short version of the regex pattern
case *jsonFlag: if len(command.Regex) > 20 {
proc = &processor.JSONProcessor{} cmdName = command.Regex[:17] + "..."
logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
pattern, luaExpr, len(files))
default:
proc = &processor.RegexProcessor{}
logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
pattern, luaExpr, len(files))
}
var wg sync.WaitGroup
// Process each file
for _, file := range files {
wg.Add(1)
go func(file string) {
defer wg.Done()
logger.Printf("Processing file: %s", file)
// It's a bit fucked, maybe I could do better to call it from proc... But it'll do for now
modCount, matchCount, err := processor.Process(proc, file, pattern, luaExpr)
if err != nil {
fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
stats.FailedFiles++
} else { } else {
logger.Printf("Successfully processed file: %s", file) cmdName = command.Regex
stats.ProcessedFiles++
stats.TotalMatches += matchCount
stats.TotalModifications += modCount
} }
}(file) }
// Parse the log level for this specific command
cmdLogLevel := logger.ParseLevel(command.LogLevel)
// Create a logger with the command name as a field
commandLoggers[command.Name] = logger.WithField("command", cmdName)
commandLoggers[command.Name].SetLevel(cmdLogLevel)
logger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
}
for file, association := range associations {
workers <- struct{}{}
wg.Add(1)
logger.SafeGoWithArgs(func(args ...interface{}) {
defer func() { <-workers }()
defer wg.Done()
// Track per-file processing time
fileStartTime := time.Now()
fileData, err := os.ReadFile(file)
if err != nil {
logger.Error("Failed to read file %q: %v", file, err)
return
}
fileDataStr := string(fileData)
fileDataStr, err = RunIsolateCommands(association, file, fileDataStr, &fileMutex)
if err != nil {
logger.Error("Failed to run isolate commands for file %q: %v", file, err)
return
}
fileDataStr, err = RunOtherCommands(file, fileDataStr, association, &fileMutex, commandLoggers)
if err != nil {
logger.Error("Failed to run other commands for file %q: %v", file, err)
return
}
err = os.WriteFile(file, []byte(fileDataStr), 0644)
if err != nil {
logger.Error("Failed to write file %q: %v", file, err)
return
}
logger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
}, file, commands)
} }
wg.Wait() wg.Wait()
processingTime := time.Since(startTime)
logger.Info("Processing completed in %v", processingTime)
if stats.ProcessedFiles > 0 {
logger.Info("Average time per file: %v", processingTime/time.Duration(stats.ProcessedFiles))
}
// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
// Do that with logger.WithField("loglevel", level.String())
// Since each command also has its own log level
// TODO: Maybe even figure out how to run individual commands...?
// TODO: What to do with git? Figure it out ....
// if *gitFlag {
// logger.Info("Git integration enabled, setting up git repository")
// err := setupGit()
// if err != nil {
// logger.Error("Failed to setup git: %v", err)
// fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
// return
// }
// }
// logger.Debug("Expanding file patterns")
// files, err := expandFilePatterns(filePatterns)
// if err != nil {
// logger.Error("Failed to expand file patterns: %v", err)
// fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
// return
// }
// if *gitFlag {
// logger.Info("Cleaning up git files before processing")
// err := cleanupGitFiles(files)
// if err != nil {
// logger.Error("Failed to cleanup git files: %v", err)
// fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
// return
// }
// }
// if *resetFlag {
// logger.Info("Files reset to their original state, nothing more to do")
// log.Printf("Files reset to their original state, nothing more to do")
// return
// }
// Print summary // Print summary
if stats.TotalModifications == 0 { if stats.TotalModifications == 0 {
fmt.Fprintf(os.Stderr, "No modifications were made in any files\n") logger.Warning("No modifications were made in any files")
} else { } else {
fmt.Printf("Operation complete! Modified %d values in %d/%d files\n", logger.Info("Operation complete! Modified %d values in %d/%d files",
stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles) stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
} sortedCommands := []string{}
} stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
sortedCommands = append(sortedCommands, key.(string))
return true
})
sort.Strings(sortedCommands)
func setupGit() error { for _, command := range sortedCommands {
cwd, err := os.Getwd() count, _ := stats.ModificationsPerCommand.Load(command)
if err != nil { if count.(int) > 0 {
return fmt.Errorf("failed to get current working directory: %w", err) logger.Info("\tCommand %q made %d modifications", command, count)
}
logger.Printf("Current working directory obtained: %s", cwd)
logger.Printf("Attempting to open git repository at %s", cwd)
repo, err = git.PlainOpen(cwd)
if err != nil {
logger.Printf("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
repo, err = git.PlainInit(cwd, false)
if err != nil {
return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
}
logger.Printf("Successfully initialized a new git repository at %s", cwd)
} else { } else {
logger.Printf("Successfully opened existing git repository at %s", cwd) logger.Warning("\tCommand %q made no modifications", command)
} }
logger.Printf("Attempting to obtain worktree for repository at %s", cwd)
worktree, err = repo.Worktree()
if err != nil {
return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
}
logger.Printf("Successfully obtained worktree for repository at %s", cwd)
return nil
}
func expandFilePatterns(patterns []string) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
for _, pattern := range patterns {
matches, _ := doublestar.Glob(os.DirFS("."), pattern)
for _, m := range matches {
if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
filesMap[m], files = true, append(files, m)
} }
} }
} }
if len(files) > 0 { func CreateExampleConfig() {
logger.Printf("Found %d files to process", len(files)) commands := []utils.ModifyCommand{
} {
return files, nil Name: "DoubleNumericValues",
} Regex: "<value>(\\d+)</value>",
Lua: "v1 * 2",
func cleanupGitFiles(files []string) error { Files: []string{"data/*.xml"},
for _, file := range files { LogLevel: "INFO",
logger.Printf("Checking file: %s", file)
status, err := worktree.Status()
if err != nil {
fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
return fmt.Errorf("error getting worktree status: %w", err)
}
if status.IsUntracked(file) {
logger.Printf("Detected untracked file: %s. Attempting to add it to the git index.", file)
_, err = worktree.Add(file)
if err != nil {
fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
return fmt.Errorf("error adding file to git: %w", err)
}
filename := filepath.Base(file)
logger.Printf("File %s added successfully. Now committing it with message: 'Track %s'", filename, filename)
_, err = worktree.Commit("Track "+filename, &git.CommitOptions{
Author: &object.Signature{
Name: "Big Chef",
Email: "bigchef@bigchef.com",
When: time.Now(),
}, },
}) {
Name: "UpdatePrices",
Regex: "price=\"(\\d+)\"",
Lua: "if num(v1) < 100 then return v1 * 1.5 else return v1 end",
Files: []string{"items/*.xml", "shop/*.xml"},
Git: true,
LogLevel: "DEBUG",
},
{
Name: "IsolatedTagUpdate",
Regex: "<tag>(.*?)</tag>",
Lua: "string.upper(s1)",
Files: []string{"config.xml"},
Isolate: true,
NoDedup: true,
LogLevel: "TRACE",
},
}
data, err := yaml.Marshal(commands)
if err != nil { if err != nil {
fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err) logger.Error("Failed to marshal example config: %v", err)
return fmt.Errorf("error committing file: %w", err) return
} }
logger.Printf("Successfully committed file: %s with message: 'Track %s'", filename, filename)
} else { err = os.WriteFile("example_cook.yml", data, 0644)
logger.Printf("File %s is already tracked. Restoring it to the working tree.", file)
err := worktree.Restore(&git.RestoreOptions{
Files: []string{file},
Staged: true,
Worktree: true,
})
if err != nil { if err != nil {
fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err) logger.Error("Failed to write example_cook.yml: %v", err)
return fmt.Errorf("error restoring file: %w", err) return
} }
logger.Printf("File %s restored successfully.", file)
logger.Info("Wrote example_cook.yml")
} }
func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, fileMutex *sync.Mutex, commandLoggers map[string]*logger.Logger) (string, error) {
// Aggregate all the modifications and execute them
modifications := []utils.ReplaceCommand{}
for _, command := range association.Commands {
// Use command-specific logger if available, otherwise fall back to default logger
cmdLogger := logger.Default
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
} }
return nil
cmdLogger.Info("Processing file %q with command %q", file, command.Regex)
newModifications, err := processor.ProcessRegex(fileDataStr, command, file)
if err != nil {
return fileDataStr, fmt.Errorf("failed to process file %q with command %q: %w", file, command.Regex, err)
}
modifications = append(modifications, newModifications...)
// It is not guranteed that all the commands will be executed...
// TODO: Make this better
// We'd have to pass the map to executemodifications or something...
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
cmdLogger.Debug("Command %q generated %d modifications", command.Name, len(newModifications))
}
if len(modifications) == 0 {
logger.Info("No modifications found for file %q", file)
return fileDataStr, nil
}
// Sort commands in reverse order for safe replacements
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
fileMutex.Lock()
stats.ProcessedFiles++
stats.TotalModifications += count
fileMutex.Unlock()
logger.Info("Executed %d modifications for file %q", count, file)
return fileDataStr, nil
}
func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string, fileMutex *sync.Mutex) (string, error) {
for _, isolateCommand := range association.IsolateCommands {
logger.Info("Processing file %q with isolate command %q", file, isolateCommand.Regex)
modifications, err := processor.ProcessRegex(fileDataStr, isolateCommand, file)
if err != nil {
return fileDataStr, fmt.Errorf("failed to process file %q with isolate command %q: %w", file, isolateCommand.Regex, err)
}
if len(modifications) == 0 {
logger.Warning("No modifications found for file %q", file)
return fileDataStr, nil
}
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
fileMutex.Lock()
stats.ProcessedFiles++
stats.TotalModifications += count
fileMutex.Unlock()
logger.Info("Executed %d isolate modifications for file %q", count, file)
}
return fileDataStr, nil
} }

View File

@@ -1,165 +0,0 @@
package processor
import (
"encoding/json"
"fmt"
"log"
"modify/processor/jsonpath"
lua "github.com/yuin/gopher-lua"
)
// JSONProcessor implements the Processor interface for JSON documents
type JSONProcessor struct{}
// ProcessContent implements the Processor interface for JSONProcessor
func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse JSON document
var jsonData interface{}
err := json.Unmarshal([]byte(content), &jsonData)
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
}
// Find nodes matching the JSONPath pattern
nodes, err := jsonpath.Get(jsonData, pattern)
if err != nil {
return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
modCount := 0
for _, node := range nodes {
log.Printf("Processing node at path: %s with value: %v", node.Path, node.Value)
// Initialize Lua
L, err := NewLuaState()
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
log.Println("Lua state initialized successfully.")
err = p.ToLua(L, node.Value)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
}
log.Printf("Converted node value to Lua: %v", node.Value)
originalScript := luaExpr
fullScript := BuildLuaScript(luaExpr)
log.Printf("Original script: %q, Full script: %q", originalScript, fullScript)
// Execute Lua script
log.Printf("Executing Lua script: %q", fullScript)
if err := L.DoString(fullScript); err != nil {
return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
}
log.Println("Lua script executed successfully.")
// Get modified value
result, err := p.FromLua(L)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
}
log.Printf("Retrieved modified value from Lua: %v", result)
modified := false
modified = L.GetGlobal("modified").String() == "true"
if !modified {
log.Printf("No changes made to node at path: %s", node.Path)
continue
}
// Apply the modification to the JSON data
err = p.updateJSONValue(jsonData, node.Path, result)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
}
log.Printf("Updated JSON at path: %s with new value: %v", node.Path, result)
modCount++
}
// Convert the modified JSON back to a string with same formatting
var jsonBytes []byte
jsonBytes, err = json.MarshalIndent(jsonData, "", " ")
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
}
return string(jsonBytes), modCount, matchCount, nil
}
// updateJSONValue updates a value in the JSON structure based on its JSONPath
func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
// Special handling for root node
if path == "$" {
// For the root node, we'll copy the value to the jsonData reference
// This is a special case since we can't directly replace the interface{} variable
// We need to handle different types of root elements
switch rootValue := newValue.(type) {
case map[string]interface{}:
// For objects, we need to copy over all keys
rootMap, ok := jsonData.(map[string]interface{})
if !ok {
// If the original wasn't a map, completely replace it with the new map
// This is handled by the jsonpath.Set function
return jsonpath.Set(jsonData, path, newValue)
}
// Clear the original map
for k := range rootMap {
delete(rootMap, k)
}
// Copy all keys from the new map
for k, v := range rootValue {
rootMap[k] = v
}
return nil
case []interface{}:
// For arrays, we need to handle similarly
rootArray, ok := jsonData.([]interface{})
if !ok {
// If the original wasn't an array, use jsonpath.Set
return jsonpath.Set(jsonData, path, newValue)
}
// Clear and recreate the array
*&rootArray = rootValue
return nil
default:
// For other types, use jsonpath.Set
return jsonpath.Set(jsonData, path, newValue)
}
}
// For non-root paths, use the regular Set method
err := jsonpath.Set(jsonData, path, newValue)
if err != nil {
return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
}
return nil
}
// ToLua converts JSON values to Lua variables
func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
table, err := ToLua(L, data)
if err != nil {
return err
}
L.SetGlobal("v", table)
return nil
}
// FromLua retrieves values from Lua
func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
luaValue := L.GetGlobal("v")
return FromLua(L, luaValue)
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,490 +0,0 @@
package jsonpath
import (
"fmt"
"strconv"
)
// JSONStep represents a single step in a JSONPath query
type JSONStep struct {
Type StepType
Key string // For Child/RecursiveDescent
Index int // For Index (use -1 for wildcard "*")
}
// JSONNode represents a value in the JSON data with its path
type JSONNode struct {
Value interface{} // The value found at the path
Path string // The exact JSONPath where the value was found
}
// StepType defines the types of steps in a JSONPath
type StepType int
const (
RootStep StepType = iota // $ - The root element
ChildStep // .key - Direct child access
RecursiveDescentStep // ..key - Recursive search for key
WildcardStep // .* - All children of an object
IndexStep // [n] - Array index access (or [*] for all elements)
)
// TraversalMode determines how the traversal behaves
type TraversalMode int
const (
CollectMode TraversalMode = iota // Just collect matched nodes
ModifyFirstMode // Modify first matching node
ModifyAllMode // Modify all matching nodes
)
// ParseJSONPath parses a JSONPath string into a sequence of steps
func ParseJSONPath(path string) ([]JSONStep, error) {
if len(path) == 0 || path[0] != '$' {
return nil, fmt.Errorf("path must start with $; received: %q", path)
}
steps := []JSONStep{}
i := 0
for i < len(path) {
switch path[i] {
case '$':
steps = append(steps, JSONStep{Type: RootStep})
i++
case '.':
i++
if i < len(path) && path[i] == '.' {
// Recursive descent
i++
key, nextPos := readKey(path, i)
steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
i = nextPos
} else {
// Child step or wildcard
key, nextPos := readKey(path, i)
if key == "*" {
steps = append(steps, JSONStep{Type: WildcardStep})
} else {
steps = append(steps, JSONStep{Type: ChildStep, Key: key})
}
i = nextPos
}
case '[':
// Index step
i++
indexStr, nextPos := readIndex(path, i)
if indexStr == "*" {
steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
} else {
index, err := strconv.Atoi(indexStr)
if err != nil {
return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
}
steps = append(steps, JSONStep{Type: IndexStep, Index: index})
}
i = nextPos + 1 // Skip closing ]
default:
return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
}
}
return steps, nil
}
// readKey extracts a key name from the path
func readKey(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == '.' || path[i] == '[' {
break
}
}
return path[start:i], i
}
// readIndex extracts an array index or wildcard from the path
func readIndex(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == ']' {
break
}
}
return path[start:i], i
}
// Get retrieves values with their paths from data at the specified JSONPath
// Each returned JSONNode contains both the value and its exact path in the data structure
func Get(data interface{}, path string) ([]JSONNode, error) {
steps, err := ParseJSONPath(path)
if err != nil {
return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
results := []JSONNode{}
err = traverseWithPaths(data, steps, &results, "$")
if err != nil {
return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
}
return results, nil
}
// Set updates the value at the specified JSONPath in the original data structure.
// It only modifies the first matching node.
func Set(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// SetAll updates all matching values at the specified JSONPath.
func SetAll(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// setWithPath modifies values while tracking paths
func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
if node == nil || *success && mode == ModifyFirstMode {
return nil
}
// Skip root step
actualSteps := steps
if len(steps) > 0 && steps[0].Type == RootStep {
actualSteps = steps[1:]
}
// If we have no steps left, we're setting the root value
if len(actualSteps) == 0 {
// For the root node, we need to handle it differently depending on what's passed in
// since we can't directly replace the interface{} variable
// We'll signal success and let the JSONProcessor handle updating the root
*success = true
return nil
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
childPath := currentPath + "." + step.Key
if isLastStep {
// We've reached the target, set the value
m[step.Key] = value
*success = true
return nil
}
// Create intermediate nodes if necessary
child, exists := m[step.Key]
if !exists {
// Create missing intermediate node
if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
child = []interface{}{}
} else {
child = map[string]interface{}{}
}
m[step.Key] = child
}
err := setWithPath(child, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
arr[i] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
arr[step.Index] = value
*success = true
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
}
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
m[step.Key] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(val, remainingSteps, success, value, directPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
// Skip keys we've already processed directly
if step.Key != "*" && k == step.Key {
continue
}
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
m[k] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(v, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
return nil
}
// traverseWithPaths tracks both nodes and their paths during traversal
func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
if len(steps) == 0 || node == nil {
return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
}
// Skip root step
actualSteps := steps
if steps[0].Type == RootStep {
if len(steps) == 1 {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
return nil
}
actualSteps = steps[1:]
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
child, exists := m[step.Key]
if !exists {
return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
}
childPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: child, Path: childPath})
} else {
err := traverseWithPaths(child, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node is not an array; actual type: %T", node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
} else {
return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: val, Path: directPath})
} else {
err := traverseWithPaths(val, remainingSteps, results, directPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
}
}
}
}
// For wildcard, collect this node
if step.Key == "*" && isLastStep {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
*results = append(*results, JSONNode{Value: v, Path: childPath})
} else {
err := traverseWithPaths(v, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
}
return nil
}

View File

@@ -1,577 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
func TestGetWithPathsBasic(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
error bool
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
{
name: "nonexistent path",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
},
path: "$.user.email",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
if !tt.error {
t.Errorf("GetWithPaths() returned error: %v", err)
}
return
}
// For nonexistent path, we expect empty slice
if tt.name == "nonexistent path" {
if len(result) > 0 {
t.Errorf("GetWithPaths() returned %v, expected empty result", result)
}
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For wildcard results, we need to check containment rather than exact order
if tt.name == "wildcard" || tt.name == "recursive descent" {
// For each expected item, check if it exists in the results by both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
found = true
break
}
}
if !found {
t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
}
}
} else {
// Otherwise check exact equality of both values and paths
for i, expected := range tt.expected {
if !reflect.DeepEqual(result[i].Value, expected.Value) {
t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
}
if result[i].Path != expected.Path {
t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := Set(data, "$.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("nested property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
}
err := Set(data, "$.user.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
user, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user["name"] != "Jane" {
t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
}
})
t.Run("array element", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
}
err := Set(data, "$.users[0].name", "Bob")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user0["name"] != "Bob" {
t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
}
})
t.Run("complex value", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
}
newProfile := map[string]interface{}{
"email": "john.doe@example.com",
"phone": "123-456-7890",
}
err := Set(data, "$.user.profile", newProfile)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
profile, ok := userMap["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Profile is not a map")
}
if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
t.Errorf("Set() failed: expected profile to be updated with new values")
}
})
t.Run("create new property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if email, exists := userMap["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
}
})
t.Run("create nested properties", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.contact.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
contact, ok := userMap["contact"].(map[string]interface{})
if !ok {
t.Fatalf("Contact is not a map")
}
if email, exists := contact["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
}
})
t.Run("create array and element", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
// This should create an empty addresses array, but won't be able to set index 0
// since the array is empty
err := Set(data, "$.user.addresses[0].street", "123 Main St")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
})
t.Run("multiple targets (should only update first)", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := Set(data, "$.users[*].active", false)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User0 is not a map")
}
user1, ok := users[1].(map[string]interface{})
if !ok {
t.Fatalf("User1 is not a map")
}
// Only the first one should be changed
if active, exists := user0["active"]; !exists || active != false {
t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
}
// The second one should remain unchanged
if active, exists := user1["active"]; !exists || active != true {
t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
}
})
t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
}
err := Set(data, "$", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Data should be unchanged
if data["name"] != "John" {
t.Errorf("Data was modified when setting on root")
}
})
}
func TestSetAll(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := SetAll(data, "$.name", "Jane")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("all array elements", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := SetAll(data, "$.users[*].active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
// Both elements should be updated
for i, user := range users {
userMap, ok := user.(map[string]interface{})
if !ok {
t.Fatalf("User%d is not a map", i)
}
if active, exists := userMap["active"]; !exists || active != false {
t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
}
}
})
t.Run("recursive descent", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
"admin": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
}
err := SetAll(data, "$..active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Check user profile
userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access user.profile")
}
if active, exists := userProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
}
// Check admin profile
adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access admin.profile")
}
if active, exists := adminProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
}
})
}
func TestGetWithPathsExtended(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
t.Errorf("GetWithPaths() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// Check if value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Check if path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -1,318 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
var testData = map[string]interface{}{
"store": map[string]interface{}{
"book": []interface{}{
map[string]interface{}{
"title": "The Fellowship of the Ring",
"price": 22.99,
},
map[string]interface{}{
"title": "The Two Towers",
"price": 23.45,
},
},
"bicycle": map[string]interface{}{
"color": "red",
"price": 199.95,
},
},
}
func TestParser(t *testing.T) {
tests := []struct {
path string
steps []JSONStep
wantErr bool
}{
{
path: "$.store.bicycle.color",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "bicycle"},
{Type: ChildStep, Key: "color"},
},
},
{
path: "$..price",
steps: []JSONStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Key: "price"},
},
},
{
path: "$.store.book[*].title",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: -1}, // Wildcard
{Type: ChildStep, Key: "title"},
},
},
{
path: "$.store.book[0]",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: 0},
},
},
{
path: "invalid.path",
wantErr: true,
},
{
path: "$.store.book[abc]",
wantErr: true,
},
}
for _, tt := range tests {
t.Run(tt.path, func(t *testing.T) {
steps, err := ParseJSONPath(tt.path)
if (err != nil) != tt.wantErr {
t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
}
if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
}
})
}
}
func TestEvaluator(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
error bool
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
{
name: "wildcard_recursive",
path: "$..*",
expected: []JSONNode{
// These will be compared by value only, paths will be validated separately
{Value: testData["store"].(map[string]interface{})["book"]},
{Value: testData["store"].(map[string]interface{})["bicycle"]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
{Value: "The Fellowship of the Ring"},
{Value: 22.99},
{Value: "The Two Towers"},
{Value: 23.45},
{Value: "red"},
{Value: 199.95},
},
},
{
name: "invalid_index",
path: "$.store.book[5]",
expected: []JSONNode{},
error: true,
},
{
name: "nonexistent_property",
path: "$.store.nonexistent",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Use GetWithPaths directly
result, err := Get(testData, tt.path)
if err != nil {
if !tt.error {
t.Errorf("Get() returned error: %v", err)
}
return
}
// Special handling for wildcard recursive test
if tt.name == "wildcard_recursive" {
// Skip length check for wildcard recursive since it might vary
// Just verify that each expected item is in the results
// Validate values match and paths are filled in
for _, e := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, e.Value) {
found = true
break
}
}
if !found {
t.Errorf("Expected value %v not found in results", e.Value)
}
}
return
}
if len(result) != len(tt.expected) {
t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
}
// Validate both values and paths
for i, e := range tt.expected {
if i < len(result) {
if !reflect.DeepEqual(result[i].Value, e.Value) {
t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
}
if result[i].Path != e.Path {
t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
}
}
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("empty_data", func(t *testing.T) {
result, err := Get(nil, "$.a.b")
if err == nil {
t.Errorf("Expected error for empty data")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("empty_path", func(t *testing.T) {
_, err := ParseJSONPath("")
if err == nil {
t.Error("Expected error for empty path")
}
})
t.Run("numeric_keys", func(t *testing.T) {
data := map[string]interface{}{
"42": "answer",
}
result, err := Get(data, "$.42")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) == 0 || result[0].Value != "answer" {
t.Errorf("Expected 'answer', got %v", result)
}
})
}
func TestGetWithPaths(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(testData, tt.path)
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// First verify the value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Then verify the path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -2,137 +2,107 @@ package processor
import ( import (
"fmt" "fmt"
"log" "io"
"os" "net/http"
"path/filepath"
"strings" "strings"
"github.com/antchfx/xmlquery" logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua" lua "github.com/yuin/gopher-lua"
) )
// Processor defines the interface for all file processors // Maybe we make this an interface again for the shits and giggles
type Processor interface { // We will see, it could easily be...
// Process handles processing a file with the given pattern and Lua expression
// Now implemented as a base function in processor.go
// Process(filename string, pattern string, luaExpr string) (int, int, error)
// ProcessContent handles processing a string content directly with the given pattern and Lua expression
// Returns the modified content, modification count, match count, and any error
ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
// ToLua converts processor-specific data to Lua variables
ToLua(L *lua.LState, data interface{}) error
// FromLua retrieves modified data from Lua
FromLua(L *lua.LState) (interface{}, error)
}
// ModificationRecord tracks a single value modification
type ModificationRecord struct {
File string
OldValue string
NewValue string
Operation string
Context string
}
func NewLuaState() (*lua.LState, error) { func NewLuaState() (*lua.LState, error) {
L := lua.NewState() L := lua.NewState()
// defer L.Close() // defer L.Close()
// Load math library // Load math library
logger.Debug("Loading Lua math library")
L.Push(L.GetGlobal("require")) L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math")) L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil { if err := L.PCall(1, 1, nil); err != nil {
logger.Error("Failed to load Lua math library: %v", err)
return nil, fmt.Errorf("error loading Lua math library: %v", err) return nil, fmt.Errorf("error loading Lua math library: %v", err)
} }
// Initialize helper functions // Initialize helper functions
logger.Debug("Initializing Lua helper functions")
if err := InitLuaHelpers(L); err != nil { if err := InitLuaHelpers(L); err != nil {
logger.Error("Failed to initialize Lua helper functions: %v", err)
return nil, err return nil, err
} }
return L, nil return L, nil
} }
func Process(p Processor, filename string, pattern string, luaExpr string) (int, int, error) { // func Process(filename string, pattern string, luaExpr string) (int, int, error) {
// Read file content // logger.Debug("Processing file %q with pattern %q", filename, pattern)
cwd, err := os.Getwd() //
if err != nil { // // Read file content
return 0, 0, fmt.Errorf("error getting current working directory: %v", err) // cwd, err := os.Getwd()
} // if err != nil {
// logger.Error("Failed to get current working directory: %v", err)
fullPath := filepath.Join(cwd, filename) // return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
content, err := os.ReadFile(fullPath) // }
if err != nil { //
return 0, 0, fmt.Errorf("error reading file: %v", err) // fullPath := filepath.Join(cwd, filename)
} // logger.Trace("Reading file from: %s", fullPath)
//
fileContent := string(content) // stat, err := os.Stat(fullPath)
// if err != nil {
// Process the content // logger.Error("Failed to stat file %s: %v", fullPath, err)
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr) // return 0, 0, fmt.Errorf("error getting file info: %v", err)
if err != nil { // }
return 0, 0, err // logger.Debug("File size: %d bytes, modified: %s", stat.Size(), stat.ModTime().Format(time.RFC3339))
} //
// content, err := os.ReadFile(fullPath)
// If we made modifications, save the file // if err != nil {
if modCount > 0 { // logger.Error("Failed to read file %s: %v", fullPath, err)
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644) // return 0, 0, fmt.Errorf("error reading file: %v", err)
if err != nil { // }
return 0, 0, fmt.Errorf("error writing file: %v", err) //
} // fileContent := string(content)
} // logger.Trace("File read successfully: %d bytes, hash: %x", len(content), md5sum(content))
//
return modCount, matchCount, nil // // Detect and log file type
} // fileType := detectFileType(filename, fileContent)
// if fileType != "" {
// ToLua converts a struct or map to a Lua table recursively // logger.Debug("Detected file type: %s", fileType)
func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) { // }
switch v := data.(type) { //
case *xmlquery.Node: // // Process the content
luaTable := L.NewTable() // logger.Debug("Starting content processing")
luaTable.RawSetString("text", lua.LString(v.Data)) // modifiedContent, modCount, matchCount, err := ProcessContent(fileContent, pattern, luaExpr)
// Should be a map, simple key value pairs // if err != nil {
attr, err := ToLua(L, v.Attr) // logger.Error("Processing error: %v", err)
if err != nil { // return 0, 0, err
return nil, err // }
} //
luaTable.RawSetString("attr", attr) // logger.Debug("Processing results: %d matches, %d modifications", matchCount, modCount)
return luaTable, nil //
case map[string]interface{}: // // If we made modifications, save the file
luaTable := L.NewTable() // if modCount > 0 {
for key, value := range v { // // Calculate changes summary
luaValue, err := ToLua(L, value) // changePercent := float64(len(modifiedContent)) / float64(len(fileContent)) * 100
if err != nil { // logger.Info("File size change: %d → %d bytes (%.1f%%)",
return nil, err // len(fileContent), len(modifiedContent), changePercent)
} //
luaTable.RawSetString(key, luaValue) // logger.Debug("Writing modified content to %s", fullPath)
} // err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
return luaTable, nil // if err != nil {
case []interface{}: // logger.Error("Failed to write to file %s: %v", fullPath, err)
luaTable := L.NewTable() // return 0, 0, fmt.Errorf("error writing file: %v", err)
for i, value := range v { // }
luaValue, err := ToLua(L, value) // logger.Debug("File written successfully, new hash: %x", md5sum([]byte(modifiedContent)))
if err != nil { // } else if matchCount > 0 {
return nil, err // logger.Debug("No content modifications needed for %d matches", matchCount)
} // } else {
luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed // logger.Debug("No matches found in file")
} // }
return luaTable, nil //
case string: // return modCount, matchCount, nil
return lua.LString(v), nil // }
case bool:
return lua.LBool(v), nil
case float64:
return lua.LNumber(v), nil
case nil:
return lua.LNil, nil
default:
return nil, fmt.Errorf("unsupported data type: %T", data)
}
}
// FromLua converts a Lua table to a struct or map recursively // FromLua converts a Lua table to a struct or map recursively
func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) { func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
@@ -174,25 +144,28 @@ func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
} }
func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) { func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
logger.Trace("Checking if Lua table is an array")
L.SetGlobal("table_to_check", v) L.SetGlobal("table_to_check", v)
// Use our predefined helper function from InitLuaHelpers // Use our predefined helper function from InitLuaHelpers
err := L.DoString(`is_array = isArray(table_to_check)`) err := L.DoString(`is_array = isArray(table_to_check)`)
if err != nil { if err != nil {
logger.Error("Error determining if table is an array: %v", err)
return false, fmt.Errorf("error determining if table is array: %w", err) return false, fmt.Errorf("error determining if table is array: %w", err)
} }
// Check the result of our Lua function // Check the result of our Lua function
isArray := L.GetGlobal("is_array") isArray := L.GetGlobal("is_array")
// LVIsFalse returns true if a given LValue is a nil or false otherwise false. // LVIsFalse returns true if a given LValue is a nil or false otherwise false.
if !lua.LVIsFalse(isArray) { result := !lua.LVIsFalse(isArray)
return true, nil logger.Trace("Lua table is array: %v", result)
} return result, nil
return false, nil
} }
// InitLuaHelpers initializes common Lua helper functions // InitLuaHelpers initializes common Lua helper functions
func InitLuaHelpers(L *lua.LState) error { func InitLuaHelpers(L *lua.LState) error {
logger.Debug("Loading Lua helper functions")
helperScript := ` helperScript := `
-- Custom Lua helpers for math operations -- Custom Lua helpers for math operations
function min(a, b) return math.min(a, b) end function min(a, b) return math.min(a, b) end
@@ -205,6 +178,39 @@ function floor(x) return math.floor(x) end
function ceil(x) return math.ceil(x) end function ceil(x) return math.ceil(x) end
function upper(s) return string.upper(s) end function upper(s) return string.upper(s) end
function lower(s) return string.lower(s) end function lower(s) return string.lower(s) end
function format(s, ...) return string.format(s, ...) end
-- String split helper
function strsplit(inputstr, sep)
if sep == nil then
sep = "%s"
end
local t = {}
for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
table.insert(t, str)
end
return t
end
---@param table table
---@param depth number?
function DumpTable(table, depth)
if depth == nil then
depth = 0
end
if (depth > 200) then
print("Error: Depth > 200 in dumpTable()")
return
end
for k, v in pairs(table) do
if (type(v) == "table") then
print(string.rep(" ", depth) .. k .. ":")
DumpTable(v, depth + 1)
else
print(string.rep(" ", depth) .. k .. ": ", v)
end
end
end
-- String to number conversion helper -- String to number conversion helper
function num(str) function num(str)
@@ -238,15 +244,16 @@ end
modified = false modified = false
` `
if err := L.DoString(helperScript); err != nil { if err := L.DoString(helperScript); err != nil {
logger.Error("Failed to load Lua helper functions: %v", err)
return fmt.Errorf("error loading helper functions: %v", err) return fmt.Errorf("error loading helper functions: %v", err)
} }
logger.Debug("Setting up Lua print function to Go")
L.SetGlobal("print", L.NewFunction(printToGo)) L.SetGlobal("print", L.NewFunction(printToGo))
L.SetGlobal("fetch", L.NewFunction(fetch))
return nil return nil
} }
// Helper utility functions
// LimitString truncates a string to maxLen and adds "..." if truncated // LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string { func LimitString(s string, maxLen int) string {
s = strings.ReplaceAll(s, "\n", "\\n") s = strings.ReplaceAll(s, "\n", "\\n")
@@ -279,6 +286,8 @@ func PrependLuaAssignment(luaExpr string) string {
// BuildLuaScript prepares a Lua expression from shorthand notation // BuildLuaScript prepares a Lua expression from shorthand notation
func BuildLuaScript(luaExpr string) string { func BuildLuaScript(luaExpr string) string {
logger.Debug("Building Lua script from expression: %s", luaExpr)
luaExpr = PrependLuaAssignment(luaExpr) luaExpr = PrependLuaAssignment(luaExpr)
// This allows the user to specify whether or not they modified a value // This allows the user to specify whether or not they modified a value
@@ -299,31 +308,108 @@ func BuildLuaScript(luaExpr string) string {
} }
func printToGo(L *lua.LState) int { func printToGo(L *lua.LState) int {
// Get the number of arguments passed to the Lua print function top := L.GetTop()
n := L.GetTop()
// Create a slice to hold the arguments args := make([]interface{}, top)
args := make([]interface{}, n) for i := 1; i <= top; i++ {
for i := 1; i <= n; i++ { args[i-1] = L.Get(i)
args[i-1] = L.Get(i) // Get the argument from Lua stack
}
// Print the arguments to Go's stdout
log.Print("Lua: ")
log.Println(args...)
return 0 // No return values
} }
// Max returns the maximum of two integers // Format the message with proper spacing between arguments
func Max(a, b int) int { var parts []string
if a > b { for _, arg := range args {
return a parts = append(parts, fmt.Sprintf("%v", arg))
} }
return b message := strings.Join(parts, " ")
// Use the LUA log level with a script tag
logger.Lua("%s", message)
return 0
} }
// Min returns the minimum of two integers func fetch(L *lua.LState) int {
func Min(a, b int) int { // Get URL from first argument
if a < b { url := L.ToString(1)
return a if url == "" {
L.Push(lua.LNil)
L.Push(lua.LString("URL is required"))
return 2
} }
return b
// Get options from second argument if provided
var method string = "GET"
var headers map[string]string = make(map[string]string)
var body string = ""
if L.GetTop() > 1 {
options := L.ToTable(2)
if options != nil {
// Get method
if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
method = methodVal.String()
}
// Get headers
if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
if headersTable, ok := headersVal.(*lua.LTable); ok {
headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
headers[key.String()] = value.String()
})
}
}
// Get body
if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
body = bodyVal.String()
}
}
}
// Create HTTP request
req, err := http.NewRequest(method, url, strings.NewReader(body))
if err != nil {
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
return 2
}
// Set headers
for key, value := range headers {
req.Header.Set(key, value)
}
// Make request
client := &http.Client{}
resp, err := client.Do(req)
if err != nil {
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
return 2
}
defer resp.Body.Close()
// Read response body
bodyBytes, err := io.ReadAll(resp.Body)
if err != nil {
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
return 2
}
// Create response table
responseTable := L.NewTable()
responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
responseTable.RawSetString("statusText", lua.LString(resp.Status))
responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
// Set headers in response
headersTable := L.NewTable()
for key, values := range resp.Header {
headersTable.RawSetString(key, lua.LString(values[0]))
}
responseTable.RawSetString("headers", headersTable)
L.Push(responseTable)
return 1
} }

View File

@@ -1,83 +1,273 @@
package processor package processor
import ( import (
"cook/utils"
"fmt" "fmt"
"log"
"regexp" "regexp"
"strconv" "strconv"
"strings" "strings"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua" lua "github.com/yuin/gopher-lua"
) )
// RegexProcessor implements the Processor interface using regex patterns type CaptureGroup struct {
type RegexProcessor struct{}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
captures, ok := data.([]string)
if !ok {
return fmt.Errorf("expected []string for captures, got %T", data)
}
// Set variables for each capture group, starting from v1/s1 for the first capture
for i := 0; i < len(captures); i++ {
// Set string version (always available as s1, s2, etc.)
L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
// Try to convert to number and set v1, v2, etc.
if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
}
}
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Get the modified values after Lua execution
modifications := make(map[int]string)
// Check for modifications to v1-v12 and s1-s12
for i := 0; i < 12; i++ {
// Check both v and s variables to see if any were modified
vVarName := fmt.Sprintf("v%d", i+1)
sVarName := fmt.Sprintf("s%d", i+1)
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
// If our value is a number then it's very likely we want it to be a number
// And not a string
// If we do want it to be a string we will cast it into a string in lua
// wait that wouldn't work... Casting v to a string would not load it here
if vLuaVal.Type() == lua.LTNumber {
modifications[i] = vLuaVal.String()
continue
}
if sLuaVal.Type() == lua.LTString {
modifications[i] = sLuaVal.String()
continue
}
}
return modifications, nil
}
type NamedCapture struct {
Name string Name string
Value string Value string
Updated string
Range [2]int Range [2]int
} }
// ProcessContent applies regex replacement with Lua processing // ProcessContent applies regex replacement with Lua processing
func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) { // The filename here exists ONLY so we can pass it to the lua environment
// Handle special pattern modifications // It's not used for anything else
if !strings.HasPrefix(pattern, "(?s)") { func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
pattern = "(?s)" + pattern var commands []utils.ReplaceCommand
log.Printf("Pattern modified to include (?s): %s", pattern) logger.Trace("Processing regex: %q", command.Regex)
// Start timing the regex processing
startTime := time.Now()
// We don't HAVE to do this multiple times for a pattern
// But it's quick enough for us to not care
pattern := resolveRegexPlaceholders(command.Regex)
// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
// But it's a compromise that allows us to use | in yaml
// Otherwise we would have to escape every god damn pair of quotation marks
// And a bunch of other shit
pattern = strings.TrimSpace(pattern)
logger.Debug("Compiling regex pattern: %s", pattern)
patternCompileStart := time.Now()
compiledPattern, err := regexp.Compile(pattern)
if err != nil {
logger.Error("Error compiling pattern: %v", err)
return commands, fmt.Errorf("error compiling pattern: %v", err)
}
logger.Debug("Compiled pattern successfully in %v: %s", time.Since(patternCompileStart), pattern)
// Same here, it's just string concatenation, it won't kill us
// More important is that we don't fuck up the command
// But we shouldn't be able to since it's passed by value
previous := command.Lua
luaExpr := BuildLuaScript(command.Lua)
logger.Debug("Transformed Lua expression: %q → %q", previous, luaExpr)
// Process all regex matches
matchFindStart := time.Now()
indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
matchFindDuration := time.Since(matchFindStart)
logger.Debug("Found %d matches in content of length %d (search took %v)",
len(indices), len(content), matchFindDuration)
// Log pattern complexity metrics
patternComplexity := estimatePatternComplexity(pattern)
logger.Debug("Pattern complexity estimate: %d", patternComplexity)
if len(indices) == 0 {
logger.Warning("No matches found for regex: %q", pattern)
logger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
// We walk backwards because we're replacing something with something else that might be longer
// And in the case it is longer than the original all indicces past that change will be fucked up
// By going backwards we fuck up all the indices to the end of the file that we don't care about
// Because there either aren't any (last match) or they're already modified (subsequent matches)
for i, matchIndices := range indices {
logger.Debug("Processing match %d of %d", i+1, len(indices))
logger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
L, err := NewLuaState()
if err != nil {
logger.Error("Error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
}
L.SetGlobal("file", lua.LString(filename))
// Hmm... Maybe we don't want to defer this..
// Maybe we want to close them every iteration
// We'll leave it as is for now
defer L.Close()
logger.Trace("Lua state created successfully for match %d", i+1)
// Why we're doing this whole song and dance of indices is to properly handle empty matches
// Plus it's a little cleaner to surgically replace our matches
// If we were to use string.replace and encountered an empty match there'd be nothing to replace
// But using indices an empty match would have its starting and ending indices be the same
// So when we're cutting open the array we say 0:7 + modified + 7:end
// As if concatenating in the middle of the array
// Plus it supports lookarounds
match := content[matchIndices[0]:matchIndices[1]]
matchPreview := match
if len(match) > 50 {
matchPreview = match[:47] + "..."
}
logger.Trace("Matched content: %q (length: %d)", matchPreview, len(match))
groups := matchIndices[2:]
if len(groups) <= 0 {
logger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
continue
}
if len(groups)%2 == 1 {
logger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
continue
}
// Count how many valid groups we have
validGroups := 0
for j := 0; j < len(groups); j += 2 {
if groups[j] != -1 && groups[j+1] != -1 {
validGroups++
}
}
logger.Debug("Found %d valid capture groups in match", validGroups)
for _, index := range groups {
if index == -1 {
logger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
continue
}
}
// We have to use array to preserve order
// Very important for the reconstruction step
// Because we must overwrite the values in reverse order
// See comments a few dozen lines above for more details
captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
groupNames := compiledPattern.SubexpNames()[1:]
for i, name := range groupNames {
start := groups[i*2]
end := groups[i*2+1]
if start == -1 || end == -1 {
continue
}
value := content[start:end]
captureGroups = append(captureGroups, &CaptureGroup{
Name: name,
Value: value,
Range: [2]int{start, end},
})
// Include name info in log if available
if name != "" {
logger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
} else {
logger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
}
}
// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
if !command.NoDedup {
logger.Debug("Deduplicating capture groups as specified in command settings")
captureGroups = deduplicateGroups(captureGroups)
}
if err := toLua(L, captureGroups); err != nil {
logger.Error("Failed to set Lua variables: %v", err)
continue
}
logger.Trace("Set %d capture groups as Lua variables", len(captureGroups))
if err := L.DoString(luaExpr); err != nil {
logger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
err, luaExpr, captureGroups)
continue
}
logger.Trace("Lua script executed successfully")
// Get modifications from Lua
captureGroups, err = fromLua(L, captureGroups)
if err != nil {
logger.Error("Failed to retrieve modifications from Lua: %v", err)
continue
}
logger.Trace("Retrieved updated values from Lua")
replacement := ""
replacementVar := L.GetGlobal("replacement")
if replacementVar.Type() != lua.LTNil {
replacement = replacementVar.String()
logger.Debug("Using global replacement: %q", replacement)
}
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
logger.Debug("Skipping match - no modifications made by Lua script")
continue
}
if replacement == "" {
// Apply the modifications to the original match
replacement = match
// Count groups that were actually modified
modifiedGroups := 0
for _, capture := range captureGroups {
if capture.Value != capture.Updated {
modifiedGroups++
}
}
logger.Info("%d of %d capture groups identified for modification", modifiedGroups, len(captureGroups))
for _, capture := range captureGroups {
if capture.Value == capture.Updated {
logger.Info("Capture group unchanged: %s", LimitString(capture.Value, 50))
continue
}
// Log what changed with context
logger.Debug("Capture group %s scheduled for modification: %q → %q",
capture.Name, capture.Value, capture.Updated)
// Indices of the group are relative to content
// To relate them to match we have to subtract the match start index
// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
commands = append(commands, utils.ReplaceCommand{
From: capture.Range[0],
To: capture.Range[1],
With: capture.Updated,
})
}
} else {
commands = append(commands, utils.ReplaceCommand{
From: matchIndices[0],
To: matchIndices[1],
With: replacement,
})
}
}
logger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
deduplicatedGroups := make([]*CaptureGroup, 0)
for _, group := range captureGroups {
overlaps := false
logger.Debug("Checking capture group: %s with range %v", group.Name, group.Range)
for _, existingGroup := range deduplicatedGroups {
logger.Debug("Comparing with existing group: %s with range %v", existingGroup.Name, existingGroup.Range)
if group.Range[0] < existingGroup.Range[1] && group.Range[1] > existingGroup.Range[0] {
overlaps = true
logger.Warning("Detected overlap between capture group '%s' and existing group '%s' in range %v-%v and %v-%v", group.Name, existingGroup.Name, group.Range[0], group.Range[1], existingGroup.Range[0], existingGroup.Range[1])
break
}
}
if overlaps {
// We CAN just continue despite this fuckup
logger.Warning("Overlapping capture group: %s", group.Name)
continue
}
logger.Debug("No overlap detected for capture group: %s. Adding to deduplicated groups.", group.Name)
deduplicatedGroups = append(deduplicatedGroups, group)
}
return deduplicatedGroups
} }
// The order of these replaces is important // The order of these replaces is important
@@ -85,16 +275,22 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
// If it were not here our !num in a named capture group would // If it were not here our !num in a named capture group would
// Expand to another capture group in the capture group // Expand to another capture group in the capture group
// We really only want one (our named) capture group // We really only want one (our named) capture group
func resolveRegexPlaceholders(pattern string) string {
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
}
namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`) namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string { pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
parts := namedGroupNum.FindStringSubmatch(match) parts := namedGroupNum.FindStringSubmatch(match)
if len(parts) != 3 { if len(parts) != 3 {
return match return match
} }
replacement := `\d*\.?\d+` replacement := `-?\d*\.?\d+`
return parts[1] + replacement return parts[1] + replacement
}) })
pattern = strings.ReplaceAll(pattern, "!num", `"?(\d*\.?\d+)"?`) pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
pattern = strings.ReplaceAll(pattern, "!any", `.*?`) pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`) repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
// !rep(pattern, count) repeats the pattern n times // !rep(pattern, count) repeats the pattern n times
@@ -109,174 +305,87 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
repetitions, _ := strconv.Atoi(count) repetitions, _ := strconv.Atoi(count)
return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
}) })
return pattern
compiledPattern, err := regexp.Compile(pattern)
if err != nil {
log.Printf("Error compiling pattern: %v", err)
return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
}
log.Printf("Compiled pattern successfully: %s", pattern)
previous := luaExpr
luaExpr = BuildLuaScript(luaExpr)
log.Printf("Changing Lua expression from: %s to: %s", previous, luaExpr)
// Initialize Lua environment
modificationCount := 0
// Process all regex matches
result := content
indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
log.Printf("Found %d matches in the content", len(indices))
// We walk backwards because we're replacing something with something else that might be longer
// And in the case it is longer than the original all indicces past that change will be fucked up
// By going backwards we fuck up all the indices to the end of the file that we don't care about
// Because there either aren't any (last match) or they're already modified (subsequent matches)
for i := len(indices) - 1; i >= 0; i-- {
L, err := NewLuaState()
if err != nil {
log.Printf("Error creating Lua state: %v", err)
return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
}
// Hmm... Maybe we don't want to defer this..
// Maybe we want to close them every iteration
// We'll leave it as is for now
defer L.Close()
log.Printf("Lua state created successfully")
matchIndices := indices[i]
log.Printf("Processing match indices: %v", matchIndices)
// Why we're doing this whole song and dance of indices is to properly handle empty matches
// Plus it's a little cleaner to surgically replace our matches
// If we were to use string.replace and encountered an empty match there'd be nothing to replace
// But using indices an empty match would have its starting and ending indices be the same
// So when we're cutting open the array we say 0:7 + modified + 7:end
// As if concatenating in the middle of the array
// Plus it supports lookarounds
match := content[matchIndices[0]:matchIndices[1]]
log.Printf("Matched content: %s", match)
groups := matchIndices[2:]
if len(groups) <= 0 {
log.Println("No capture groups for lua to chew on")
continue
}
if len(groups)%2 == 1 {
log.Println("Odd number of indices of groups, what the fuck?")
continue
}
for _, index := range groups {
if index == -1 {
// return "", 0, 0, fmt.Errorf("negative indices encountered: %v. This indicates that there was an issue with the match indices, possibly due to an empty match or an unexpected pattern. Please check the regex pattern and input content.", matchIndices)
log.Printf("Negative indices encountered: %v. This indicates that there was an issue with the match indices, possibly due to an empty match or an unexpected pattern. This is not an error but it's possibly not what you want.", matchIndices)
continue
}
} }
captures := make([]string, 0, len(groups)/2) // ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
for j := 0; j < len(groups); j += 2 { func toLua(L *lua.LState, data interface{}) error {
if groups[j] == -1 || groups[j+1] == -1 { captureGroups, ok := data.([]*CaptureGroup)
continue if !ok {
} return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
captures = append(captures, content[groups[j]:groups[j+1]])
}
log.Printf("Captured groups: %v", captures)
// We have to use array to preserve order
// Very important for the reconstruction step
// Because we must overwrite the values in reverse order
// See comments a few dozen lines above for more details
namedCaptures := make([]NamedCapture, 0, len(groups)/2)
groupNames := compiledPattern.SubexpNames()[1:]
for i, name := range groupNames {
if name == "" {
continue
}
if groups[i*2] == -1 || groups[i*2+1] == -1 {
continue
}
namedCaptures = append(namedCaptures, NamedCapture{
Name: name,
Value: captures[i],
Range: [2]int{groups[i*2], groups[i*2+1]},
})
} }
log.Printf("Named captures: %v", namedCaptures) groupindex := 0
for _, capture := range captureGroups {
if err := p.ToLua(L, captures); err != nil {
log.Printf("Error setting Lua variables: %v", err)
continue
}
log.Println("Lua variables set successfully")
for _, capture := range namedCaptures {
if capture.Name == "" { if capture.Name == "" {
continue // We don't want to change the name of the capture group
// Even if it's empty
tempName := fmt.Sprintf("%d", groupindex+1)
groupindex++
L.SetGlobal("s"+tempName, lua.LString(capture.Value))
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal("v"+tempName, lua.LNumber(val))
} }
if val, err := strconv.ParseFloat(capture.Value, 64); err == nil { } else {
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal(capture.Name, lua.LNumber(val)) L.SetGlobal(capture.Name, lua.LNumber(val))
} else { } else {
L.SetGlobal(capture.Name, lua.LString(capture.Value)) L.SetGlobal(capture.Name, lua.LString(capture.Value))
} }
} }
if err := L.DoString(luaExpr); err != nil {
log.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
continue
}
log.Println("Lua code executed successfully")
// Get modifications from Lua
modResult, err := p.FromLua(L)
if err != nil {
log.Printf("Error getting modifications: %v", err)
continue
} }
// Apply modifications to the matched text return nil
modsMap, ok := modResult.(map[int]string)
if !ok || len(modsMap) == 0 {
log.Println("No modifications to apply")
continue
} }
replacement := "" // FromLua implements the Processor interface for RegexProcessor
replacementVar := L.GetGlobal("replacement") func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
if replacementVar.Type() != lua.LTNil { captureIndex := 0
replacement = replacementVar.String() for _, capture := range captureGroups {
}
if replacement == "" {
// Apply the modifications to the original match
replacement = match
for i := len(modsMap) - 1; i >= 0; i-- {
newVal := modsMap[i]
log.Printf("Applying modification: %s", newVal)
// Indices of the group are relative to content
// To relate them to match we have to subtract the match start index
groupStart := groups[i*2] - matchIndices[0]
groupEnd := groups[i*2+1] - matchIndices[0]
replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
}
for i := len(namedCaptures) - 1; i >= 0; i-- {
capture := namedCaptures[i]
if capture.Name == "" { if capture.Name == "" {
continue capture.Name = fmt.Sprintf("%d", captureIndex+1)
vVarName := fmt.Sprintf("v%s", capture.Name)
sVarName := fmt.Sprintf("s%s", capture.Name)
captureIndex++
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
if sLuaVal.Type() == lua.LTString {
capture.Updated = sLuaVal.String()
} }
groupStart := capture.Range[0] - matchIndices[0] // Numbers have priority
groupEnd := capture.Range[1] - matchIndices[0] if vLuaVal.Type() == lua.LTNumber {
luaValue := L.GetGlobal(capture.Name).String() capture.Updated = vLuaVal.String()
replacement = replacement[:groupStart] + luaValue + replacement[groupEnd:]
} }
} else {
// Easy shit
capture.Updated = L.GetGlobal(capture.Name).String()
} }
modificationCount++
result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
log.Printf("Modification count updated: %d", modificationCount)
} }
log.Printf("Process completed with %d modifications", modificationCount) return captureGroups, nil
return result, modificationCount, len(indices), nil }
// estimatePatternComplexity gives a rough estimate of regex pattern complexity
// This can help identify potentially problematic patterns
func estimatePatternComplexity(pattern string) int {
complexity := len(pattern)
// Add complexity for potentially expensive operations
complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
complexity += strings.Count(pattern, "[^") * 3 // Negated character class
complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
complexity += strings.Count(pattern, "(") * 2 // Capture groups
complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
complexity += strings.Count(pattern, "{") * 2 // Counted repetition
return complexity
} }

File diff suppressed because it is too large Load Diff

27
processor/test_helper.go Normal file
View File

@@ -0,0 +1,27 @@
package processor
import (
"io"
"os"
logger "git.site.quack-lab.dev/dave/cylogger"
)
func init() {
// Only modify logger in test mode
// This checks if we're running under 'go test'
if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
// Initialize logger with ERROR level for tests
// to minimize noise in test output
logger.Init(logger.LevelError)
// Optionally redirect logger output to discard
// This prevents logger output from interfering with test output
disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
if disableTestLogs {
// Create a new logger that writes to nowhere
silentLogger := logger.New(io.Discard, "", 0)
logger.Default = silentLogger
}
}
}

View File

@@ -1,412 +0,0 @@
package processor
import (
"fmt"
"log"
"modify/processor/xpath"
"strings"
"github.com/antchfx/xmlquery"
lua "github.com/yuin/gopher-lua"
)
// XMLProcessor implements the Processor interface for XML documents
type XMLProcessor struct{}
// ProcessContent implements the Processor interface for XMLProcessor
func (p *XMLProcessor) ProcessContent(content string, path string, luaExpr string) (string, int, int, error) {
// Parse XML document
// We can't really use encoding/xml here because it requires a pre defined struct
// And we HAVE TO parse dynamic unknown XML
doc, err := xmlquery.Parse(strings.NewReader(content))
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
}
// Find nodes matching the XPath pattern
nodes, err := xpath.Get(doc, path)
if err != nil {
return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
// Apply modifications to each node
modCount := 0
for _, node := range nodes {
L, err := NewLuaState()
if err != nil {
return content, 0, 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
err = p.ToLua(L, node)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
}
err = L.DoString(BuildLuaScript(luaExpr))
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
}
result, err := p.FromLua(L)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
}
log.Printf("%#v", result)
modified := false
modified = L.GetGlobal("modified").String() == "true"
if !modified {
log.Printf("No changes made to node at path: %s", node.Data)
continue
}
// Apply modification based on the result
if updatedValue, ok := result.(string); ok {
// If the result is a simple string, update the node value directly
xpath.Set(doc, path, updatedValue)
} else if nodeData, ok := result.(map[string]interface{}); ok {
// If the result is a map, apply more complex updates
updateNodeFromMap(node, nodeData)
}
modCount++
}
// Serialize the modified XML document to string
if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
// If we have an XML declaration, start with it
declaration := doc.FirstChild.OutputXML(true)
// Remove the firstChild (declaration) before serializing the rest of the document
doc.FirstChild = doc.FirstChild.NextSibling
return ConvertToNamedEntities(declaration + doc.OutputXML(true)), modCount, matchCount, nil
}
// Convert numeric entities to named entities for better readability
return ConvertToNamedEntities(doc.OutputXML(true)), modCount, matchCount, nil
}
func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
table, err := p.ToLuaTable(L, data)
if err != nil {
return err
}
L.SetGlobal("v", table)
return nil
}
// ToLua converts XML node values to Lua variables
func (p *XMLProcessor) ToLuaTable(L *lua.LState, data interface{}) (lua.LValue, error) {
// Check if data is an xmlquery.Node
node, ok := data.(*xmlquery.Node)
if !ok {
return nil, fmt.Errorf("expected xmlquery.Node, got %T", data)
}
// Create a simple table with essential data
table := L.NewTable()
// For element nodes, just provide basic info
L.SetField(table, "type", lua.LString(nodeTypeToString(node.Type)))
L.SetField(table, "name", lua.LString(node.Data))
L.SetField(table, "value", lua.LString(node.InnerText()))
// Add children if any
children := L.NewTable()
for child := node.FirstChild; child != nil; child = child.NextSibling {
childTable, err := p.ToLuaTable(L, child)
if err == nil {
children.Append(childTable)
}
}
L.SetField(table, "children", children)
attrs := L.NewTable()
if len(node.Attr) > 0 {
for _, attr := range node.Attr {
L.SetField(attrs, attr.Name.Local, lua.LString(attr.Value))
}
}
L.SetField(table, "attr", attrs)
return table, nil
}
// FromLua gets modified values from Lua
func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
luaValue := L.GetGlobal("v")
// Handle string values directly
if luaValue.Type() == lua.LTString {
return luaValue.String(), nil
}
// Handle tables (for attributes and more complex updates)
if luaValue.Type() == lua.LTTable {
return luaTableToMap(L, luaValue.(*lua.LTable)), nil
}
return luaValue.String(), nil
}
// Simple helper to convert a Lua table to a Go map
func luaTableToMap(L *lua.LState, table *lua.LTable) map[string]interface{} {
result := make(map[string]interface{})
table.ForEach(func(k, v lua.LValue) {
if k.Type() == lua.LTString {
key := k.String()
if v.Type() == lua.LTTable {
result[key] = luaTableToMap(L, v.(*lua.LTable))
} else {
result[key] = v.String()
}
}
})
return result
}
// Simple helper to convert node type to string
func nodeTypeToString(nodeType xmlquery.NodeType) string {
switch nodeType {
case xmlquery.ElementNode:
return "element"
case xmlquery.TextNode:
return "text"
case xmlquery.AttributeNode:
return "attribute"
default:
return "other"
}
}
// Helper function to update an XML node from a map
func updateNodeFromMap(node *xmlquery.Node, data map[string]interface{}) {
// Update node value if present
if value, ok := data["value"]; ok {
if strValue, ok := value.(string); ok {
// For element nodes, replace text content
if node.Type == xmlquery.ElementNode {
// Find the first text child if it exists
var textNode *xmlquery.Node
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type == xmlquery.TextNode {
textNode = child
break
}
}
if textNode != nil {
// Update existing text node
textNode.Data = strValue
} else {
// Create new text node
newText := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: strValue,
Parent: node,
}
// Insert at beginning of children
if node.FirstChild != nil {
newText.NextSibling = node.FirstChild
node.FirstChild.PrevSibling = newText
node.FirstChild = newText
} else {
node.FirstChild = newText
node.LastChild = newText
}
}
} else if node.Type == xmlquery.TextNode {
// Directly update text node
node.Data = strValue
} else if node.Type == xmlquery.AttributeNode {
// Update attribute value
if node.Parent != nil {
for i, attr := range node.Parent.Attr {
if attr.Name.Local == node.Data {
node.Parent.Attr[i].Value = strValue
break
}
}
}
}
}
}
// Update attributes if present
if attrs, ok := data["attr"].(map[string]interface{}); ok && node.Type == xmlquery.ElementNode {
for name, value := range attrs {
if strValue, ok := value.(string); ok {
// Look for existing attribute
found := false
for i, attr := range node.Attr {
if attr.Name.Local == name {
node.Attr[i].Value = strValue
found = true
break
}
}
// Add new attribute if not found
if !found {
node.Attr = append(node.Attr, xmlquery.Attr{
Name: struct {
Space, Local string
}{Local: name},
Value: strValue,
})
}
}
}
}
}
// Helper function to get a string representation of node type
func nodeTypeName(nodeType xmlquery.NodeType) string {
switch nodeType {
case xmlquery.ElementNode:
return "element"
case xmlquery.TextNode:
return "text"
case xmlquery.AttributeNode:
return "attribute"
case xmlquery.CommentNode:
return "comment"
case xmlquery.DeclarationNode:
return "declaration"
default:
return "unknown"
}
}
// ConvertToNamedEntities replaces numeric XML entities with their named counterparts
func ConvertToNamedEntities(xml string) string {
// Basic XML entities
replacements := map[string]string{
// Basic XML entities
"&#34;": "&quot;", // double quote
"&#39;": "&apos;", // single quote
"&#60;": "&lt;", // less than
"&#62;": "&gt;", // greater than
"&#38;": "&amp;", // ampersand
// Common symbols
"&#160;": "&nbsp;", // non-breaking space
"&#169;": "&copy;", // copyright
"&#174;": "&reg;", // registered trademark
"&#8364;": "&euro;", // euro
"&#163;": "&pound;", // pound
"&#165;": "&yen;", // yen
"&#162;": "&cent;", // cent
"&#167;": "&sect;", // section
"&#8482;": "&trade;", // trademark
"&#9824;": "&spades;", // spade
"&#9827;": "&clubs;", // club
"&#9829;": "&hearts;", // heart
"&#9830;": "&diams;", // diamond
// Special characters
"&#161;": "&iexcl;", // inverted exclamation
"&#191;": "&iquest;", // inverted question
"&#171;": "&laquo;", // left angle quotes
"&#187;": "&raquo;", // right angle quotes
"&#183;": "&middot;", // middle dot
"&#8226;": "&bull;", // bullet
"&#8230;": "&hellip;", // horizontal ellipsis
"&#8242;": "&prime;", // prime
"&#8243;": "&Prime;", // double prime
"&#8254;": "&oline;", // overline
"&#8260;": "&frasl;", // fraction slash
// Math symbols
"&#177;": "&plusmn;", // plus-minus
"&#215;": "&times;", // multiplication
"&#247;": "&divide;", // division
"&#8734;": "&infin;", // infinity
"&#8776;": "&asymp;", // almost equal
"&#8800;": "&ne;", // not equal
"&#8804;": "&le;", // less than or equal
"&#8805;": "&ge;", // greater than or equal
"&#8721;": "&sum;", // summation
"&#8730;": "&radic;", // square root
"&#8747;": "&int;", // integral
// Accented characters
"&#192;": "&Agrave;", // A grave
"&#193;": "&Aacute;", // A acute
"&#194;": "&Acirc;", // A circumflex
"&#195;": "&Atilde;", // A tilde
"&#196;": "&Auml;", // A umlaut
"&#197;": "&Aring;", // A ring
"&#198;": "&AElig;", // AE ligature
"&#199;": "&Ccedil;", // C cedilla
"&#200;": "&Egrave;", // E grave
"&#201;": "&Eacute;", // E acute
"&#202;": "&Ecirc;", // E circumflex
"&#203;": "&Euml;", // E umlaut
"&#204;": "&Igrave;", // I grave
"&#205;": "&Iacute;", // I acute
"&#206;": "&Icirc;", // I circumflex
"&#207;": "&Iuml;", // I umlaut
"&#208;": "&ETH;", // Eth
"&#209;": "&Ntilde;", // N tilde
"&#210;": "&Ograve;", // O grave
"&#211;": "&Oacute;", // O acute
"&#212;": "&Ocirc;", // O circumflex
"&#213;": "&Otilde;", // O tilde
"&#214;": "&Ouml;", // O umlaut
"&#216;": "&Oslash;", // O slash
"&#217;": "&Ugrave;", // U grave
"&#218;": "&Uacute;", // U acute
"&#219;": "&Ucirc;", // U circumflex
"&#220;": "&Uuml;", // U umlaut
"&#221;": "&Yacute;", // Y acute
"&#222;": "&THORN;", // Thorn
"&#223;": "&szlig;", // Sharp s
"&#224;": "&agrave;", // a grave
"&#225;": "&aacute;", // a acute
"&#226;": "&acirc;", // a circumflex
"&#227;": "&atilde;", // a tilde
"&#228;": "&auml;", // a umlaut
"&#229;": "&aring;", // a ring
"&#230;": "&aelig;", // ae ligature
"&#231;": "&ccedil;", // c cedilla
"&#232;": "&egrave;", // e grave
"&#233;": "&eacute;", // e acute
"&#234;": "&ecirc;", // e circumflex
"&#235;": "&euml;", // e umlaut
"&#236;": "&igrave;", // i grave
"&#237;": "&iacute;", // i acute
"&#238;": "&icirc;", // i circumflex
"&#239;": "&iuml;", // i umlaut
"&#240;": "&eth;", // eth
"&#241;": "&ntilde;", // n tilde
"&#242;": "&ograve;", // o grave
"&#243;": "&oacute;", // o acute
"&#244;": "&ocirc;", // o circumflex
"&#245;": "&otilde;", // o tilde
"&#246;": "&ouml;", // o umlaut
"&#248;": "&oslash;", // o slash
"&#249;": "&ugrave;", // u grave
"&#250;": "&uacute;", // u acute
"&#251;": "&ucirc;", // u circumflex
"&#252;": "&uuml;", // u umlaut
"&#253;": "&yacute;", // y acute
"&#254;": "&thorn;", // thorn
"&#255;": "&yuml;", // y umlaut
}
result := xml
for numeric, named := range replacements {
result = strings.ReplaceAll(result, numeric, named)
}
return result
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,4 +0,0 @@
// The package is now using github.com/antchfx/xmlquery for XPath parsing.
// The parsing functionality tests have been removed since we're now
// delegating XPath parsing to the xmlquery library.
package xpath

View File

@@ -1,4 +0,0 @@
// The package is now using github.com/antchfx/xmlquery for XPath parsing.
// The parsing functionality tests have been removed since we're now
// delegating XPath parsing to the xmlquery library.
package xpath

View File

@@ -1,133 +0,0 @@
package xpath
import (
"errors"
"fmt"
"github.com/antchfx/xmlquery"
)
// Get retrieves nodes from XML data using an XPath expression
func Get(node *xmlquery.Node, path string) ([]*xmlquery.Node, error) {
if node == nil {
return nil, errors.New("nil node provided")
}
// Execute xpath query directly
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return nil, fmt.Errorf("failed to execute XPath query: %v", err)
}
return nodes, nil
}
// Set updates a single node in the XML data using an XPath expression
func Set(node *xmlquery.Node, path string, value interface{}) error {
if node == nil {
return errors.New("nil node provided")
}
// Find the node to update
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return fmt.Errorf("failed to execute XPath query: %v", err)
}
if len(nodes) == 0 {
return fmt.Errorf("no nodes found for path: %s", path)
}
// Update the first matching node
updateNodeValue(nodes[0], value)
return nil
}
// SetAll updates all nodes that match the XPath expression
func SetAll(node *xmlquery.Node, path string, value interface{}) error {
if node == nil {
return errors.New("nil node provided")
}
// Find all nodes to update
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return fmt.Errorf("failed to execute XPath query: %v", err)
}
if len(nodes) == 0 {
return fmt.Errorf("no nodes found for path: %s", path)
}
// Update all matching nodes
for _, matchNode := range nodes {
updateNodeValue(matchNode, value)
}
return nil
}
// Helper function to update a node's value
func updateNodeValue(node *xmlquery.Node, value interface{}) {
strValue := fmt.Sprintf("%v", value)
// Handle different node types
switch node.Type {
case xmlquery.AttributeNode:
// For attribute nodes, update the attribute value
parent := node.Parent
if parent != nil {
for i, attr := range parent.Attr {
if attr.Name.Local == node.Data {
parent.Attr[i].Value = strValue
break
}
}
}
case xmlquery.TextNode:
// For text nodes, update the text content
node.Data = strValue
case xmlquery.ElementNode:
// For element nodes, clear existing text children and add a new text node
// First, remove all existing text children
var nonTextChildren []*xmlquery.Node
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type != xmlquery.TextNode {
nonTextChildren = append(nonTextChildren, child)
}
}
// Clear all children
node.FirstChild = nil
node.LastChild = nil
// Add a new text node
textNode := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: strValue,
Parent: node,
}
// Set the text node as the first child
node.FirstChild = textNode
node.LastChild = textNode
// Add back non-text children
for _, child := range nonTextChildren {
child.Parent = node
// If this is the first child being added back
if node.FirstChild == textNode && node.LastChild == textNode {
node.FirstChild.NextSibling = child
child.PrevSibling = node.FirstChild
node.LastChild = child
} else {
// Add to the end of the chain
node.LastChild.NextSibling = child
child.PrevSibling = node.LastChild
node.LastChild = child
}
}
}
}

View File

@@ -1,474 +0,0 @@
package xpath
import (
"strings"
"testing"
"github.com/antchfx/xmlquery"
)
// Parse test XML data once at the beginning for use in multiple tests
func parseTestXML(t *testing.T, xmlData string) *xmlquery.Node {
doc, err := xmlquery.Parse(strings.NewReader(xmlData))
if err != nil {
t.Fatalf("Failed to parse test XML: %v", err)
}
return doc
}
// XML test data as a string for our tests
var testXML = `
<store>
<book category="fiction">
<title lang="en">The Fellowship of the Ring</title>
<author>J.R.R. Tolkien</author>
<year>1954</year>
<price>22.99</price>
</book>
<book category="fiction">
<title lang="en">The Two Towers</title>
<author>J.R.R. Tolkien</author>
<year>1954</year>
<price>23.45</price>
</book>
<book category="technical">
<title lang="en">Learning XML</title>
<author>Erik T. Ray</author>
<year>2003</year>
<price>39.95</price>
</book>
<bicycle>
<color>red</color>
<price>199.95</price>
</bicycle>
</store>
`
func TestEvaluator(t *testing.T) {
// Parse the test XML data once for all test cases
doc := parseTestXML(t, testXML)
tests := []struct {
name string
path string
error bool
}{
{
name: "simple_element_access",
path: "/store/bicycle/color",
},
{
name: "recursive_element_access",
path: "//price",
},
{
name: "wildcard_element_access",
path: "/store/book/*",
},
{
name: "attribute_exists_predicate",
path: "//title[@lang]",
},
{
name: "attribute_equals_predicate",
path: "//title[@lang='en']",
},
{
name: "value_comparison_predicate",
path: "/store/book[price>35.00]/title",
error: true,
},
{
name: "last_predicate",
path: "/store/book[last()]/title",
error: true,
},
{
name: "last_minus_predicate",
path: "/store/book[last()-1]/title",
error: true,
},
{
name: "position_predicate",
path: "/store/book[position()<3]/title",
error: true,
},
{
name: "invalid_index",
path: "/store/book[10]/title",
error: true,
},
{
name: "nonexistent_element",
path: "/store/nonexistent",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(doc, tt.path)
// Handle expected errors
if tt.error {
if err == nil && len(result) == 0 {
// If we expected an error but got empty results instead, that's okay
return
}
if err != nil {
// If we got an error as expected, that's okay
return
}
} else if err != nil {
// If we didn't expect an error but got one, that's a test failure
t.Errorf("Get(%q) returned unexpected error: %v", tt.path, err)
return
}
// Special cases where we don't care about exact matches
switch tt.name {
case "wildcard_element_access":
// Just check that we got some elements
if len(result) == 0 {
t.Errorf("Expected multiple elements for wildcard, got none")
}
return
case "attribute_exists_predicate", "attribute_equals_predicate":
// Just check that we got some titles
if len(result) == 0 {
t.Errorf("Expected titles with lang attribute, got none")
}
// Ensure all are title elements
for _, node := range result {
if node.Data != "title" {
t.Errorf("Expected title elements, got: %s", node.Data)
}
}
return
case "nonexistent_element":
// Just check that we got empty results
if len(result) != 0 {
t.Errorf("Expected empty results for nonexistent element, got %d items", len(result))
}
return
}
// For other cases, just verify we got results
if len(result) == 0 {
t.Errorf("Expected results for path %s, got none", tt.path)
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("nil_node", func(t *testing.T) {
result, err := Get(nil, "/store/book")
if err == nil {
t.Errorf("Expected error for nil node")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("invalid_xml", func(t *testing.T) {
invalidXML, err := xmlquery.Parse(strings.NewReader("<invalid>xml"))
if err != nil {
// If parsing fails, that's expected
return
}
_, err = Get(invalidXML, "/store")
if err == nil {
t.Error("Expected error for invalid XML structure")
}
})
// For these tests with the simple XML, we expect just one result
simpleXML := `<root><book><title lang="en">Test</title></book></root>`
doc := parseTestXML(t, simpleXML)
t.Run("current_node", func(t *testing.T) {
result, err := Get(doc, "/root/book/.")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) > 1 {
t.Errorf("Expected at most 1 result, got %d", len(result))
}
if len(result) > 0 {
// Verify it's the book node
if result[0].Data != "book" {
t.Errorf("Expected book node, got %v", result[0].Data)
}
}
})
t.Run("attributes", func(t *testing.T) {
result, err := Get(doc, "/root/book/title/@lang")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 || result[0].InnerText() != "en" {
t.Errorf("Expected 'en', got %v", result[0].InnerText())
}
})
}
func TestGetWithPaths(t *testing.T) {
// Use a simplified, well-formed XML document
simpleXML := `<store>
<book category="fiction">
<title lang="en">The Book Title</title>
<author>Author Name</author>
<price>19.99</price>
</book>
<bicycle>
<color>red</color>
<price>199.95</price>
</bicycle>
</store>`
// Parse the XML for testing
doc := parseTestXML(t, simpleXML)
// Debug: Print the test XML
t.Logf("Test XML:\n%s", simpleXML)
tests := []struct {
name string
path string
expectedValue string
}{
{
name: "simple_element_access",
path: "/store/bicycle/color",
expectedValue: "red",
},
{
name: "attribute_access",
path: "/store/book/title/@lang",
expectedValue: "en",
},
{
name: "recursive_with_attribute",
path: "//title[@lang='en']",
expectedValue: "The Book Title",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Debug: Print the path we're looking for
t.Logf("Looking for path: %s", tt.path)
result, err := Get(doc, tt.path)
if err != nil {
t.Errorf("Get(%q) returned error: %v", tt.path, err)
return
}
// Debug: Print the results
t.Logf("Got %d results", len(result))
for i, r := range result {
t.Logf("Result %d: Node=%s, Value=%v", i, r.Data, r.InnerText())
}
// Check that we got results
if len(result) == 0 {
t.Errorf("Get(%q) returned no results", tt.path)
return
}
// For attribute access test, do more specific checks
if tt.name == "attribute_access" {
// Check the first result's value matches expected
if result[0].InnerText() != tt.expectedValue {
t.Errorf("Attribute value: got %v, expected %s", result[0].InnerText(), tt.expectedValue)
}
}
// For simple element access, check the text content
if tt.name == "simple_element_access" {
if text := result[0].InnerText(); text != tt.expectedValue {
t.Errorf("Element text: got %s, expected %s", text, tt.expectedValue)
}
}
// For recursive with attribute test, check title elements with lang="en"
if tt.name == "recursive_with_attribute" {
for _, node := range result {
// Check the node is a title
if node.Data != "title" {
t.Errorf("Expected title element, got %s", node.Data)
}
// Check text content
if text := node.InnerText(); text != tt.expectedValue {
t.Errorf("Text content: got %s, expected %s", text, tt.expectedValue)
}
// Check attributes - find the lang attribute
hasLang := false
for _, attr := range node.Attr {
if attr.Name.Local == "lang" && attr.Value == "en" {
hasLang = true
break
}
}
if !hasLang {
t.Errorf("Expected lang=\"en\" attribute, but it was not found")
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple element", func(t *testing.T) {
xmlData := `<root><name>John</name></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(doc, "/root/name")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 {
t.Errorf("Expected 1 result, got %d", len(result))
return
}
// Check text content
if text := result[0].InnerText(); text != "Jane" {
t.Errorf("Expected text 'Jane', got '%s'", text)
}
})
t.Run("attribute", func(t *testing.T) {
xmlData := `<root><element id="123"></element></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/element/@id", "456")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(doc, "/root/element/@id")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 {
t.Errorf("Expected 1 result, got %d", len(result))
return
}
// For attributes, check the inner text
if text := result[0].InnerText(); text != "456" {
t.Errorf("Expected attribute value '456', got '%s'", text)
}
})
t.Run("indexed element", func(t *testing.T) {
xmlData := `<root><items><item>first</item><item>second</item></items></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/items/item[1]", "changed")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change using XPath that specifically targets the first item
result, err := Get(doc, "/root/items/item[1]")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if we have results
if len(result) == 0 {
t.Errorf("Expected at least one result for /root/items/item[1]")
return
}
// Check text content
if text := result[0].InnerText(); text != "changed" {
t.Errorf("Expected text 'changed', got '%s'", text)
}
})
}
func TestSetAll(t *testing.T) {
t.Run("multiple elements", func(t *testing.T) {
xmlData := `<root><items><item>first</item><item>second</item></items></root>`
doc := parseTestXML(t, xmlData)
err := SetAll(doc, "//item", "changed")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Verify all items are changed
result, err := Get(doc, "//item")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 2 {
t.Errorf("Expected 2 results, got %d", len(result))
return
}
// Check each node
for i, node := range result {
if text := node.InnerText(); text != "changed" {
t.Errorf("Item %d: expected text 'changed', got '%s'", i, text)
}
}
})
t.Run("attributes", func(t *testing.T) {
xmlData := `<root><item id="1"/><item id="2"/></root>`
doc := parseTestXML(t, xmlData)
err := SetAll(doc, "//item/@id", "new")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Verify all attributes are changed
result, err := Get(doc, "//item/@id")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 2 {
t.Errorf("Expected 2 results, got %d", len(result))
return
}
// For attributes, check inner text
for i, node := range result {
if text := node.InnerText(); text != "new" {
t.Errorf("Attribute %d: expected value 'new', got '%s'", i, text)
}
}
})
}

View File

@@ -0,0 +1,137 @@
package regression
import (
"cook/processor"
"cook/utils"
"os"
"path/filepath"
"testing"
)
func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
command := utils.ModifyCommand{
Regex: regex,
Lua: lua,
LogLevel: "TRACE",
}
commands, err := processor.ProcessRegex(content, command, "test")
if err != nil {
return "", 0, 0, err
}
result, modifications := utils.ExecuteModifications(commands, content)
return result, modifications, len(commands), nil
}
func TestTalentsMechanicOutOfRange(t *testing.T) {
given := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
actual := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="30" color="gui.green"/>
<Replace tag="[duration]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="20"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
if matches != 4 {
t.Errorf("Expected 4 matches, got %d", matches)
}
if mods != 4 {
t.Errorf("Expected 4 modifications, got %d", mods)
}
if result != actual {
t.Errorf("expected %s, got %s", actual, result)
}
}
func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
cwd, err := os.Getwd()
if err != nil {
t.Fatalf("Error getting current working directory: %v", err)
}
given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
// We don't really care how many god damn matches there are as long as the result is correct
// if matches != 45 {
// t.Errorf("Expected 45 match, got %d", matches)
// }
//
// if mods != 45 {
// t.Errorf("Expected 45 modification, got %d", mods)
// }
if string(result) != string(expected) {
t.Errorf("expected %s, got %s", expected, result)
}
}

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

View File

@@ -1,12 +0,0 @@
<config>
<item>
<value>75</value>
<multiplier>2</multiplier>
<divider>4</divider>
</item>
<item>
<value>150</value>
<multiplier>3</multiplier>
<divider>2</divider>
</item>
</config>

View File

@@ -1,37 +0,0 @@
<?xml version="1.0" encoding="UTF-8"?>
<testdata>
<!-- Numeric values -->
<item>
<id>1</id>
<value>200</value>
<price>24.99</price>
<quantity>5</quantity>
</item>
<!-- Text values -->
<item>
<id>2</id>
<name>Test Product</name>
<description>This is a test product description</description>
<category>Test</category>
</item>
<!-- Mixed content -->
<item>
<id>3</id>
<name>Mixed Product</name>
<price>19.99</price>
<code>PRD-123</code>
<tags>sale,discount,new</tags>
</item>
<!-- Empty and special values -->
<item>
<id>4</id>
<value></value>
<specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
<multiline>Line 1
Line 2
Line 3</multiline>
</item>
</testdata>

1252
testfiles/OutpostItems.xml Normal file

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

24
utils/file.go Normal file
View File

@@ -0,0 +1,24 @@
package utils
import (
"os"
"path/filepath"
"strings"
)
func CleanPath(path string) string {
path = filepath.Clean(path)
path = strings.ReplaceAll(path, "\\", "/")
return path
}
func ToAbs(path string) string {
if filepath.IsAbs(path) {
return CleanPath(path)
}
cwd, err := os.Getwd()
if err != nil {
return CleanPath(path)
}
return CleanPath(filepath.Join(cwd, path))
}

14
utils/flags.go Normal file
View File

@@ -0,0 +1,14 @@
package utils
import (
"flag"
)
var (
// Deprecated
GitFlag = flag.Bool("git", false, "Use git to manage files")
// Deprecated
ResetFlag = flag.Bool("reset", false, "Reset files to their original state")
ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
Filter = flag.String("filter", "", "Filter commands before running them")
)

97
utils/git.go Normal file
View File

@@ -0,0 +1,97 @@
package utils
import (
"fmt"
"os"
"path/filepath"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/go-git/go-git/v5"
"github.com/go-git/go-git/v5/plumbing/object"
)
var (
Repo *git.Repository
Worktree *git.Worktree
)
func SetupGit() error {
cwd, err := os.Getwd()
if err != nil {
return fmt.Errorf("failed to get current working directory: %w", err)
}
logger.Debug("Current working directory obtained: %s", cwd)
logger.Debug("Attempting to open git repository at %s", cwd)
Repo, err = git.PlainOpen(cwd)
if err != nil {
logger.Debug("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
Repo, err = git.PlainInit(cwd, false)
if err != nil {
return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
}
logger.Info("Successfully initialized a new git repository at %s", cwd)
} else {
logger.Info("Successfully opened existing git repository at %s", cwd)
}
logger.Debug("Attempting to obtain worktree for repository at %s", cwd)
Worktree, err = Repo.Worktree()
if err != nil {
return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
}
logger.Debug("Successfully obtained worktree for repository at %s", cwd)
return nil
}
func CleanupGitFiles(files []string) error {
for _, file := range files {
logger.Debug("Checking git status for file: %s", file)
status, err := Worktree.Status()
if err != nil {
logger.Error("Error getting worktree status: %v", err)
fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
return fmt.Errorf("error getting worktree status: %w", err)
}
if status.IsUntracked(file) {
logger.Info("Detected untracked file: %s. Adding to git index.", file)
_, err = Worktree.Add(file)
if err != nil {
logger.Error("Error adding file to git: %v", err)
fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
return fmt.Errorf("error adding file to git: %w", err)
}
filename := filepath.Base(file)
logger.Info("File %s added successfully. Committing with message: 'Track %s'", filename, filename)
_, err = Worktree.Commit("Track "+filename, &git.CommitOptions{
Author: &object.Signature{
Name: "Big Chef",
Email: "bigchef@bigchef.com",
When: time.Now(),
},
})
if err != nil {
logger.Error("Error committing file: %v", err)
fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
return fmt.Errorf("error committing file: %w", err)
}
logger.Info("Successfully committed file: %s", filename)
} else {
logger.Info("File %s is already tracked. Restoring it to the working tree.", file)
err := Worktree.Restore(&git.RestoreOptions{
Files: []string{file},
Staged: true,
Worktree: true,
})
if err != nil {
logger.Error("Error restoring file: %v", err)
fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
return fmt.Errorf("error restoring file: %w", err)
}
logger.Info("File %s restored successfully", file)
}
}
return nil
}

254
utils/modifycommand.go Normal file
View File

@@ -0,0 +1,254 @@
package utils
import (
"fmt"
"os"
"path/filepath"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/bmatcuk/doublestar/v4"
"gopkg.in/yaml.v3"
)
type ModifyCommand struct {
Name string `yaml:"name"`
Regex string `yaml:"regex"`
Lua string `yaml:"lua"`
Files []string `yaml:"files"`
Git bool `yaml:"git"`
Reset bool `yaml:"reset"`
LogLevel string `yaml:"loglevel"`
Isolate bool `yaml:"isolate"`
NoDedup bool `yaml:"nodedup"`
}
type CookFile []ModifyCommand
func (c *ModifyCommand) Validate() error {
if c.Regex == "" {
return fmt.Errorf("pattern is required")
}
if c.Lua == "" {
return fmt.Errorf("lua expression is required")
}
if len(c.Files) == 0 {
return fmt.Errorf("at least one file is required")
}
if c.LogLevel == "" {
c.LogLevel = "INFO"
}
return nil
}
// Ehh.. Not much better... Guess this wasn't the big deal
var matchesMemoTable map[string]bool = make(map[string]bool)
func Matches(path string, glob string) (bool, error) {
key := fmt.Sprintf("%s:%s", path, glob)
if matches, ok := matchesMemoTable[key]; ok {
logger.Debug("Found match for file %q and glob %q in memo table", path, glob)
return matches, nil
}
matches, err := doublestar.Match(glob, path)
if err != nil {
return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
}
matchesMemoTable[key] = matches
return matches, nil
}
func SplitPattern(pattern string) (string, string) {
static, pattern := doublestar.SplitPattern(pattern)
cwd, err := os.Getwd()
if err != nil {
return "", ""
}
if static == "" {
static = cwd
}
if !filepath.IsAbs(static) {
static = filepath.Join(cwd, static)
static = filepath.Clean(static)
}
static = strings.ReplaceAll(static, "\\", "/")
return static, pattern
}
type FileCommandAssociation struct {
File string
IsolateCommands []ModifyCommand
Commands []ModifyCommand
}
func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
associationCount := 0
fileCommands := make(map[string]FileCommandAssociation)
for _, file := range files {
file = strings.ReplaceAll(file, "\\", "/")
fileCommands[file] = FileCommandAssociation{
File: file,
IsolateCommands: []ModifyCommand{},
Commands: []ModifyCommand{},
}
for _, command := range commands {
for _, glob := range command.Files {
static, pattern := SplitPattern(glob)
patternFile := strings.Replace(file, static+`/`, "", 1)
matches, err := Matches(patternFile, pattern)
if err != nil {
logger.Trace("Failed to match glob %s with file %s: %v", glob, file, err)
continue
}
if matches {
logger.Debug("Found match for file %q and command %q", file, command.Regex)
association := fileCommands[file]
if command.Isolate {
association.IsolateCommands = append(association.IsolateCommands, command)
} else {
association.Commands = append(association.Commands, command)
}
fileCommands[file] = association
associationCount++
}
}
}
logger.Debug("Found %d commands for file %q", len(fileCommands[file].Commands), file)
if len(fileCommands[file].Commands) == 0 {
logger.Info("No commands found for file %q", file)
}
if len(fileCommands[file].IsolateCommands) > 0 {
logger.Info("Found %d isolate commands for file %q", len(fileCommands[file].IsolateCommands), file)
}
}
logger.Info("Found %d associations between %d files and %d commands", associationCount, len(files), len(commands))
return fileCommands, nil
}
func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
logger.Info("Aggregating globs for %d commands", len(commands))
globs := make(map[string]struct{})
for _, command := range commands {
for _, glob := range command.Files {
glob = strings.Replace(glob, "~", os.Getenv("HOME"), 1)
glob = strings.ReplaceAll(glob, "\\", "/")
globs[glob] = struct{}{}
}
}
logger.Info("Found %d unique globs", len(globs))
return globs
}
func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
cwd, err := os.Getwd()
if err != nil {
return nil, fmt.Errorf("failed to get current working directory: %w", err)
}
logger.Debug("Expanding patterns from directory: %s", cwd)
for pattern := range patterns {
logger.Trace("Processing pattern: %s", pattern)
static, pattern := SplitPattern(pattern)
matches, _ := doublestar.Glob(os.DirFS(static), pattern)
logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
for _, m := range matches {
m = filepath.Join(static, m)
info, err := os.Stat(m)
if err != nil {
logger.Warning("Error getting file info for %s: %v", m, err)
continue
}
if !info.IsDir() && !filesMap[m] {
logger.Trace("Adding file to process list: %s", m)
filesMap[m], files = true, append(files, m)
}
}
}
if len(files) > 0 {
logger.Debug("Found %d files to process: %v", len(files), files)
}
return files, nil
}
func LoadCommands(args []string) ([]ModifyCommand, error) {
commands := []ModifyCommand{}
logger.Info("Loading commands from cook files: %s", args)
for _, arg := range args {
newcommands, err := LoadCommandsFromCookFiles(arg)
if err != nil {
return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
}
logger.Info("Successfully loaded %d commands from cook iles", len(newcommands))
commands = append(commands, newcommands...)
logger.Info("Now total commands: %d", len(commands))
}
logger.Info("Loaded %d commands from all cook file", len(commands))
return commands, nil
}
func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
static, pattern := SplitPattern(pattern)
commands := []ModifyCommand{}
cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
return nil, fmt.Errorf("failed to glob cook files: %w", err)
}
for _, cookFile := range cookFiles {
cookFile = filepath.Join(static, cookFile)
cookFile = filepath.Clean(cookFile)
cookFile = strings.ReplaceAll(cookFile, "\\", "/")
logger.Info("Loading commands from cook file: %s", cookFile)
cookFileData, err := os.ReadFile(cookFile)
if err != nil {
return nil, fmt.Errorf("failed to read cook file: %w", err)
}
newcommands, err := LoadCommandsFromCookFile(cookFileData)
if err != nil {
return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
}
commands = append(commands, newcommands...)
}
return commands, nil
}
func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
commands := []ModifyCommand{}
err := yaml.Unmarshal(cookFileData, &commands)
if err != nil {
return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
}
return commands, nil
}
// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
func CountGlobsBeforeDedup(commands []ModifyCommand) int {
count := 0
for _, cmd := range commands {
count += len(cmd.Files)
}
return count
}
func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
filteredCommands := []ModifyCommand{}
filters := strings.Split(filter, ",")
for _, cmd := range commands {
for _, filter := range filters {
if strings.Contains(cmd.Name, filter) {
filteredCommands = append(filteredCommands, cmd)
}
}
}
return filteredCommands
}

1000
utils/modifycommand_test.go Normal file

File diff suppressed because it is too large Load Diff

58
utils/replacecommand.go Normal file
View File

@@ -0,0 +1,58 @@
package utils
import (
"fmt"
"sort"
logger "git.site.quack-lab.dev/dave/cylogger"
)
type ReplaceCommand struct {
From int
To int
With string
}
func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
var err error
sort.Slice(modifications, func(i, j int) bool {
return modifications[i].From > modifications[j].From
})
logger.Trace("Preparing to apply %d replacement commands in reverse order", len(modifications))
executed := 0
for _, modification := range modifications {
fileData, err = modification.Execute(fileData)
if err != nil {
logger.Error("Failed to execute replacement: %v", err)
continue
}
executed++
}
logger.Info("Successfully applied %d text replacements", executed)
return fileData, executed
}
func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
err := m.Validate(len(fileDataStr))
if err != nil {
return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
}
logger.Trace("Replace pos %d-%d with %q", m.From, m.To, m.With)
return fileDataStr[:m.From] + m.With + fileDataStr[m.To:], nil
}
func (m *ReplaceCommand) Validate(maxsize int) error {
if m.To < m.From {
return fmt.Errorf("command to is less than from: %v", m)
}
if m.From > maxsize || m.To > maxsize {
return fmt.Errorf("command from or to is greater than replacement length: %v", m)
}
if m.From < 0 || m.To < 0 {
return fmt.Errorf("command from or to is less than 0: %v", m)
}
return nil
}

View File

@@ -0,0 +1,504 @@
package utils
import (
"testing"
"github.com/stretchr/testify/assert"
)
func TestReplaceCommandExecute(t *testing.T) {
tests := []struct {
name string
input string
command ReplaceCommand
expected string
shouldError bool
}{
{
name: "Simple replacement",
input: "This is a test string",
command: ReplaceCommand{From: 5, To: 7, With: "was"},
expected: "This was a test string",
shouldError: false,
},
{
name: "Replace at beginning",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 5, With: "Hi"},
expected: "Hi world",
shouldError: false,
},
{
name: "Replace at end",
input: "Hello world",
command: ReplaceCommand{From: 6, To: 11, With: "everyone"},
expected: "Hello everyone",
shouldError: false,
},
{
name: "Replace entire string",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
expected: "Goodbye!",
shouldError: false,
},
{
name: "Error: From > To",
input: "Test string",
command: ReplaceCommand{From: 7, To: 5, With: "fail"},
expected: "Test string",
shouldError: true,
},
{
name: "Error: From > string length",
input: "Test",
command: ReplaceCommand{From: 10, To: 12, With: "fail"},
expected: "Test",
shouldError: true,
},
{
name: "Error: To > string length",
input: "Test",
command: ReplaceCommand{From: 2, To: 10, With: "fail"},
expected: "Test",
shouldError: true,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
result, err := tc.command.Execute(tc.input)
if tc.shouldError {
if err == nil {
t.Errorf("Expected an error for command %+v but got none", tc.command)
}
} else {
if err != nil {
t.Errorf("Unexpected error: %v", err)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
}
})
}
}
func TestExecuteModifications(t *testing.T) {
tests := []struct {
name string
input string
modifications []ReplaceCommand
expected string
expectedCount int
}{
{
name: "Single modification",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
},
expected: "Hi world",
expectedCount: 1,
},
{
name: "Multiple modifications",
input: "This is a test string",
modifications: []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 8, To: 14, With: "sample"},
},
expected: "That is sample string",
expectedCount: 2,
},
{
name: "Overlapping modifications",
input: "ABCDEF",
modifications: []ReplaceCommand{
{From: 0, To: 3, With: "123"}, // ABC -> 123
{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
},
// The actual behavior with the current implementation
expected: "123yzF",
expectedCount: 2,
},
{
name: "Sequential modifications",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 5, To: 6, With: ""}, // Remove the space
{From: 6, To: 11, With: "everyone"},
},
expected: "Hieveryone",
expectedCount: 3,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
// Make a copy of the modifications to avoid modifying the test case
mods := make([]ReplaceCommand, len(tc.modifications))
copy(mods, tc.modifications)
result, count := ExecuteModifications(mods, tc.input)
if count != tc.expectedCount {
t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
})
}
}
func TestReverseOrderExecution(t *testing.T) {
// This test verifies the current behavior of modification application
input := "Original text with multiple sections"
// Modifications in specific positions
modifications := []ReplaceCommand{
{From: 0, To: 8, With: "Modified"}, // Original -> Modified
{From: 9, To: 13, With: "document"}, // text -> document
{From: 14, To: 22, With: "without"}, // with -> without
{From: 23, To: 31, With: "any"}, // multiple -> any
}
// The actual current behavior of our implementation
expected := "Modified document withouttanytions"
result, count := ExecuteModifications(modifications, input)
if count != 4 {
t.Errorf("Expected 4 modifications, got %d", count)
}
if result != expected {
t.Errorf("Expected %q, got %q", expected, result)
}
}
// Replace text in the middle of a string with new content
func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello replaced, how are you?", result)
}
// Replace with empty string (deletion)
func TestReplaceCommandExecute_DeletesText(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello , how are you?", result)
}
// Replace with longer string than original segment
func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "longerreplacement",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello longerreplacement, how are you?", result)
}
// From and To values are the same (zero-length replacement)
func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 5,
With: "inserted",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Helloinserted world", result)
}
// From value is greater than To value
func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 10,
To: 5,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// From or To values exceed string length
func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 50, // Exceeds the length of the fileContent
With: "replaced",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world", result)
}
// From or To values are negative
func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: -1,
To: 10,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// Modifications are applied in reverse order (from highest to lowest 'From' value)
func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 10, To: 14, With: "sample"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a sample string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// One or more modifications fail but others succeed
func TestExecuteModificationsWithPartialFailures(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
// Create a custom ReplaceCommand implementation that will fail
failingCommand := ReplaceCommand{
From: 15,
To: 10, // Invalid range (To < From) to cause failure
With: "will fail",
}
// Valid commands
validCommand1 := ReplaceCommand{
From: 0,
To: 4,
With: "That",
}
validCommand2 := ReplaceCommand{
From: 26,
To: 38,
With: "modifications",
}
modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a test string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
// Only 2 out of 3 modifications should succeed
if executed != 2 {
t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
}
}
// All valid modifications are executed and the modified string is returned
func TestExecuteModificationsAllValid(t *testing.T) {
// Setup test data
fileData := "Hello world, this is a test"
modifications := []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 18, To: 20, With: "was"},
{From: 21, To: 27, With: "an example"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "Hi world, this was an example"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// The count of successfully executed modifications is returned
func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
// Setup test data
fileData := "Initial text for testing"
modifications := []ReplaceCommand{
{From: 0, To: 7, With: "Final"},
{From: 12, To: 16, With: "example"},
{From: 17, To: 24, With: "process"},
}
// Execute the function
_, executed := ExecuteModifications(modifications, fileData)
// Verify the count of executed modifications
expectedExecuted := 3
if executed != expectedExecuted {
t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
}
}
// Empty modifications list returns the original string with zero executed count
func TestExecuteModificationsWithEmptyList(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
if result != fileData {
t.Errorf("Expected result to be %q, but got %q", fileData, result)
}
if executed != 0 {
t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
}
}
// Modifications with identical 'From' values
func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 10, To: 14, With: "sample"},
{From: 10, To: 14, With: "example"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
// Yes, it's mangled, yes, it's intentional
// Every subsequent command works with the modified contents of the previous command
// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
// So we prepend "example" and end up with "examplele"
// Whether sample or example goes first here is irrelevant to us
// But it just so happens that sample goes first, so we end up with "examplele"
expectedResult := "This is a examplele string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// Modifications that would affect each other if not sorted properly
func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
// Setup test data
fileData := "The quick brown fox jumps over the lazy dog"
modifications := []ReplaceCommand{
{From: 4, To: 9, With: "slow"},
{From: 10, To: 15, With: "red"},
{From: 16, To: 19, With: "cat"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "The slow red cat jumps over the lazy dog"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}