Hallucinate a json mode implementation

refactor(db.go, file.go): improve database error handling and file snapshot seeding
Improve config readability by removing unnecessary fields and adding omitempty
2025-08-21 20:39:35 +02:00 · 2025-08-09 16:12:26 +02:00 · 2025-08-08 09:58:03 +02:00 · 2025-08-08 09:52:47 +02:00 · 2025-08-08 09:50:31 +02:00 · 2025-08-08 08:10:51 +02:00
37 changed files with 7192 additions and 8053 deletions
--- a/.gitignore
+++ b/.gitignore
@@ -1 +1,4 @@
 *.exe
 .qodo
 *.sqlite
 testfiles
--- a/.vscode/launch.json
+++ b/.vscode/launch.json
@@ -5,16 +5,98 @@
 	"version": "0.2.0",
 	"configurations": [
 		{
-			"name": "Launch Package",
+			"name": "Launch Package (Barotrauma)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Payday 2)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
 			"args": [
 				"-loglevel",
 				"trace",
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Barotrauma cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"cookassistant.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Quasimorph cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
 			"args": [
 				"cook.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Rimworld cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
 			"args": [
 				"cookVehicles.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Workspace)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"args": [
-				"-mode=json",
+				"tester.yml",
-				"$..name",
+			]
-				"v='pero'",
+		},
-				"test.json"
+		{
 			"name": "Launch Package (Avorion)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
 			"args": [
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Minecraft)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Minecraft",
 			"args": [
 				"cook_tacz.yml",
 			]
 		}
 	]
--- a/TalentsMechanic.xml
+++ b/TalentsMechanic.xml
@@ -1,651 +0,0 @@
 <?xml version="1.0" encoding="utf-8"?>
 <Talents>
  <Talent identifier="powerarmor">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.powerarmor">
      <Replace tag="[bonusmovement]" value="25" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHasItem tags="deepdivinglarge" />
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
      </Abilities>
    </AbilityGroupInterval>
    <AddedRecipe itemidentifier="exosuit"/>
  </Talent>
  <Talent identifier="foolhardy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="foolhardy" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="berserker">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="berserker" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="mudraptorwrestler">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.mudraptorwrestler">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattypeself">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData weapontype="NoWeapon,Melee" />
        <AbilityConditionCharacter>
          <Conditional group="eq mudraptor" />
        </AbilityConditionCharacter>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="heavylifting">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.heavylifting">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHoldingItem tags="alienartifact,crate"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="iamthatguy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.iamthatguy">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.skillbonus">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
      <Abilities>
        <CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="heavywrench"/>
  </Talent>
  <Talent identifier="robotics">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.robotics"/>
    <Description tag="talentdescription.roboticsreminder">
      <Replace tag="[amount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="defensebotspawner"/>
    <AddedRecipe itemidentifier="defensebotammobox"/>
  </Talent>
  <Talent identifier="ironstorm">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ironstorm">
      <Replace tag="[chance]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="scrapcannon"/>
  </Talent>
  <Talent identifier="residualwaste">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.residualwaste">
      <Replace tag="[chance]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.2"/>
        <!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
        <AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="massproduction">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.massproduction">
      <Replace tag="[chance]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityRemoveRandomIngredient>
          <AbilityConditionItem category="Material"/>
        </CharacterAbilityRemoveRandomIngredient>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="toolmaintenance">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.toolmaintenance">
      <Replace tag="[amount]" value="1" color="gui.green"/>
    </Description>
    <!-- Give once when unlocking the talent -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupEffect>
    <!-- Give every 60 seconds for late comers -->
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="miner">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
    <Description tag="talentdescription.miner">
      <Replace tag="[probability]" value="320" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.gainoredetachspeed">
      <Replace tag="[amount]" value="1600" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomchance="12.8"/>
        <AbilityConditionItem tags="ore"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="retrofit">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.retrofit" />
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ironman">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="ironhelmet"/>
    <AddedRecipe itemidentifier="makeshiftarmor"/>
  </Talent>
  <Talent identifier="oiledmachinery">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.oiledmachinery">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="pumpndump">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.pumpndump">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <conditions>
        <AbilityConditionItem tags="pump"/>
      </conditions>
      <Abilities>
        <CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ballastdenizen">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ballastdenizen">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="engineengineer">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.engineengineer">
      <Replace tag="[amount]" value="2.5" color="gui.green"/>
      <Replace tag="[max]" value="5" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="1" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="2" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="3" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="5" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="6" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="7" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel minlevel="8" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="multifunctional">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.multifunctional">
      <Replace tag="[powerincrease]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="wrenchitem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="crowbaritem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="salvagecrew">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.bonusxponmission">
      <Replace tag="[xpbonus]" value="30" color="gui.green"/>
      <Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.salvagecrew">
      <Replace tag="[swimbonus]" value="50" color="gui.green"/>
      <Replace tag="[resistanceamount]" value="10" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
      <Conditions>
        <AbilityConditionMission missiontype="Salvage"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="1.3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionInSubmarine submarinetype="Wreck" />
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="This" disabledeltatime="true">
              <Affliction identifier="salvagecrew" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.machinemaniac">
      <Replace tag="[bonus]" value="80" color="gui.green"/>
      <Replace tag="[amount]" value="3" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.30">
      <Replace tag="[requirement]" value="12" color="gui.green"/>
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
      <Replace tag="[xpamount]" value="500" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.50">
      <Replace tag="[requirement]" value="20" color="gui.green"/>
      <Replace tag="[level]" value="1" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.100">
      <Replace tag="[requirement]" value="40" color="gui.green"/>
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <!-- Give the player stats that tracks if the rewards should be given -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveExperience amount="2000"/>
        <CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="tinkerer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.increasemaxrepairmechanical">
      <Replace tag="[percentage]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="modularrepairs">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.freeupgrade">
      <Replace tag="[level]" value="1" color="gui.green"/>
      <Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="repairpack"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="hullfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="25" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="fixfoamgrenade"/>
    <AddedRecipe itemidentifier="handheldstatusmonitor"/>
  </Talent>
  <Talent identifier="letitdrain">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.letitdrain"/>
    <Description tag="talentdescription.letitdrainreminder">
      <Replace tag="[itemcount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="portablepump"/>
  </Talent>
  <Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="scrapsavant">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
    <Description tag="talentdescription.doublescrapoutput" />
    <Description tag="talentdescription.findadditionalscrap">
      <Replace tag="[probability]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionItem tags="scrap"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
      <Conditions>
        <AbilityConditionItemInSubmarine submarinetype="Wreck"/>
        <AbilityConditionItem tags="container"/>
      </Conditions>
      <Abilities>
        <CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
          <StatusEffects>
            <StatusEffect type="OnAbility" target="UseTarget" >
              <SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilitySpawnItemsToContainer>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="safetyfirst">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="safetyharness"/>
  </Talent>
 </Talents>
--- a/cmd/log_format_test/main.go
+++ b/cmd/log_format_test/main.go
@@ -0,0 +1,28 @@
 package main
 import (
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 func main() {
 	// Initialize logger with DEBUG level
 	logger.Init(logger.LevelDebug)
 	// Test different log levels
 	logger.Info("This is an info message")
 	logger.Debug("This is a debug message")
 	logger.Warning("This is a warning message")
 	logger.Error("This is an error message")
 	logger.Trace("This is a trace message (not visible at DEBUG level)")
 	// Test with a goroutine
 	logger.SafeGo(func() {
 		time.Sleep(10 * time.Millisecond)
 		logger.Info("Message from goroutine")
 	})
 	// Wait for goroutine to complete
 	time.Sleep(20 * time.Millisecond)
 }
--- a/glob_test.go
+++ b/glob_test.go
@@ -1,6 +1,7 @@
 package main
 import (
 	"cook/utils"
 	"os"
 	"path/filepath"
 	"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
-			files, err := expandFilePatterns(tc.patterns)
+			// Convert string patterns to map[string]struct{} for ExpandGLobs
 			patternMap := make(map[string]struct{})
 			for _, pattern := range tc.patterns {
 				patternMap[pattern] = struct{}{}
 			}
 			files, err := utils.ExpandGLobs(patternMap)
 			if err != nil {
-				t.Fatalf("expandFilePatterns failed: %v", err)
+				t.Fatalf("ExpandGLobs failed: %v", err)
 			}
 			if len(files) != tc.expected {
--- a/go.mod
+++ b/go.mod
@@ -1,39 +1,32 @@
-module modify
+module cook
-go 1.24.1
+go 1.23.2
 require (
-	github.com/PaesslerAG/jsonpath v0.1.1
+	git.site.quack-lab.dev/dave/cylogger v1.3.0
 	github.com/antchfx/xmlquery v1.4.4
 	github.com/bmatcuk/doublestar/v4 v4.8.1
 	github.com/stretchr/testify v1.10.0
 	github.com/yuin/gopher-lua v1.1.1
 	gopkg.in/yaml.v3 v3.0.1
 	gorm.io/gorm v1.30.0
 )
 require (
-	dario.cat/mergo v1.0.0 // indirect
+	github.com/davecgh/go-spew v1.1.1 // indirect
-	github.com/Microsoft/go-winio v0.6.2 // indirect
+	github.com/google/go-cmp v0.6.0 // indirect
-	github.com/ProtonMail/go-crypto v1.1.5 // indirect
+	github.com/hexops/valast v1.5.0 // indirect
-	github.com/cloudflare/circl v1.6.0 // indirect
+	github.com/jinzhu/inflection v1.0.0 // indirect
-	github.com/cyphar/filepath-securejoin v0.4.1 // indirect
+	github.com/jinzhu/now v1.1.5 // indirect
-	github.com/emirpasic/gods v1.18.1 // indirect
+	github.com/kr/pretty v0.3.1 // indirect
-	github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
+	github.com/mattn/go-sqlite3 v1.14.22 // indirect
-	github.com/go-git/go-billy/v5 v5.6.2 // indirect
+	github.com/pmezard/go-difflib v1.0.0 // indirect
-	github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect
+	github.com/rogpeppe/go-internal v1.14.1 // indirect
-	github.com/kevinburke/ssh_config v1.2.0 // indirect
+	golang.org/x/mod v0.21.0 // indirect
-	github.com/pjbgf/sha1cd v0.3.2 // indirect
+	golang.org/x/sync v0.11.0 // indirect
 	github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect
 	github.com/skeema/knownhosts v1.3.1 // indirect
 	github.com/xanzy/ssh-agent v0.3.3 // indirect
 	golang.org/x/crypto v0.35.0 // indirect
 	golang.org/x/sys v0.30.0 // indirect
 	gopkg.in/warnings.v0 v0.1.2 // indirect
 )
 require (
 	github.com/PaesslerAG/gval v1.0.0 // indirect
 	github.com/antchfx/xpath v1.3.3 // indirect
 	github.com/go-git/go-git/v5 v5.14.0
 	github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect
 	golang.org/x/net v0.35.0 // indirect
 	golang.org/x/text v0.22.0 // indirect
 	golang.org/x/tools v0.26.0 // indirect
 	gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
 	mvdan.cc/gofumpt v0.4.0 // indirect
 )
 require gorm.io/driver/sqlite v1.6.0
--- a/go.sum
+++ b/go.sum
@@ -1,177 +1,59 @@
-dario.cat/mergo v1.0.0 h1:AGCNq9Evsj31mOgNPcLyXc+4PNABt905YmuqPYYpBWk=
+git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw=
-dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk=
+git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk=
 github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY=
 github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY=
 github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU=
 github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
 github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
 github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
 github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
 github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
 github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4=
 github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE=
 github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8=
 github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4=
 github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
 github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
 github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
 github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
 github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio=
 github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs=
 github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
 github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
-github.com/cloudflare/circl v1.6.0 h1:cr5JKic4HI+LkINy2lg3W2jF8sHCVTBncJr5gIIq7qk=
+github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
 github.com/cloudflare/circl v1.6.0/go.mod h1:uddAzsPgqdMAYatqJ0lsjX1oECcQLIlRpzZh3pJrofs=
 github.com/cyphar/filepath-securejoin v0.4.1 h1:JyxxyPEaktOD+GAnqIqTf9A8tHyAG22rowi7HkoSU1s=
 github.com/cyphar/filepath-securejoin v0.4.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI=
 github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
 github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
 github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
-github.com/elazarl/goproxy v1.7.2 h1:Y2o6urb7Eule09PjlhQRGNsqRfPmYI3KKQLFpCAV3+o=
+github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE=
-github.com/elazarl/goproxy v1.7.2/go.mod h1:82vkLNir0ALaW14Rc399OTTjyNREgmdL2cVoIbS6XaE=
+github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps=
-github.com/emirpasic/gods v1.18.1 h1:FXtiHYKDGKCW2KzwZKx0iC0PQmdlorYgdFG9jPXJ1Bc=
+github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
 github.com/emirpasic/gods v1.18.1/go.mod h1:8tpGGwCnJ5H4r6BWwaV6OrWmMoPhUl5jm/FMNAnJvWQ=
 github.com/gliderlabs/ssh v0.3.8 h1:a4YXD1V7xMF9g5nTkdfnja3Sxy1PVDCj1Zg4Wb8vY6c=
 github.com/gliderlabs/ssh v0.3.8/go.mod h1:xYoytBv1sV0aL3CavoDuJIQNURXkkfPA/wxQ1pL1fAU=
 github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI=
 github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic=
 github.com/go-git/go-billy/v5 v5.6.2 h1:6Q86EsPXMa7c3YZ3aLAQsMA0VlWmy43r6FHqa/UNbRM=
 github.com/go-git/go-billy/v5 v5.6.2/go.mod h1:rcFC2rAsp/erv7CMz9GczHcuD0D32fWzH+MJAU+jaUU=
 github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4=
 github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
 github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60=
 github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k=
 github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
 github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ=
 github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw=
 github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
-github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8=
+github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM=
-github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU=
+github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
-github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A=
+github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
-github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99/go.mod h1:1lJo3i6rXxKeerYnT8Nvf0QmHCRC1n8sfWVwXF2Frvo=
+github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
-github.com/kevinburke/ssh_config v1.2.0 h1:x584FjTGwHzMwvHx18PXxbBVzfnxogHaAReU4gf13a4=
+github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
-github.com/kevinburke/ssh_config v1.2.0/go.mod h1:CT57kijsi8u/K/BOFA39wgDQJ9CxiF4nAY/ojJ6r6mM=
+github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
-github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
+github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
 github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
 github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
 github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
 github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
 github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
 github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
 github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
 github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
 github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
 github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
-github.com/onsi/gomega v1.34.1 h1:EUMJIKUjM8sKjYbtxQI9A4z2o+rruxnzNvpknOXie6k=
+github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
-github.com/onsi/gomega v1.34.1/go.mod h1:kU1QgUvBDLXBJq618Xvm2LUX6rSAfRaFRTcdOeDLwwY=
+github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
-github.com/pjbgf/sha1cd v0.3.2 h1:a9wb0bp1oC2TGwStyn0Umc/IGKQnEgF0vVaZ8QF8eo4=
+github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
 github.com/pjbgf/sha1cd v0.3.2/go.mod h1:zQWigSxVmsHEZow5qaLtPYxpcKMMQpa09ixqBxuCS6A=
 github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
 github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
 github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
 github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
 github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs=
 github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
 github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
 github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 h1:n661drycOFuPLCN3Uc8sB6B/s6Z4t2xvBgU1htSHuq8=
 github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3/go.mod h1:A0bzQcvG0E7Rwjx0REVgAGH58e96+X0MeOfepqsbeW4=
 github.com/sirupsen/logrus v1.7.0/go.mod h1:yWOB1SBYBC5VeMP7gHvWumXLIWorT60ONWic61uBYv0=
 github.com/skeema/knownhosts v1.3.1 h1:X2osQ+RAjK76shCbvhHHHVl3ZlgDm8apHEHFqRjnBY8=
 github.com/skeema/knownhosts v1.3.1/go.mod h1:r7KTdC8l4uxWRyK2TpQZ/1o5HaSzh06ePQNxPwTcfiY=
 github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
 github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
 github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
 github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
 github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
 github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM=
 github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw=
 github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
 github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
 github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
-golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
+golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0=
-golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
+golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY=
-golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
+golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w=
-golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
+golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
 golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
 golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
 golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs=
 golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ=
 golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8=
 golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY=
 golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
 golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
 golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
 golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
 golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
 golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
 golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
 golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
 golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
 golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
 golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
 golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
 golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
 golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
 golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
 golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
 golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc=
 golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
 golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
 golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
 golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
 golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
 golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
 golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
 golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
 golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU=
 golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
 golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
 golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
 golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
 golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
 golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
 golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
-golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
+golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ=
-golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
+golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0=
 golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
 golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
 golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
 golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
 golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
 gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
 gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
 gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
 gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
 gopkg.in/warnings.v0 v0.1.2 h1:wFXVbFY8DY5/xOe1ECiWdKCzZlxgshcYVNkBHstARME=
 gopkg.in/warnings.v0 v0.1.2/go.mod h1:jksf8JmL6Qr/oQM2OXTHunEvvTAsrWBLb6OOjuVWRNI=
 gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
 gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
 gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
 gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
 gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
 gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
 gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
 gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
 mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
 mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=
--- a/main.go
+++ b/main.go
@@ -1,289 +1,701 @@
 package main
 import (
 	"errors"
 	"flag"
 	"fmt"
 	"log"
 	"os"
-	"path/filepath"
+	"sort"
 	"sync"
 	"sync/atomic"
 	"time"
-	"github.com/bmatcuk/doublestar/v4"
+	"cook/processor"
-	"github.com/go-git/go-git/v5"
+	"cook/utils"
 	"github.com/go-git/go-git/v5/plumbing/object"
-	"modify/processor"
+	"gopkg.in/yaml.v3"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // mainLogger is a scoped logger for the main package.
 var mainLogger = logger.Default.WithPrefix("main")
 type GlobalStats struct {
-	TotalMatches       int
+	TotalMatches            int64
-	TotalModifications int
+	TotalModifications      int64
-	ProcessedFiles     int
+	ProcessedFiles          int64
-	FailedFiles        int
+	FailedFiles             int64
 	ModificationsPerCommand sync.Map
 }
 var stats GlobalStats
 var logger *log.Logger
 var (
-	jsonFlag  = flag.Bool("json", false, "Process JSON files")
+	stats GlobalStats = GlobalStats{
-	xmlFlag   = flag.Bool("xml", false, "Process XML files")
+		ModificationsPerCommand: sync.Map{},
-	gitFlag   = flag.Bool("git", false, "Use git to manage files")
+	}
 	resetFlag = flag.Bool("reset", false, "Reset files to their original state")
 	repo      *git.Repository
 	worktree  *git.Worktree
 )
 func init() {
 	log.SetFlags(log.Lmicroseconds | log.Lshortfile)
 	logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
 	stats = GlobalStats{}
 }
 func main() {
 	// TODO: Implement some sort of git integration
 	// Maybe use go-git
 	// Specify a -git flag
 	// If we are operating with git then:
 	// Inmitialize a repo if one doesn't exist (try to open right?)
 	// For each file matched by glob first figure out if it's already tracked
 	// If not tracked then track it and commit (either it alone or maybe multiple together somehow)
 	// Then reset the file (to undo previous modifications)
 	// THEN change the file
 	// In addition add a -undo flag that will ONLY reset the files without changing them
 	// Only for the ones matched by glob
 	// ^ important because binary files would fuck us up
 	flag.Usage = func() {
 		CreateExampleConfig()
 		fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nOptions:\n")
 		fmt.Fprintf(os.Stderr, "  -json\n")
 		fmt.Fprintf(os.Stderr, "        Process JSON files\n")
 		fmt.Fprintf(os.Stderr, "  -xml\n")
 		fmt.Fprintf(os.Stderr, "        Process XML files\n")
 		fmt.Fprintf(os.Stderr, "  -git\n")
 		fmt.Fprintf(os.Stderr, "        Use git to manage files\n")
 		fmt.Fprintf(os.Stderr, "  -reset\n")
 		fmt.Fprintf(os.Stderr, "        Reset files to their original state\n")
-		fmt.Fprintf(os.Stderr, "  -mode string\n")
+		fmt.Fprintf(os.Stderr, "  -loglevel string\n")
-		fmt.Fprintf(os.Stderr, "        Processing mode: regex, xml, json (default \"regex\")\n")
+		fmt.Fprintf(os.Stderr, "        Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
 		fmt.Fprintf(os.Stderr, "  -json\n")
 		fmt.Fprintf(os.Stderr, "        Enable JSON mode for processing JSON files\n")
 		fmt.Fprintf(os.Stderr, "\nExamples:\n")
 		fmt.Fprintf(os.Stderr, "  Regex mode (default):\n")
-		fmt.Fprintf(os.Stderr, "    %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
+		fmt.Fprintf(os.Stderr, "    %s \"<value>(\\\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "  XML mode:\n")
 		fmt.Fprintf(os.Stderr, "    %s -xml \"//value\" \"*1.5\" data.xml\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "  JSON mode:\n")
-		fmt.Fprintf(os.Stderr, "    %s -json \"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
+		fmt.Fprintf(os.Stderr, "    %s -json data.json\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
 		fmt.Fprintf(os.Stderr, "      s1, s2, etc. are used to refer to capture groups as strings.\n")
 		fmt.Fprintf(os.Stderr, "      Helper functions: num(str) converts string to number, str(num) converts number to string\n")
 		fmt.Fprintf(os.Stderr, "      is_number(str) checks if a string is numeric\n")
 		fmt.Fprintf(os.Stderr, "      For XML and JSON, the captured values are exposed as 'v', which can be of any type we capture (string, number, table).\n")
 		fmt.Fprintf(os.Stderr, "      If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n")
 		fmt.Fprintf(os.Stderr, "      You can use any valid Lua code, including if statements, loops, etc.\n")
 		fmt.Fprintf(os.Stderr, "      Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
 	}
-
+	// TODO: Fix bed shitting when doing *.yml in barotrauma directory
 	flag.Parse()
 	args := flag.Args()
 	if *resetFlag {
 		*gitFlag = true
 	}
-	if len(args) < 3 {
+	logger.InitFlag()
-		log.Printf("At least %d arguments are required", 3)
+	mainLogger.Info("Initializing with log level: %s", logger.GetLevel().String())
 	mainLogger.Trace("Full argv: %v", os.Args)
 	if flag.NArg() == 0 {
 		flag.Usage()
 		return
 	}
-	// Get the appropriate pattern and expression based on mode
+	mainLogger.Debug("Getting database connection")
-	var pattern, luaExpr string
+	db, err := utils.GetDB()
 	var filePatterns []string
 	pattern = args[0]
 	luaExpr = args[1]
 	filePatterns = args[2:]
 	// Prepare the Lua expression
 	originalLuaExpr := luaExpr
 	luaExpr = processor.BuildLuaScript(luaExpr)
 	if originalLuaExpr != luaExpr {
 		logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
 	}
 	if *gitFlag {
 		err := setupGit()
 	if err != nil {
-			fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
+		mainLogger.Error("Failed to get database: %v", err)
 		return
 	}
-	}
+	mainLogger.Debug("Database connection established")
-	// Expand file patterns with glob support
+	workdone, err := HandleSpecialArgs(args, err, db)
 	files, err := expandFilePatterns(filePatterns)
 	if err != nil {
-		fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
+		mainLogger.Error("Failed to handle special args: %v", err)
 		return
 	}
 	if workdone {
 		mainLogger.Info("Special arguments handled, exiting.")
 		return
 	}
-	if len(files) == 0 {
+	// The plan is:
-		fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
+	// Load all commands
 	mainLogger.Debug("Loading commands from arguments")
 	mainLogger.Trace("Arguments: %v", args)
 	commands, err := utils.LoadCommands(args)
 	if err != nil || len(commands) == 0 {
 		mainLogger.Error("Failed to load commands: %v", err)
 		flag.Usage()
 		return
 	}
 	// Collect global modifiers from special entries and filter them out
 	vars := map[string]interface{}{}
 	filtered := make([]utils.ModifyCommand, 0, len(commands))
 	for _, c := range commands {
 		if len(c.Modifiers) > 0 && c.Name == "" && c.Regex == "" && len(c.Regexes) == 0 && c.Lua == "" && len(c.Files) == 0 {
 			for k, v := range c.Modifiers {
 				vars[k] = v
 			}
 			continue
 		}
 		filtered = append(filtered, c)
 	}
 	if len(vars) > 0 {
 		mainLogger.Info("Loaded %d global modifiers", len(vars))
 		processor.SetVariables(vars)
 	}
 	commands = filtered
 	mainLogger.Info("Loaded %d commands", len(commands))
-	if *gitFlag {
+	if *utils.Filter != "" {
-		err := cleanupGitFiles(files)
+		mainLogger.Info("Filtering commands by name: %s", *utils.Filter)
-		if err != nil {
+		commands = utils.FilterCommands(commands, *utils.Filter)
-			fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
+		mainLogger.Info("Filtered %d commands", len(commands))
 			return
 		}
 	}
 	if *resetFlag {
 		log.Printf("Files reset to their original state, nothing more to do")
 		return
 	}
-	// Create the processor based on mode
+	// Then aggregate all the globs and deduplicate them
-	var proc processor.Processor
+	mainLogger.Debug("Aggregating globs and deduplicating")
-	switch {
+	globs := utils.AggregateGlobs(commands)
-	case *xmlFlag:
+	mainLogger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
 		proc = &processor.XMLProcessor{}
 		logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
 			pattern, luaExpr, len(files))
 	case *jsonFlag:
 		proc = &processor.JSONProcessor{}
 		logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
 			pattern, luaExpr, len(files))
 	default:
 		proc = &processor.RegexProcessor{}
 		logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
 			pattern, luaExpr, len(files))
 	}
-	var wg sync.WaitGroup
+	for _, command := range commands {
-	// Process each file
+		mainLogger.Trace("Command: %s", command.Name)
-	for _, file := range files {
+		if len(command.Regexes) > 0 {
-		wg.Add(1)
+			mainLogger.Trace("Regexes: %v", command.Regexes)
 		go func(file string) {
 			defer wg.Done()
 			logger.Printf("Processing file: %s", file)
 			// It's a bit fucked, maybe I could do better to call it from proc... But it'll do for now
 			modCount, matchCount, err := processor.Process(proc, file, pattern, luaExpr)
 			if err != nil {
 				fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
 				stats.FailedFiles++
 		} else {
-				logger.Printf("Successfully processed file: %s", file)
+			mainLogger.Trace("Regex: %s", command.Regex)
 				stats.ProcessedFiles++
 				stats.TotalMatches += matchCount
 				stats.TotalModifications += modCount
 		}
-		}(file)
+		mainLogger.Trace("Files: %v", command.Files)
 		mainLogger.Trace("Lua: %s", command.Lua)
 		mainLogger.Trace("Reset: %t", command.Reset)
 		mainLogger.Trace("Isolate: %t", command.Isolate)
 		mainLogger.Trace("LogLevel: %s", command.LogLevel)
 	}
 	// Resolve all the files for all the globs
 	mainLogger.Info("Found %d unique file patterns", len(globs))
 	mainLogger.Debug("Expanding glob patterns to files")
 	files, err := utils.ExpandGLobs(globs)
 	if err != nil {
 		mainLogger.Error("Failed to expand file patterns: %v", err)
 		return
 	}
 	mainLogger.Info("Found %d files to process", len(files))
 	mainLogger.Trace("Files to process: %v", files)
 	// Somehow connect files to commands via globs..
 	// For each file check every glob of every command
 	// Maybe memoize this part
 	// That way we know what commands affect what files
 	mainLogger.Debug("Associating files with commands")
 	associations, err := utils.AssociateFilesWithCommands(files, commands)
 	if err != nil {
 		mainLogger.Error("Failed to associate files with commands: %v", err)
 		return
 	}
 	mainLogger.Debug("Files associated with commands")
 	mainLogger.Trace("File-command associations: %v", associations)
 	// Per-file association summary for better visibility when debugging
 	for file, assoc := range associations {
 		cmdNames := make([]string, 0, len(assoc.Commands))
 		for _, c := range assoc.Commands {
 			cmdNames = append(cmdNames, c.Name)
 		}
 		isoNames := make([]string, 0, len(assoc.IsolateCommands))
 		for _, c := range assoc.IsolateCommands {
 			isoNames = append(isoNames, c.Name)
 		}
 		mainLogger.Debug("File %q has %d regular and %d isolate commands", file, len(assoc.Commands), len(assoc.IsolateCommands))
 		mainLogger.Trace("\tRegular: %v", cmdNames)
 		mainLogger.Trace("\tIsolate: %v", isoNames)
 	}
 	mainLogger.Debug("Resetting files where necessary")
 	err = utils.ResetWhereNecessary(associations, db)
 	if err != nil {
 		mainLogger.Error("Failed to reset files where necessary: %v", err)
 		return
 	}
 	mainLogger.Debug("Files reset where necessary")
 	// Then for each file run all commands associated with the file
 	workers := make(chan struct{}, *utils.ParallelFiles)
 	wg := sync.WaitGroup{}
 	mainLogger.Debug("Starting file processing with %d parallel workers", *utils.ParallelFiles)
 	// Add performance tracking
 	startTime := time.Now()
 	// Create a map to store loggers for each command
 	commandLoggers := make(map[string]*logger.Logger)
 	for _, command := range commands {
 		// Create a named logger for each command
 		cmdName := command.Name
 		if cmdName == "" {
 			// If no name is provided, use a short version of the regex pattern
 			if len(command.Regex) > 20 {
 				cmdName = command.Regex[:17] + "..."
 			} else {
 				cmdName = command.Regex
 			}
 		}
 		// Parse the log level for this specific command
 		cmdLogLevel := logger.ParseLevel(command.LogLevel)
 		// Create a logger with the command name as a field
 		commandLoggers[command.Name] = logger.Default.WithField("command", cmdName)
 		commandLoggers[command.Name].SetLevel(cmdLogLevel)
 		mainLogger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
 	}
 	for file, association := range associations {
 		workers <- struct{}{}
 		wg.Add(1)
 		logger.SafeGoWithArgs(func(args ...interface{}) {
 			defer func() { <-workers }()
 			defer wg.Done()
 			// Track per-file processing time
 			fileStartTime := time.Now()
 			mainLogger.Debug("Reading file %q", file)
 			fileData, err := os.ReadFile(file)
 			if err != nil {
 				mainLogger.Error("Failed to read file %q: %v", file, err)
 				atomic.AddInt64(&stats.FailedFiles, 1)
 				return
 			}
 			fileDataStr := string(fileData)
 			mainLogger.Trace("File %q content: %s", file, utils.LimitString(fileDataStr, 500))
 			isChanged := false
 			mainLogger.Debug("Running isolate commands for file %q", file)
 			fileDataStr, err = RunIsolateCommands(association, file, fileDataStr)
 			if err != nil && err != NothingToDo {
 				mainLogger.Error("Failed to run isolate commands for file %q: %v", file, err)
 				atomic.AddInt64(&stats.FailedFiles, 1)
 				return
 			}
 			if err != NothingToDo {
 				isChanged = true
 			}
 			mainLogger.Debug("Running other commands for file %q", file)
 			fileDataStr, err = RunOtherCommands(file, fileDataStr, association, commandLoggers)
 			if err != nil && err != NothingToDo {
 				mainLogger.Error("Failed to run other commands for file %q: %v", file, err)
 				atomic.AddInt64(&stats.FailedFiles, 1)
 				return
 			}
 			if err != NothingToDo {
 				isChanged = true
 			}
 			if isChanged {
 				mainLogger.Debug("Saving file %q to database", file)
 				err = db.SaveFile(file, fileData)
 				if err != nil {
 					mainLogger.Error("Failed to save file %q to database: %v", file, err)
 					atomic.AddInt64(&stats.FailedFiles, 1)
 					return
 				}
 				mainLogger.Debug("File %q saved to database", file)
 			}
 			mainLogger.Debug("Writing file %q", file)
 			err = os.WriteFile(file, []byte(fileDataStr), 0644)
 			if err != nil {
 				mainLogger.Error("Failed to write file %q: %v", file, err)
 				atomic.AddInt64(&stats.FailedFiles, 1)
 				return
 			}
 			mainLogger.Debug("File %q written", file)
 			// Only increment ProcessedFiles once per file, after all processing is complete
 			atomic.AddInt64(&stats.ProcessedFiles, 1)
 			mainLogger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
 		}, file, commands)
 	}
 	wg.Wait()
 	processingTime := time.Since(startTime)
 	mainLogger.Info("Processing completed in %v", processingTime)
 	processedFiles := atomic.LoadInt64(&stats.ProcessedFiles)
 	if processedFiles > 0 {
 		mainLogger.Info("Average time per file: %v", processingTime/time.Duration(processedFiles))
 	}
 	// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
 	// Do that with logger.WithField("loglevel", level.String())
 	// Since each command also has its own log level
 	// TODO: Maybe even figure out how to run individual commands...?
 	// TODO: What to do with git? Figure it out ....
 	// if *gitFlag {
 	// 	mainLogger.Info("Git integration enabled, setting up git repository")
 	// 	err := setupGit()
 	// 	if err != nil {
 	// 		mainLogger.Error("Failed to setup git: %v", err)
 	// 		fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
 	// 		return
 	// 	}
 	// }
 	// mainLogger.Debug("Expanding file patterns")
 	// files, err := expandFilePatterns(filePatterns)
 	// if err != nil {
 	// 	mainLogger.Error("Failed to expand file patterns: %v", err)
 	// 	fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
 	// 	return
 	// }
 	// if *gitFlag {
 	// 	mainLogger.Info("Cleaning up git files before processing")
 	// 	err := cleanupGitFiles(files)
 	// 	if err != nil {
 	// 		mainLogger.Error("Failed to cleanup git files: %v", err)
 	// 		fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
 	// 		return
 	// 	}
 	// }
 	// if *resetFlag {
 	// 	mainLogger.Info("Files reset to their original state, nothing more to do")
 	// 	log.Printf("Files reset to their original state, nothing more to do")
 	// 	return
 	// }
 	// Print summary
-	if stats.TotalModifications == 0 {
+	totalModifications := atomic.LoadInt64(&stats.TotalModifications)
-		fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
+	if totalModifications == 0 {
 		mainLogger.Warning("No modifications were made in any files")
 	} else {
-		fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
+		failedFiles := atomic.LoadInt64(&stats.FailedFiles)
-			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
+		mainLogger.Info("Operation complete! Modified %d values in %d/%d files",
-	}
+			totalModifications, processedFiles, processedFiles+failedFiles)
-}
+		sortedCommands := []string{}
 		stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
 			sortedCommands = append(sortedCommands, key.(string))
 			return true
 		})
 		sort.Strings(sortedCommands)
-func setupGit() error {
+		for _, command := range sortedCommands {
-	cwd, err := os.Getwd()
+			count, _ := stats.ModificationsPerCommand.Load(command)
-	if err != nil {
+			if count.(int) > 0 {
-		return fmt.Errorf("failed to get current working directory: %w", err)
+				mainLogger.Info("\tCommand %q made %d modifications", command, count)
 	}
 	logger.Printf("Current working directory obtained: %s", cwd)
 	logger.Printf("Attempting to open git repository at %s", cwd)
 	repo, err = git.PlainOpen(cwd)
 	if err != nil {
 		logger.Printf("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
 		repo, err = git.PlainInit(cwd, false)
 		if err != nil {
 			return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
 		}
 		logger.Printf("Successfully initialized a new git repository at %s", cwd)
 			} else {
-		logger.Printf("Successfully opened existing git repository at %s", cwd)
+				mainLogger.Warning("\tCommand %q made no modifications", command)
 			}
 		}
 	}
 }
-	logger.Printf("Attempting to obtain worktree for repository at %s", cwd)
+func HandleSpecialArgs(args []string, err error, db utils.DB) (bool, error) {
-	worktree, err = repo.Worktree()
+	handleSpecialArgsLogger := logger.Default.WithPrefix("HandleSpecialArgs")
 	handleSpecialArgsLogger.Debug("Handling special arguments: %v", args)
 	switch args[0] {
 	case "reset":
 		handleSpecialArgsLogger.Info("Resetting all files")
 		err = utils.ResetAllFiles(db)
 		if err != nil {
-		return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
+			handleSpecialArgsLogger.Error("Failed to reset all files: %v", err)
 			return true, err
 		}
-	logger.Printf("Successfully obtained worktree for repository at %s", cwd)
+		handleSpecialArgsLogger.Info("All files reset")
-	return nil
+		return true, nil
-}
+	case "dump":
-
+		handleSpecialArgsLogger.Info("Dumping all files from database")
-func expandFilePatterns(patterns []string) ([]string, error) {
+		err = db.RemoveAllFiles()
 	var files []string
 	filesMap := make(map[string]bool)
 	for _, pattern := range patterns {
 		matches, _ := doublestar.Glob(os.DirFS("."), pattern)
 		for _, m := range matches {
 			if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
 				filesMap[m], files = true, append(files, m)
 			}
 		}
 	}
 	if len(files) > 0 {
 		logger.Printf("Found %d files to process", len(files))
 	}
 	return files, nil
 }
 func cleanupGitFiles(files []string) error {
 	for _, file := range files {
 		logger.Printf("Checking file: %s", file)
 		status, err := worktree.Status()
 		if err != nil {
-			fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
+			handleSpecialArgsLogger.Error("Failed to remove all files from database: %v", err)
-			return fmt.Errorf("error getting worktree status: %w", err)
+			return true, err
 		}
-		if status.IsUntracked(file) {
+		handleSpecialArgsLogger.Info("All files removed from database")
-			logger.Printf("Detected untracked file: %s. Attempting to add it to the git index.", file)
+		return true, nil
-			_, err = worktree.Add(file)
+	}
-			if err != nil {
+	handleSpecialArgsLogger.Debug("No special arguments handled, returning false")
-				fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
+	return false, nil
 				return fmt.Errorf("error adding file to git: %w", err)
 }
-			filename := filepath.Base(file)
+func CreateExampleConfig() {
-			logger.Printf("File %s added successfully. Now committing it with message: 'Track %s'", filename, filename)
+	createExampleConfigLogger := logger.Default.WithPrefix("CreateExampleConfig")
-			_, err = worktree.Commit("Track "+filename, &git.CommitOptions{
+	createExampleConfigLogger.Debug("Creating example configuration file")
-				Author: &object.Signature{
+	commands := []utils.ModifyCommand{
-					Name:  "Big Chef",
+		// Global modifiers only entry (no name/regex/lua/files)
-					Email: "bigchef@bigchef.com",
+		{
-					When:  time.Now(),
+			Modifiers: map[string]interface{}{
 				"foobar":   4,
 				"multiply": 1.5,
 				"prefix":   "NEW_",
 				"enabled":  true,
 			},
 		},
 		// Multi-regex example using $variable in Lua
 		{
 			Name:    "RFToolsMultiply",
 			Regexes: []string{"generatePerTick = !num", "ticksPer\\w+ = !num", "generatorRFPerTick = !num"},
 			Lua:     "* $foobar",
 			Files:   []string{"polymc/instances/**/rftools*.toml", `polymc\\instances\\**\\rftools*.toml`},
 			Reset:   true,
 			// LogLevel defaults to INFO
 		},
 		// Named capture groups with arithmetic and string ops
 		{
 			Name:  "UpdateAmountsAndItems",
 			Regex: `(?P<amount>!num)\s+units\s+of\s+(?P<item>[A-Za-z_\-]+)`,
 			Lua:   `amount = amount * $multiply; item = upper(item); return true`,
 			Files: []string{"data/**/*.txt"},
 			// INFO log level
 		},
 		// Full replacement via Lua 'replacement' variable
 		{
 			Name:  "BumpMinorVersion",
 			Regex: `version\s*=\s*"(?P<major>!num)\.(?P<minor>!num)\.(?P<patch>!num)"`,
 			Lua:   `replacement = format("version=\"%s.%s.%s\"", major, num(minor)+1, 0); return true`,
 			Files: []string{"config/*.ini", "config/*.cfg"},
 		},
 		// Multiline regex example (DOTALL is auto-enabled). Captures numeric in nested XML.
 		{
 			Name:  "XMLNestedValueMultiply",
 			Regex: `<item>\s*\s*<name>!any<\/name>\s*\s*<value>(!num)<\/value>\s*\s*<\/item>`,
 			Lua:   `* $multiply`,
 			Files: []string{"data/**/*.xml"},
 			// Demonstrates multiline regex in YAML
 		},
 		// Multiline regexES array, with different patterns handled by same Lua
 		{
 			Name: "MultiLinePatterns",
 			Regexes: []string{
 				`<entry>\s*\n\s*<id>(?P<id>!num)</id>\s*\n\s*<score>(?P<score>!num)</score>\s*\n\s*</entry>`,
 				`\[block\]\nkey=(?P<key>[A-Za-z_]+)\nvalue=(?P<val>!num)`,
 			},
 			Lua:      `if is_number(score) then score = score * 2 end; if is_number(val) then val = val * 3 end; return true`,
 			Files:    []string{"examples/**/*.*"},
 			LogLevel: "DEBUG",
 		},
 		// Use equals operator shorthand and boolean variable
 		{
 			Name:  "EnableFlags",
 			Regex: `enabled\s*=\s*(true|false)`,
 			Lua:   `= $enabled`,
 			Files: []string{"**/*.toml"},
 		},
 		// Demonstrate NoDedup to allow overlapping replacements
 		{
 			Name:    "OverlappingGroups",
 			Regex:   `(?P<a>!num)(?P<b>!num)`,
 			Lua:     `a = num(a) + 1; b = num(b) + 1; return true`,
 			Files:   []string{"overlap/**/*.txt"},
 			NoDedup: true,
 		},
 		// Isolate command example operating on entire matched block
 		{
 			Name:     "IsolateUppercaseBlock",
 			Regex:    `BEGIN\n(?P<block>!any)\nEND`,
 			Lua:      `block = upper(block); return true`,
 			Files:    []string{"logs/**/*.log"},
 			Isolate:  true,
 			LogLevel: "TRACE",
 		},
 		// Using !rep placeholder and arrays of files
 		{
 			Name:  "RepeatPlaceholderExample",
 			Regex: `name: (.*) !rep(, .* , 2)`,
 			Lua:   `-- no-op, just demonstrate placeholder; return false`,
 			Files: []string{"lists/**/*.yml", "lists/**/*.yaml"},
 		},
 		// Using string variable in Lua expression
 		{
 			Name:  "PrefixKeys",
 			Regex: `(?P<key>[A-Za-z0-9_]+)\s*=`,
 			Lua:   `key = $prefix .. key; return true`,
 			Files: []string{"**/*.properties"},
 		},
 		// JSON mode examples
 		{
 			Name:  "JSONArrayMultiply",
 			JSON:  true,
 			Lua:   `for i, item in ipairs(data.items) do data.items[i].value = item.value * 2 end; return true`,
 			Files: []string{"data/**/*.json"},
 		},
 		{
 			Name:  "JSONObjectUpdate",
 			JSON:  true,
 			Lua:   `data.version = "2.0.0"; data.enabled = true; return true`,
 			Files: []string{"config/**/*.json"},
 		},
 		{
 			Name:  "JSONNestedModify",
 			JSON:  true,
 			Lua:   `if data.settings and data.settings.performance then data.settings.performance.multiplier = data.settings.performance.multiplier * 1.5 end; return true`,
 			Files: []string{"settings/**/*.json"},
 		},
 			})
 			if err != nil {
 				fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
 				return fmt.Errorf("error committing file: %w", err)
 	}
-			logger.Printf("Successfully committed file: %s with message: 'Track %s'", filename, filename)
+
 	data, err := yaml.Marshal(commands)
 	if err != nil {
 		createExampleConfigLogger.Error("Failed to marshal example config: %v", err)
 		return
 	}
 	createExampleConfigLogger.Debug("Writing example_cook.yml")
 	err = os.WriteFile("example_cook.yml", data, 0644)
 	if err != nil {
 		createExampleConfigLogger.Error("Failed to write example_cook.yml: %v", err)
 		return
 	}
 	createExampleConfigLogger.Info("Wrote example_cook.yml")
 }
 var NothingToDo = errors.New("nothing to do")
 func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, commandLoggers map[string]*logger.Logger) (string, error) {
 	runOtherCommandsLogger := mainLogger.WithPrefix("RunOtherCommands").WithField("file", file)
 	runOtherCommandsLogger.Debug("Running other commands for file")
 	runOtherCommandsLogger.Trace("File data before modifications: %s", utils.LimitString(fileDataStr, 200))
 	// Separate JSON and regex commands for different processing approaches
 	jsonCommands := []utils.ModifyCommand{}
 	regexCommands := []utils.ModifyCommand{}
 	for _, command := range association.Commands {
 		if command.JSON || *utils.JSON {
 			jsonCommands = append(jsonCommands, command)
 		} else {
-			logger.Printf("File %s is already tracked. Restoring it to the working tree.", file)
+			regexCommands = append(regexCommands, command)
-			err := worktree.Restore(&git.RestoreOptions{
+		}
-				Files:    []string{file},
+	}
-				Staged:   true,
+
-				Worktree: true,
+	// Process JSON commands sequentially (each operates on the entire file)
-			})
+	for _, command := range jsonCommands {
 		cmdLogger := logger.Default
 		if cmdLog, ok := commandLoggers[command.Name]; ok {
 			cmdLogger = cmdLog
 		}
 		cmdLogger.Debug("Processing file with JSON mode for command %q", command.Name)
 		newModifications, err := processor.ProcessJSON(fileDataStr, command, file)
 		if err != nil {
-				fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
+			runOtherCommandsLogger.Error("Failed to process file with JSON command %q: %v", command.Name, err)
-				return fmt.Errorf("error restoring file: %w", err)
+			continue
 		}
-			logger.Printf("File %s restored successfully.", file)
+
 		// Apply JSON modifications immediately
 		if len(newModifications) > 0 {
 			var count int
 			fileDataStr, count = utils.ExecuteModifications(newModifications, fileDataStr)
 			atomic.AddInt64(&stats.TotalModifications, int64(count))
 			cmdLogger.Debug("Applied %d JSON modifications for command %q", count, command.Name)
 		}
 		count, ok := stats.ModificationsPerCommand.Load(command.Name)
 		if !ok {
 			count = 0
 		}
 		stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
 	}
 	// Aggregate regex modifications and execute them
 	modifications := []utils.ReplaceCommand{}
 	numCommandsConsidered := 0
 	for _, command := range regexCommands {
 		cmdLogger := logger.Default
 		if cmdLog, ok := commandLoggers[command.Name]; ok {
 			cmdLogger = cmdLog
 		}
 		patterns := command.Regexes
 		if len(patterns) == 0 {
 			patterns = []string{command.Regex}
 		}
 		for idx, pattern := range patterns {
 			tmpCmd := command
 			tmpCmd.Regex = pattern
 			cmdLogger.Debug("Begin processing file with command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
 			numCommandsConsidered++
 			newModifications, err := processor.ProcessRegex(fileDataStr, tmpCmd, file)
 			if err != nil {
 				runOtherCommandsLogger.Error("Failed to process file with command %q: %v", command.Name, err)
 				continue
 			}
 			modifications = append(modifications, newModifications...)
 			count, ok := stats.ModificationsPerCommand.Load(command.Name)
 			if !ok {
 				count = 0
 			}
 			stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
 			cmdLogger.Debug("Command %q generated %d modifications (pattern %d/%d)", command.Name, len(newModifications), idx+1, len(patterns))
 			cmdLogger.Trace("Modifications generated by command %q: %v", command.Name, newModifications)
 			if len(newModifications) == 0 {
 				cmdLogger.Debug("No modifications yielded by command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
 			}
 		}
-	return nil
+	}
 	runOtherCommandsLogger.Debug("Aggregated %d modifications from %d command-pattern runs", len(modifications), numCommandsConsidered)
 	runOtherCommandsLogger.Trace("All aggregated modifications: %v", modifications)
 	if len(modifications) == 0 {
 		runOtherCommandsLogger.Warning("No modifications found for file")
 		return fileDataStr, NothingToDo
 	}
 	runOtherCommandsLogger.Debug("Executing %d modifications for file", len(modifications))
 	// Sort commands in reverse order for safe replacements
 	var count int
 	fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
 	runOtherCommandsLogger.Trace("File data after modifications: %s", utils.LimitString(fileDataStr, 200))
 	atomic.AddInt64(&stats.TotalModifications, int64(count))
 	runOtherCommandsLogger.Info("Executed %d modifications for file", count)
 	return fileDataStr, nil
 }
 func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string) (string, error) {
 	runIsolateCommandsLogger := mainLogger.WithPrefix("RunIsolateCommands").WithField("file", file)
 	runIsolateCommandsLogger.Debug("Running isolate commands for file")
 	runIsolateCommandsLogger.Trace("File data before isolate modifications: %s", utils.LimitString(fileDataStr, 200))
 	anythingDone := false
 	for _, isolateCommand := range association.IsolateCommands {
 		// Check if this isolate command should use JSON mode
 		if isolateCommand.JSON || *utils.JSON {
 			runIsolateCommandsLogger.Debug("Begin processing file with JSON isolate command %q", isolateCommand.Name)
 			modifications, err := processor.ProcessJSON(fileDataStr, isolateCommand, file)
 			if err != nil {
 				runIsolateCommandsLogger.Error("Failed to process file with JSON isolate command %q: %v", isolateCommand.Name, err)
 				continue
 			}
 			if len(modifications) == 0 {
 				runIsolateCommandsLogger.Debug("JSON isolate command %q produced no modifications", isolateCommand.Name)
 				continue
 			}
 			anythingDone = true
 			runIsolateCommandsLogger.Debug("Executing %d JSON isolate modifications for file", len(modifications))
 			runIsolateCommandsLogger.Trace("JSON isolate modifications: %v", modifications)
 			var count int
 			fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
 			runIsolateCommandsLogger.Trace("File data after JSON isolate modifications: %s", utils.LimitString(fileDataStr, 200))
 			atomic.AddInt64(&stats.TotalModifications, int64(count))
 			runIsolateCommandsLogger.Info("Executed %d JSON isolate modifications for file", count)
 		} else {
 			// Regular regex processing for isolate commands
 			runIsolateCommandsLogger.Debug("Begin processing file with isolate command %q", isolateCommand.Regex)
 			patterns := isolateCommand.Regexes
 			if len(patterns) == 0 {
 				patterns = []string{isolateCommand.Regex}
 			}
 			for idx, pattern := range patterns {
 				tmpCmd := isolateCommand
 				tmpCmd.Regex = pattern
 				modifications, err := processor.ProcessRegex(fileDataStr, tmpCmd, file)
 				if err != nil {
 					runIsolateCommandsLogger.Error("Failed to process file with isolate command %q (pattern %d/%d): %v", isolateCommand.Name, idx+1, len(patterns), err)
 					continue
 				}
 				if len(modifications) == 0 {
 					runIsolateCommandsLogger.Debug("Isolate command %q produced no modifications (pattern %d/%d)", isolateCommand.Name, idx+1, len(patterns))
 					continue
 				}
 				anythingDone = true
 				runIsolateCommandsLogger.Debug("Executing %d isolate modifications for file", len(modifications))
 				runIsolateCommandsLogger.Trace("Isolate modifications: %v", modifications)
 				var count int
 				fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
 				runIsolateCommandsLogger.Trace("File data after isolate modifications: %s", utils.LimitString(fileDataStr, 200))
 				atomic.AddInt64(&stats.TotalModifications, int64(count))
 				runIsolateCommandsLogger.Info("Executed %d isolate modifications for file", count)
 			}
 		}
 	}
 	if !anythingDone {
 		runIsolateCommandsLogger.Debug("No isolate modifications were made for file")
 		return fileDataStr, NothingToDo
 	}
 	return fileDataStr, nil
 }
--- a/processor/json.go
+++ b/processor/json.go
@@ -1,165 +1,216 @@
 package processor
 import (
 	"cook/utils"
 	"encoding/json"
 	"fmt"
-	"log"
+	"time"
 	"modify/processor/jsonpath"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
 )
-// JSONProcessor implements the Processor interface for JSON documents
+// jsonLogger is a scoped logger for the processor/json package.
-type JSONProcessor struct{}
+var jsonLogger = logger.Default.WithPrefix("processor/json")
-// ProcessContent implements the Processor interface for JSONProcessor
+// ProcessJSON applies Lua processing to JSON content
-func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
+func ProcessJSON(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
-	// Parse JSON document
+	processJsonLogger := jsonLogger.WithPrefix("ProcessJSON").WithField("commandName", command.Name).WithField("file", filename)
 	processJsonLogger.Debug("Starting JSON processing for file")
 	processJsonLogger.Trace("Initial file content length: %d", len(content))
 	var commands []utils.ReplaceCommand
 	startTime := time.Now()
 	// Parse JSON content
 	var jsonData interface{}
 	err := json.Unmarshal([]byte(content), &jsonData)
 	if err != nil {
-		return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
+		processJsonLogger.Error("Failed to parse JSON content: %v", err)
 		return commands, fmt.Errorf("failed to parse JSON: %v", err)
 	}
 	processJsonLogger.Debug("Successfully parsed JSON content")
-	// Find nodes matching the JSONPath pattern
+	// Create Lua state
 	nodes, err := jsonpath.Get(jsonData, pattern)
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
 	}
 	matchCount := len(nodes)
 	if matchCount == 0 {
 		return content, 0, 0, nil
 	}
 	modCount := 0
 	for _, node := range nodes {
 		log.Printf("Processing node at path: %s with value: %v", node.Path, node.Value)
 		// Initialize Lua
 	L, err := NewLuaState()
 	if err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
+		processJsonLogger.Error("Error creating Lua state: %v", err)
 		return commands, fmt.Errorf("error creating Lua state: %v", err)
 	}
 	defer L.Close()
 		log.Println("Lua state initialized successfully.")
-		err = p.ToLua(L, node.Value)
+	// Set filename global
 	L.SetGlobal("file", lua.LString(filename))
 	// Convert JSON data to Lua table
 	luaTable, err := ToLuaTable(L, jsonData)
 	if err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
+		processJsonLogger.Error("Failed to convert JSON to Lua table: %v", err)
 		return commands, fmt.Errorf("failed to convert JSON to Lua table: %v", err)
 	}
 		log.Printf("Converted node value to Lua: %v", node.Value)
-		originalScript := luaExpr
+	// Set the JSON data as a global variable
-		fullScript := BuildLuaScript(luaExpr)
+	L.SetGlobal("data", luaTable)
-		log.Printf("Original script: %q, Full script: %q", originalScript, fullScript)
+	processJsonLogger.Debug("Set JSON data as Lua global 'data'")
-		// Execute Lua script
+	// Build and execute Lua script for JSON mode
-		log.Printf("Executing Lua script: %q", fullScript)
+	luaExpr := BuildJSONLuaScript(command.Lua)
-		if err := L.DoString(fullScript); err != nil {
+	processJsonLogger.Debug("Built Lua script from expression: %q", command.Lua)
-			return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
+	processJsonLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
 	if err := L.DoString(luaExpr); err != nil {
 		processJsonLogger.Error("Lua script execution failed: %v\nScript: %s", err, utils.LimitString(luaExpr, 200))
 		return commands, fmt.Errorf("lua script execution failed: %v", err)
 	}
-		log.Println("Lua script executed successfully.")
+	processJsonLogger.Debug("Lua script executed successfully")
-		// Get modified value
+	// Check if modification flag is set
-		result, err := p.FromLua(L)
+	modifiedVal := L.GetGlobal("modified")
 	if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
 		processJsonLogger.Debug("Skipping - no modifications indicated by Lua script")
 		return commands, nil
 	}
 	// Get the modified data from Lua
 	modifiedData := L.GetGlobal("data")
 	if modifiedData.Type() != lua.LTTable {
 		processJsonLogger.Error("Expected 'data' to be a table after Lua processing, got %s", modifiedData.Type().String())
 		return commands, fmt.Errorf("expected 'data' to be a table after Lua processing")
 	}
 	// Convert back to Go interface
 	goData, err := FromLua(L, modifiedData)
 	if err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
+		processJsonLogger.Error("Failed to convert Lua table back to Go: %v", err)
-		}
+		return commands, fmt.Errorf("failed to convert Lua table back to Go: %v", err)
 		log.Printf("Retrieved modified value from Lua: %v", result)
 		modified := false
 		modified = L.GetGlobal("modified").String() == "true"
 		if !modified {
 			log.Printf("No changes made to node at path: %s", node.Path)
 			continue
 	}
-		// Apply the modification to the JSON data
+	// Marshal back to JSON
-		err = p.updateJSONValue(jsonData, node.Path, result)
+	modifiedJSON, err := json.MarshalIndent(goData, "", "  ")
 	if err != nil {
-			return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
+		processJsonLogger.Error("Failed to marshal modified data to JSON: %v", err)
-		}
+		return commands, fmt.Errorf("failed to marshal modified data to JSON: %v", err)
 		log.Printf("Updated JSON at path: %s with new value: %v", node.Path, result)
 		modCount++
 	}
-	// Convert the modified JSON back to a string with same formatting
+	// Create replacement command for the entire file
-	var jsonBytes []byte
+	// For JSON mode, we always replace the entire content
-	jsonBytes, err = json.MarshalIndent(jsonData, "", "  ")
+	commands = append(commands, utils.ReplaceCommand{
-	if err != nil {
+		From: 0,
-		return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
+		To:   len(content),
-	}
+		With: string(modifiedJSON),
-	return string(jsonBytes), modCount, matchCount, nil
+	})
 	processJsonLogger.Debug("Total JSON processing time: %v", time.Since(startTime))
 	processJsonLogger.Debug("Generated %d total modifications", len(commands))
 	return commands, nil
 }
-// updateJSONValue updates a value in the JSON structure based on its JSONPath
+// ToLuaTable converts a Go interface{} to a Lua table recursively
-func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
+func ToLuaTable(L *lua.LState, data interface{}) (*lua.LTable, error) {
-	// Special handling for root node
+	toLuaTableLogger := jsonLogger.WithPrefix("ToLuaTable")
-	if path == "$" {
+	toLuaTableLogger.Debug("Converting Go interface to Lua table")
-		// For the root node, we'll copy the value to the jsonData reference
+	toLuaTableLogger.Trace("Input data type: %T", data)
 		// This is a special case since we can't directly replace the interface{} variable
-		// We need to handle different types of root elements
+	switch v := data.(type) {
 		switch rootValue := newValue.(type) {
 	case map[string]interface{}:
-			// For objects, we need to copy over all keys
+		toLuaTableLogger.Debug("Converting map to Lua table")
-			rootMap, ok := jsonData.(map[string]interface{})
+		table := L.CreateTable(0, len(v))
-			if !ok {
+		for key, value := range v {
-				// If the original wasn't a map, completely replace it with the new map
+			luaValue, err := ToLuaValue(L, value)
-				// This is handled by the jsonpath.Set function
+			if err != nil {
-				return jsonpath.Set(jsonData, path, newValue)
+				toLuaTableLogger.Error("Failed to convert map value for key %q: %v", key, err)
 				return nil, err
 			}
-
+			table.RawSetString(key, luaValue)
 			// Clear the original map
 			for k := range rootMap {
 				delete(rootMap, k)
 		}
-
+		return table, nil
 			// Copy all keys from the new map
 			for k, v := range rootValue {
 				rootMap[k] = v
 			}
 			return nil
 	case []interface{}:
-			// For arrays, we need to handle similarly
+		toLuaTableLogger.Debug("Converting slice to Lua table")
-			rootArray, ok := jsonData.([]interface{})
+		table := L.CreateTable(len(v), 0)
-			if !ok {
+		for i, value := range v {
-				// If the original wasn't an array, use jsonpath.Set
+			luaValue, err := ToLuaValue(L, value)
-				return jsonpath.Set(jsonData, path, newValue)
+			if err != nil {
 				toLuaTableLogger.Error("Failed to convert slice value at index %d: %v", i, err)
 				return nil, err
 			}
 			table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
 		}
 		return table, nil
-			// Clear and recreate the array
+	case string:
-			*&rootArray = rootValue
+		toLuaTableLogger.Debug("Converting string to Lua string")
-			return nil
+		return nil, fmt.Errorf("expected table or array, got string")
 	case float64:
 		toLuaTableLogger.Debug("Converting float64 to Lua number")
 		return nil, fmt.Errorf("expected table or array, got number")
 	case bool:
 		toLuaTableLogger.Debug("Converting bool to Lua boolean")
 		return nil, fmt.Errorf("expected table or array, got boolean")
 	case nil:
 		toLuaTableLogger.Debug("Converting nil to Lua nil")
 		return nil, fmt.Errorf("expected table or array, got nil")
 	default:
-			// For other types, use jsonpath.Set
+		toLuaTableLogger.Error("Unsupported type for Lua table conversion: %T", v)
-			return jsonpath.Set(jsonData, path, newValue)
+		return nil, fmt.Errorf("unsupported type for Lua table conversion: %T", v)
 	}
 }
-	// For non-root paths, use the regular Set method
+// ToLuaValue converts a Go interface{} to a Lua value
-	err := jsonpath.Set(jsonData, path, newValue)
+func ToLuaValue(L *lua.LState, data interface{}) (lua.LValue, error) {
 	toLuaValueLogger := jsonLogger.WithPrefix("ToLuaValue")
 	toLuaValueLogger.Debug("Converting Go interface to Lua value")
 	toLuaValueLogger.Trace("Input data type: %T", data)
 	switch v := data.(type) {
 	case map[string]interface{}:
 		toLuaValueLogger.Debug("Converting map to Lua table")
 		table := L.CreateTable(0, len(v))
 		for key, value := range v {
 			luaValue, err := ToLuaValue(L, value)
 			if err != nil {
-		return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
+				toLuaValueLogger.Error("Failed to convert map value for key %q: %v", key, err)
 				return lua.LNil, err
 			}
-	return nil
+			table.RawSetString(key, luaValue)
 		}
 		return table, nil
-// ToLua converts JSON values to Lua variables
+	case []interface{}:
-func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
+		toLuaValueLogger.Debug("Converting slice to Lua table")
-	table, err := ToLua(L, data)
+		table := L.CreateTable(len(v), 0)
 		for i, value := range v {
 			luaValue, err := ToLuaValue(L, value)
 			if err != nil {
-		return err
+				toLuaValueLogger.Error("Failed to convert slice value at index %d: %v", i, err)
 				return lua.LNil, err
 			}
-	L.SetGlobal("v", table)
+			table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
 	return nil
 		}
 		return table, nil
-// FromLua retrieves values from Lua
+	case string:
-func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
+		toLuaValueLogger.Debug("Converting string to Lua string")
-	luaValue := L.GetGlobal("v")
+		return lua.LString(v), nil
-	return FromLua(L, luaValue)
+
 	case float64:
 		toLuaValueLogger.Debug("Converting float64 to Lua number")
 		return lua.LNumber(v), nil
 	case bool:
 		toLuaValueLogger.Debug("Converting bool to Lua boolean")
 		return lua.LBool(v), nil
 	case nil:
 		toLuaValueLogger.Debug("Converting nil to Lua nil")
 		return lua.LNil, nil
 	default:
 		toLuaValueLogger.Error("Unsupported type for Lua value conversion: %T", v)
 		return lua.LNil, fmt.Errorf("unsupported type for Lua value conversion: %T", v)
 	}
 }
--- a/processor/json_test.go
+++ b/processor/json_test.go
--- a/processor/jsonpath/jsonpath.go
+++ b/processor/jsonpath/jsonpath.go
@@ -1,490 +0,0 @@
 package jsonpath
 import (
 	"fmt"
 	"strconv"
 )
 // JSONStep represents a single step in a JSONPath query
 type JSONStep struct {
 	Type  StepType
 	Key   string // For Child/RecursiveDescent
 	Index int    // For Index (use -1 for wildcard "*")
 }
 // JSONNode represents a value in the JSON data with its path
 type JSONNode struct {
 	Value interface{} // The value found at the path
 	Path  string      // The exact JSONPath where the value was found
 }
 // StepType defines the types of steps in a JSONPath
 type StepType int
 const (
 	RootStep             StepType = iota // $ - The root element
 	ChildStep                            // .key - Direct child access
 	RecursiveDescentStep                 // ..key - Recursive search for key
 	WildcardStep                         // .* - All children of an object
 	IndexStep                            // [n] - Array index access (or [*] for all elements)
 )
 // TraversalMode determines how the traversal behaves
 type TraversalMode int
 const (
 	CollectMode     TraversalMode = iota // Just collect matched nodes
 	ModifyFirstMode                      // Modify first matching node
 	ModifyAllMode                        // Modify all matching nodes
 )
 // ParseJSONPath parses a JSONPath string into a sequence of steps
 func ParseJSONPath(path string) ([]JSONStep, error) {
 	if len(path) == 0 || path[0] != '$' {
 		return nil, fmt.Errorf("path must start with $; received: %q", path)
 	}
 	steps := []JSONStep{}
 	i := 0
 	for i < len(path) {
 		switch path[i] {
 		case '$':
 			steps = append(steps, JSONStep{Type: RootStep})
 			i++
 		case '.':
 			i++
 			if i < len(path) && path[i] == '.' {
 				// Recursive descent
 				i++
 				key, nextPos := readKey(path, i)
 				steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
 				i = nextPos
 			} else {
 				// Child step or wildcard
 				key, nextPos := readKey(path, i)
 				if key == "*" {
 					steps = append(steps, JSONStep{Type: WildcardStep})
 				} else {
 					steps = append(steps, JSONStep{Type: ChildStep, Key: key})
 				}
 				i = nextPos
 			}
 		case '[':
 			// Index step
 			i++
 			indexStr, nextPos := readIndex(path, i)
 			if indexStr == "*" {
 				steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
 			} else {
 				index, err := strconv.Atoi(indexStr)
 				if err != nil {
 					return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
 				}
 				steps = append(steps, JSONStep{Type: IndexStep, Index: index})
 			}
 			i = nextPos + 1 // Skip closing ]
 		default:
 			return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
 		}
 	}
 	return steps, nil
 }
 // readKey extracts a key name from the path
 func readKey(path string, start int) (string, int) {
 	i := start
 	for ; i < len(path); i++ {
 		if path[i] == '.' || path[i] == '[' {
 			break
 		}
 	}
 	return path[start:i], i
 }
 // readIndex extracts an array index or wildcard from the path
 func readIndex(path string, start int) (string, int) {
 	i := start
 	for ; i < len(path); i++ {
 		if path[i] == ']' {
 			break
 		}
 	}
 	return path[start:i], i
 }
 // Get retrieves values with their paths from data at the specified JSONPath
 // Each returned JSONNode contains both the value and its exact path in the data structure
 func Get(data interface{}, path string) ([]JSONNode, error) {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	results := []JSONNode{}
 	err = traverseWithPaths(data, steps, &results, "$")
 	if err != nil {
 		return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
 	}
 	return results, nil
 }
 // Set updates the value at the specified JSONPath in the original data structure.
 // It only modifies the first matching node.
 func Set(data interface{}, path string, value interface{}) error {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	success := false
 	err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
 	if err != nil {
 		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
 	}
 	return nil
 }
 // SetAll updates all matching values at the specified JSONPath.
 func SetAll(data interface{}, path string, value interface{}) error {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	success := false
 	err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
 	if err != nil {
 		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
 	}
 	return nil
 }
 // setWithPath modifies values while tracking paths
 func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
 	if node == nil || *success && mode == ModifyFirstMode {
 		return nil
 	}
 	// Skip root step
 	actualSteps := steps
 	if len(steps) > 0 && steps[0].Type == RootStep {
 		actualSteps = steps[1:]
 	}
 	// If we have no steps left, we're setting the root value
 	if len(actualSteps) == 0 {
 		// For the root node, we need to handle it differently depending on what's passed in
 		// since we can't directly replace the interface{} variable
 		// We'll signal success and let the JSONProcessor handle updating the root
 		*success = true
 		return nil
 	}
 	// Process the first step
 	step := actualSteps[0]
 	remainingSteps := actualSteps[1:]
 	isLastStep := len(remainingSteps) == 0
 	switch step.Type {
 	case ChildStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
 		}
 		childPath := currentPath + "." + step.Key
 		if isLastStep {
 			// We've reached the target, set the value
 			m[step.Key] = value
 			*success = true
 			return nil
 		}
 		// Create intermediate nodes if necessary
 		child, exists := m[step.Key]
 		if !exists {
 			// Create missing intermediate node
 			if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
 				child = []interface{}{}
 			} else {
 				child = map[string]interface{}{}
 			}
 			m[step.Key] = child
 		}
 		err := setWithPath(child, remainingSteps, success, value, childPath, mode)
 		if err != nil {
 			return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 		}
 	case IndexStep:
 		arr, ok := node.([]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
 		}
 		// Handle wildcard index
 		if step.Index == -1 {
 			for i, item := range arr {
 				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				if isLastStep {
 					arr[i] = value
 					*success = true
 					if mode == ModifyFirstMode {
 						return nil
 					}
 				} else {
 					err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
 					if err != nil {
 						return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
 					}
 					if *success && mode == ModifyFirstMode {
 						return nil
 					}
 				}
 			}
 			return nil
 		}
 		// Handle specific index
 		if step.Index >= 0 && step.Index < len(arr) {
 			item := arr[step.Index]
 			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
 			if isLastStep {
 				arr[step.Index] = value
 				*success = true
 			} else {
 				err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
 				}
 			}
 		}
 	case RecursiveDescentStep:
 		// For recursive descent, first check direct match at this level
 		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
 			if val, exists := m[step.Key]; exists {
 				directPath := currentPath + "." + step.Key
 				if isLastStep {
 					m[step.Key] = value
 					*success = true
 					if mode == ModifyFirstMode {
 						return nil
 					}
 				} else {
 					err := setWithPath(val, remainingSteps, success, value, directPath, mode)
 					if err != nil {
 						return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
 					}
 					if *success && mode == ModifyFirstMode {
 						return nil
 					}
 				}
 			}
 		}
 		// Then continue recursion to all children
 		switch n := node.(type) {
 		case map[string]interface{}:
 			for k, v := range n {
 				childPath := currentPath + "." + k
 				// Skip keys we've already processed directly
 				if step.Key != "*" && k == step.Key {
 					continue
 				}
 				err := setWithPath(v, steps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		case []interface{}:
 			for i, v := range n {
 				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				err := setWithPath(v, steps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		}
 	case WildcardStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
 		}
 		for k, v := range m {
 			childPath := currentPath + "." + k
 			if isLastStep {
 				m[k] = value
 				*success = true
 				if mode == ModifyFirstMode {
 					return nil
 				}
 			} else {
 				err := setWithPath(v, remainingSteps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		}
 	}
 	return nil
 }
 // traverseWithPaths tracks both nodes and their paths during traversal
 func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
 	if len(steps) == 0 || node == nil {
 		return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
 	}
 	// Skip root step
 	actualSteps := steps
 	if steps[0].Type == RootStep {
 		if len(steps) == 1 {
 			*results = append(*results, JSONNode{Value: node, Path: currentPath})
 			return nil
 		}
 		actualSteps = steps[1:]
 	}
 	// Process the first step
 	step := actualSteps[0]
 	remainingSteps := actualSteps[1:]
 	isLastStep := len(remainingSteps) == 0
 	switch step.Type {
 	case ChildStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node is not a map; actual type: %T", node)
 		}
 		child, exists := m[step.Key]
 		if !exists {
 			return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
 		}
 		childPath := currentPath + "." + step.Key
 		if isLastStep {
 			*results = append(*results, JSONNode{Value: child, Path: childPath})
 		} else {
 			err := traverseWithPaths(child, remainingSteps, results, childPath)
 			if err != nil {
 				return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 			}
 		}
 	case IndexStep:
 		arr, ok := node.([]interface{})
 		if !ok {
 			return fmt.Errorf("node is not an array; actual type: %T", node)
 		}
 		// Handle wildcard index
 		if step.Index == -1 {
 			for i, item := range arr {
 				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				if isLastStep {
 					*results = append(*results, JSONNode{Value: item, Path: itemPath})
 				} else {
 					err := traverseWithPaths(item, remainingSteps, results, itemPath)
 					if err != nil {
 						return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
 					}
 				}
 			}
 			return nil
 		}
 		// Handle specific index
 		if step.Index >= 0 && step.Index < len(arr) {
 			item := arr[step.Index]
 			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
 			if isLastStep {
 				*results = append(*results, JSONNode{Value: item, Path: itemPath})
 			} else {
 				err := traverseWithPaths(item, remainingSteps, results, itemPath)
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
 				}
 			}
 		} else {
 			return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
 		}
 	case RecursiveDescentStep:
 		// For recursive descent, first check direct match at this level
 		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
 			if val, exists := m[step.Key]; exists {
 				directPath := currentPath + "." + step.Key
 				if isLastStep {
 					*results = append(*results, JSONNode{Value: val, Path: directPath})
 				} else {
 					err := traverseWithPaths(val, remainingSteps, results, directPath)
 					if err != nil {
 						return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
 					}
 				}
 			}
 		}
 		// For wildcard, collect this node
 		if step.Key == "*" && isLastStep {
 			*results = append(*results, JSONNode{Value: node, Path: currentPath})
 		}
 		// Then continue recursion to all children
 		switch n := node.(type) {
 		case map[string]interface{}:
 			for k, v := range n {
 				childPath := currentPath + "." + k
 				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		case []interface{}:
 			for i, v := range n {
 				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		}
 	case WildcardStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node is not a map; actual type: %T", node)
 		}
 		for k, v := range m {
 			childPath := currentPath + "." + k
 			if isLastStep {
 				*results = append(*results, JSONNode{Value: v, Path: childPath})
 			} else {
 				err := traverseWithPaths(v, remainingSteps, results, childPath)
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		}
 	}
 	return nil
 }
--- a/processor/jsonpath/jsonpath_get_set_test.go
+++ b/processor/jsonpath/jsonpath_get_set_test.go
@@ -1,577 +0,0 @@
 package jsonpath
 import (
 	"reflect"
 	"testing"
 )
 func TestGetWithPathsBasic(t *testing.T) {
 	tests := []struct {
 		name     string
 		data     map[string]interface{}
 		path     string
 		expected []JSONNode
 		error    bool
 	}{
 		{
 			name: "simple property",
 			data: map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 			path: "$.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.name"},
 			},
 		},
 		{
 			name: "nested property",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"age":  30,
 				},
 			},
 			path: "$.user.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.user.name"},
 			},
 		},
 		{
 			name: "array access",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[1].name",
 			expected: []JSONNode{
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "wildcard",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[*].name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.users[0].name"},
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "recursive descent",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"profile": map[string]interface{}{
 						"email": "john@example.com",
 					},
 				},
 				"admin": map[string]interface{}{
 					"email": "admin@example.com",
 				},
 			},
 			path: "$..email",
 			expected: []JSONNode{
 				{Value: "john@example.com", Path: "$.user.profile.email"},
 				{Value: "admin@example.com", Path: "$.admin.email"},
 			},
 		},
 		{
 			name: "nonexistent path",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 				},
 			},
 			path:     "$.user.email",
 			expected: []JSONNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(tt.data, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("GetWithPaths() returned error: %v", err)
 				}
 				return
 			}
 			// For nonexistent path, we expect empty slice
 			if tt.name == "nonexistent path" {
 				if len(result) > 0 {
 					t.Errorf("GetWithPaths() returned %v, expected empty result", result)
 				}
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For wildcard results, we need to check containment rather than exact order
 			if tt.name == "wildcard" || tt.name == "recursive descent" {
 				// For each expected item, check if it exists in the results by both value and path
 				for _, expected := range tt.expected {
 					found := false
 					for _, r := range result {
 						if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
 							found = true
 							break
 						}
 					}
 					if !found {
 						t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
 					}
 				}
 			} else {
 				// Otherwise check exact equality of both values and paths
 				for i, expected := range tt.expected {
 					if !reflect.DeepEqual(result[i].Value, expected.Value) {
 						t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
 					}
 					if result[i].Path != expected.Path {
 						t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestSet(t *testing.T) {
 	t.Run("simple property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 			"age":  30,
 		}
 		 err := Set(data, "$.name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		if data["name"] != "Jane" {
 			t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
 		}
 	})
 	t.Run("nested property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 		}
 		err := Set(data, "$.user.name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		user, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if user["name"] != "Jane" {
 			t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
 		}
 	})
 	t.Run("array element", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"name": "John", "age": 30},
 				map[string]interface{}{"name": "Jane", "age": 25},
 			},
 		}
 		err := Set(data, "$.users[0].name", "Bob")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		user0, ok := users[0].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if user0["name"] != "Bob" {
 			t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
 		}
 	})
 	t.Run("complex value", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 				"profile": map[string]interface{}{
 					"email": "john@example.com",
 				},
 			},
 		}
 		newProfile := map[string]interface{}{
 			"email": "john.doe@example.com",
 			"phone": "123-456-7890",
 		}
 		err := Set(data, "$.user.profile", newProfile)
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		profile, ok := userMap["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Profile is not a map")
 		}
 		if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
 			t.Errorf("Set() failed: expected profile to be updated with new values")
 		}
 	})
 	t.Run("create new property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		err := Set(data, "$.user.email", "john@example.com")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if email, exists := userMap["email"]; !exists || email != "john@example.com" {
 			t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
 		}
 	})
 	t.Run("create nested properties", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		err := Set(data, "$.user.contact.email", "john@example.com")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		contact, ok := userMap["contact"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Contact is not a map")
 		}
 		if email, exists := contact["email"]; !exists || email != "john@example.com" {
 			t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
 		}
 	})
 	t.Run("create array and element", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		// This should create an empty addresses array, but won't be able to set index 0
 		// since the array is empty
 		err := Set(data, "$.user.addresses[0].street", "123 Main St")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 	})
 	t.Run("multiple targets (should only update first)", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"active": true},
 				map[string]interface{}{"active": true},
 			},
 		}
 		err := Set(data, "$.users[*].active", false)
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		user0, ok := users[0].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User0 is not a map")
 		}
 		user1, ok := users[1].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User1 is not a map")
 		}
 		// Only the first one should be changed
 		if active, exists := user0["active"]; !exists || active != false {
 			t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
 		}
 		// The second one should remain unchanged
 		if active, exists := user1["active"]; !exists || active != true {
 			t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
 		}
 	})
 	t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 		}
 		err := Set(data, "$", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Data should be unchanged
 		if data["name"] != "John" {
 			t.Errorf("Data was modified when setting on root")
 		}
 	})
 }
 func TestSetAll(t *testing.T) {
 	t.Run("simple property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 			"age":  30,
 		}
 		err := SetAll(data, "$.name", "Jane")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		if data["name"] != "Jane" {
 			t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
 		}
 	})
 	t.Run("all array elements", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"active": true},
 				map[string]interface{}{"active": true},
 			},
 		}
 		err := SetAll(data, "$.users[*].active", false)
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		// Both elements should be updated
 		for i, user := range users {
 			userMap, ok := user.(map[string]interface{})
 			if !ok {
 				t.Fatalf("User%d is not a map", i)
 			}
 			if active, exists := userMap["active"]; !exists || active != false {
 				t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
 			}
 		}
 	})
 	t.Run("recursive descent", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"profile": map[string]interface{}{
 					"active": true,
 				},
 			},
 			"admin": map[string]interface{}{
 				"profile": map[string]interface{}{
 					"active": true,
 				},
 			},
 		}
 		err := SetAll(data, "$..active", false)
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Check user profile
 		userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Failed to access user.profile")
 		}
 		if active, exists := userProfile["active"]; !exists || active != false {
 			t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
 		}
 		// Check admin profile
 		adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Failed to access admin.profile")
 		}
 		if active, exists := adminProfile["active"]; !exists || active != false {
 			t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
 		}
 	})
 }
 func TestGetWithPathsExtended(t *testing.T) {
 	tests := []struct {
 		name     string
 		data     map[string]interface{}
 		path     string
 		expected []JSONNode
 	}{
 		{
 			name: "simple property",
 			data: map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 			path: "$.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.name"},
 			},
 		},
 		{
 			name: "nested property",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"age":  30,
 				},
 			},
 			path: "$.user.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.user.name"},
 			},
 		},
 		{
 			name: "array access",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[1].name",
 			expected: []JSONNode{
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "wildcard",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[*].name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.users[0].name"},
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "recursive descent",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"profile": map[string]interface{}{
 						"email": "john@example.com",
 					},
 				},
 				"admin": map[string]interface{}{
 					"email": "admin@example.com",
 				},
 			},
 			path: "$..email",
 			expected: []JSONNode{
 				{Value: "john@example.com", Path: "$.user.profile.email"},
 				{Value: "admin@example.com", Path: "$.admin.email"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(tt.data, tt.path)
 			if err != nil {
 				t.Errorf("GetWithPaths() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// Check if value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Check if path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
--- a/processor/jsonpath/jsonpath_test.go
+++ b/processor/jsonpath/jsonpath_test.go
@@ -1,318 +0,0 @@
 package jsonpath
 import (
 	"reflect"
 	"testing"
 )
 var testData = map[string]interface{}{
 	"store": map[string]interface{}{
 		"book": []interface{}{
 			map[string]interface{}{
 				"title": "The Fellowship of the Ring",
 				"price": 22.99,
 			},
 			map[string]interface{}{
 				"title": "The Two Towers",
 				"price": 23.45,
 			},
 		},
 		"bicycle": map[string]interface{}{
 			"color": "red",
 			"price": 199.95,
 		},
 	},
 }
 func TestParser(t *testing.T) {
 	tests := []struct {
 		path    string
 		steps   []JSONStep
 		wantErr bool
 	}{
 		{
 			path: "$.store.bicycle.color",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "bicycle"},
 				{Type: ChildStep, Key: "color"},
 			},
 		},
 		{
 			path: "$..price",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: RecursiveDescentStep, Key: "price"},
 			},
 		},
 		{
 			path: "$.store.book[*].title",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "book"},
 				{Type: IndexStep, Index: -1}, // Wildcard
 				{Type: ChildStep, Key: "title"},
 			},
 		},
 		{
 			path: "$.store.book[0]",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "book"},
 				{Type: IndexStep, Index: 0},
 			},
 		},
 		{
 			path:    "invalid.path",
 			wantErr: true,
 		},
 		{
 			path:    "$.store.book[abc]",
 			wantErr: true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.path, func(t *testing.T) {
 			steps, err := ParseJSONPath(tt.path)
 			if (err != nil) != tt.wantErr {
 				t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
 			}
 			if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
 				t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
 			}
 		})
 	}
 }
 func TestEvaluator(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []JSONNode
 		error    bool
 	}{
 		{
 			name: "simple_property_access",
 			path: "$.store.bicycle.color",
 			expected: []JSONNode{
 				{Value: "red", Path: "$.store.bicycle.color"},
 			},
 		},
 		{
 			name: "array_index_access",
 			path: "$.store.book[0].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 			},
 		},
 		{
 			name: "wildcard_array_access",
 			path: "$.store.book[*].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 				{Value: "The Two Towers", Path: "$.store.book[1].title"},
 			},
 		},
 		{
 			name: "recursive_price_search",
 			path: "$..price",
 			expected: []JSONNode{
 				{Value: 22.99, Path: "$.store.book[0].price"},
 				{Value: 23.45, Path: "$.store.book[1].price"},
 				{Value: 199.95, Path: "$.store.bicycle.price"},
 			},
 		},
 		{
 			name: "wildcard_recursive",
 			path: "$..*",
 			expected: []JSONNode{
 				// These will be compared by value only, paths will be validated separately
 				{Value: testData["store"].(map[string]interface{})["book"]},
 				{Value: testData["store"].(map[string]interface{})["bicycle"]},
 				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
 				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
 				{Value: "The Fellowship of the Ring"},
 				{Value: 22.99},
 				{Value: "The Two Towers"},
 				{Value: 23.45},
 				{Value: "red"},
 				{Value: 199.95},
 			},
 		},
 		{
 			name:     "invalid_index",
 			path:     "$.store.book[5]",
 			expected: []JSONNode{},
 			error:    true,
 		},
 		{
 			name:     "nonexistent_property",
 			path:     "$.store.nonexistent",
 			expected: []JSONNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			// Use GetWithPaths directly
 			result, err := Get(testData, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("Get() returned error: %v", err)
 				}
 				return
 			}
 			// Special handling for wildcard recursive test
 			if tt.name == "wildcard_recursive" {
 				// Skip length check for wildcard recursive since it might vary
 				// Just verify that each expected item is in the results
 				// Validate values match and paths are filled in
 				for _, e := range tt.expected {
 					found := false
 					for _, r := range result {
 						if reflect.DeepEqual(r.Value, e.Value) {
 							found = true
 							break
 						}
 					}
 					if !found {
 						t.Errorf("Expected value %v not found in results", e.Value)
 					}
 				}
 				return
 			}
 			if len(result) != len(tt.expected) {
 				t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
 			}
 			// Validate both values and paths
 			for i, e := range tt.expected {
 				if i < len(result) {
 					if !reflect.DeepEqual(result[i].Value, e.Value) {
 						t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
 					}
 					if result[i].Path != e.Path {
 						t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestEdgeCases(t *testing.T) {
 	t.Run("empty_data", func(t *testing.T) {
 		result, err := Get(nil, "$.a.b")
 		if err == nil {
 			t.Errorf("Expected error for empty data")
 			return
 		}
 		if len(result) > 0 {
 			t.Errorf("Expected empty result, got %v", result)
 		}
 	})
 	t.Run("empty_path", func(t *testing.T) {
 		_, err := ParseJSONPath("")
 		if err == nil {
 			t.Error("Expected error for empty path")
 		}
 	})
 	t.Run("numeric_keys", func(t *testing.T) {
 		data := map[string]interface{}{
 			"42": "answer",
 		}
 		result, err := Get(data, "$.42")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) == 0 || result[0].Value != "answer" {
 			t.Errorf("Expected 'answer', got %v", result)
 		}
 	})
 }
 func TestGetWithPaths(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []JSONNode
 	}{
 		{
 			name: "simple_property_access",
 			path: "$.store.bicycle.color",
 			expected: []JSONNode{
 				{Value: "red", Path: "$.store.bicycle.color"},
 			},
 		},
 		{
 			name: "array_index_access",
 			path: "$.store.book[0].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 			},
 		},
 		{
 			name: "wildcard_array_access",
 			path: "$.store.book[*].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 				{Value: "The Two Towers", Path: "$.store.book[1].title"},
 			},
 		},
 		{
 			name: "recursive_price_search",
 			path: "$..price",
 			expected: []JSONNode{
 				{Value: 22.99, Path: "$.store.book[0].price"},
 				{Value: 23.45, Path: "$.store.book[1].price"},
 				{Value: 199.95, Path: "$.store.bicycle.price"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(testData, tt.path)
 			if err != nil {
 				t.Errorf("Get() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// First verify the value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Then verify the path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
--- a/processor/processor.go
+++ b/processor/processor.go
@@ -2,197 +2,164 @@ package processor
 import (
 	"fmt"
-	"log"
+	"io"
-	"os"
+	"net/http"
-	"path/filepath"
+	"regexp"
 	"strings"
-	"github.com/antchfx/xmlquery"
+	"cook/utils"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
 )
-// Processor defines the interface for all file processors
+// processorLogger is a scoped logger for the processor package.
-type Processor interface {
+var processorLogger = logger.Default.WithPrefix("processor")
 	// Process handles processing a file with the given pattern and Lua expression
 	// Now implemented as a base function in processor.go
 	// Process(filename string, pattern string, luaExpr string) (int, int, error)
-	// ProcessContent handles processing a string content directly with the given pattern and Lua expression
+// Maybe we make this an interface again for the shits and giggles
-	// Returns the modified content, modification count, match count, and any error
+// We will see, it could easily be...
 	ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
-	// ToLua converts processor-specific data to Lua variables
+var globalVariables = map[string]interface{}{}
 	ToLua(L *lua.LState, data interface{}) error
-	// FromLua retrieves modified data from Lua
+func SetVariables(vars map[string]interface{}) {
-	FromLua(L *lua.LState) (interface{}, error)
+	for k, v := range vars {
 		globalVariables[k] = v
 	}
 // ModificationRecord tracks a single value modification
 type ModificationRecord struct {
 	File      string
 	OldValue  string
 	NewValue  string
 	Operation string
 	Context   string
 }
 func NewLuaState() (*lua.LState, error) {
 	newLStateLogger := processorLogger.WithPrefix("NewLuaState")
 	newLStateLogger.Debug("Creating new Lua state")
 	L := lua.NewState()
 	// defer L.Close()
 	// Load math library
 	newLStateLogger.Debug("Loading Lua math library")
 	L.Push(L.GetGlobal("require"))
 	L.Push(lua.LString("math"))
 	if err := L.PCall(1, 1, nil); err != nil {
 		newLStateLogger.Error("Failed to load Lua math library: %v", err)
 		return nil, fmt.Errorf("error loading Lua math library: %v", err)
 	}
 	newLStateLogger.Debug("Lua math library loaded")
 	// Initialize helper functions
 	newLStateLogger.Debug("Initializing Lua helper functions")
 	if err := InitLuaHelpers(L); err != nil {
 		newLStateLogger.Error("Failed to initialize Lua helper functions: %v", err)
 		return nil, err
 	}
 	newLStateLogger.Debug("Lua helper functions initialized")
-	return L, nil
+	// Inject global variables
-}
+	if len(globalVariables) > 0 {
-
+		newLStateLogger.Debug("Injecting %d global variables into Lua state", len(globalVariables))
-func Process(p Processor, filename string, pattern string, luaExpr string) (int, int, error) {
+		for k, v := range globalVariables {
-	// Read file content
+			switch val := v.(type) {
-	cwd, err := os.Getwd()
+			case int:
-	if err != nil {
+				L.SetGlobal(k, lua.LNumber(float64(val)))
-		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
+			case int64:
-	}
+				L.SetGlobal(k, lua.LNumber(float64(val)))
-
+			case float32:
-	fullPath := filepath.Join(cwd, filename)
+				L.SetGlobal(k, lua.LNumber(float64(val)))
 	content, err := os.ReadFile(fullPath)
 	if err != nil {
 		return 0, 0, fmt.Errorf("error reading file: %v", err)
 	}
 	fileContent := string(content)
 	// Process the content
 	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
 	if err != nil {
 		return 0, 0, err
 	}
 	// If we made modifications, save the file
 	if modCount > 0 {
 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
 		if err != nil {
 			return 0, 0, fmt.Errorf("error writing file: %v", err)
 		}
 	}
 	return modCount, matchCount, nil
 }
 // ToLua converts a struct or map to a Lua table recursively
 func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
 	switch v := data.(type) {
 	case *xmlquery.Node:
 		luaTable := L.NewTable()
 		luaTable.RawSetString("text", lua.LString(v.Data))
 		// Should be a map, simple key value pairs
 		attr, err := ToLua(L, v.Attr)
 		if err != nil {
 			return nil, err
 		}
 		luaTable.RawSetString("attr", attr)
 		return luaTable, nil
 	case map[string]interface{}:
 		luaTable := L.NewTable()
 		for key, value := range v {
 			luaValue, err := ToLua(L, value)
 			if err != nil {
 				return nil, err
 			}
 			luaTable.RawSetString(key, luaValue)
 		}
 		return luaTable, nil
 	case []interface{}:
 		luaTable := L.NewTable()
 		for i, value := range v {
 			luaValue, err := ToLua(L, value)
 			if err != nil {
 				return nil, err
 			}
 			luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
 		}
 		return luaTable, nil
 	case string:
 		return lua.LString(v), nil
 	case bool:
 		return lua.LBool(v), nil
 			case float64:
-		return lua.LNumber(v), nil
+				L.SetGlobal(k, lua.LNumber(val))
-	case nil:
+			case string:
-		return lua.LNil, nil
+				L.SetGlobal(k, lua.LString(val))
-	default:
+			case bool:
-		return nil, fmt.Errorf("unsupported data type: %T", data)
+				if val {
 					L.SetGlobal(k, lua.LTrue)
 				} else {
 					L.SetGlobal(k, lua.LFalse)
 				}
 			default:
 				// Fallback to string representation
 				L.SetGlobal(k, lua.LString(fmt.Sprintf("%v", val)))
 			}
 		}
 	}
 	newLStateLogger.Debug("New Lua state created successfully")
 	return L, nil
 }
 // FromLua converts a Lua table to a struct or map recursively
 func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
 	fromLuaLogger := processorLogger.WithPrefix("FromLua").WithField("luaType", luaValue.Type().String())
 	fromLuaLogger.Debug("Converting Lua value to Go interface")
 	switch v := luaValue.(type) {
 	// Well shit...
 	// Tables in lua are both maps and arrays
 	// As arrays they are ordered and as maps, obviously, not
 	// So when we parse them to a go map we fuck up the order for arrays
 	// We have to find a better way....
 	case *lua.LTable:
 		fromLuaLogger.Debug("Processing Lua table")
 		isArray, err := IsLuaTableArray(L, v)
 		if err != nil {
 			fromLuaLogger.Error("Failed to determine if Lua table is array: %v", err)
 			return nil, err
 		}
 		fromLuaLogger.Debug("Lua table is array: %t", isArray)
 		if isArray {
 			fromLuaLogger.Debug("Converting Lua table to Go array")
 			result := make([]interface{}, 0)
 			v.ForEach(func(key lua.LValue, value lua.LValue) {
 				converted, _ := FromLua(L, value)
 				result = append(result, converted)
 			})
 			fromLuaLogger.Trace("Converted Go array: %v", result)
 			return result, nil
 		} else {
 			fromLuaLogger.Debug("Converting Lua table to Go map")
 			result := make(map[string]interface{})
 			v.ForEach(func(key lua.LValue, value lua.LValue) {
 				converted, _ := FromLua(L, value)
 				result[key.String()] = converted
 			})
 			fromLuaLogger.Trace("Converted Go map: %v", result)
 			return result, nil
 		}
 	case lua.LString:
 		fromLuaLogger.Debug("Converting Lua string to Go string")
 		fromLuaLogger.Trace("Lua string: %q", string(v))
 		return string(v), nil
 	case lua.LBool:
 		fromLuaLogger.Debug("Converting Lua boolean to Go boolean")
 		fromLuaLogger.Trace("Lua boolean: %t", bool(v))
 		return bool(v), nil
 	case lua.LNumber:
 		fromLuaLogger.Debug("Converting Lua number to Go float64")
 		fromLuaLogger.Trace("Lua number: %f", float64(v))
 		return float64(v), nil
 	default:
 		fromLuaLogger.Debug("Unsupported Lua type, returning nil")
 		return nil, nil
 	}
 }
 func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
 	isLuaTableArrayLogger := processorLogger.WithPrefix("IsLuaTableArray")
 	isLuaTableArrayLogger.Debug("Checking if Lua table is an array")
 	isLuaTableArrayLogger.Trace("Lua table input: %v", v)
 	L.SetGlobal("table_to_check", v)
 	// Use our predefined helper function from InitLuaHelpers
 	err := L.DoString(`is_array = isArray(table_to_check)`)
 	if err != nil {
 		isLuaTableArrayLogger.Error("Error determining if table is an array: %v", err)
 		return false, fmt.Errorf("error determining if table is array: %w", err)
 	}
 	// Check the result of our Lua function
 	isArray := L.GetGlobal("is_array")
 	// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
-	if !lua.LVIsFalse(isArray) {
+	result := !lua.LVIsFalse(isArray)
-		return true, nil
+	isLuaTableArrayLogger.Debug("Lua table is array: %t", result)
-	}
+	isLuaTableArrayLogger.Trace("isArray result Lua value: %v", isArray)
-	return false, nil
+	return result, nil
 }
 // InitLuaHelpers initializes common Lua helper functions
 func InitLuaHelpers(L *lua.LState) error {
 	initLuaHelpersLogger := processorLogger.WithPrefix("InitLuaHelpers")
 	initLuaHelpersLogger.Debug("Loading Lua helper functions")
 	helperScript := `
 -- Custom Lua helpers for math operations
 function min(a, b) return math.min(a, b) end
@@ -205,6 +172,40 @@ function floor(x) return math.floor(x) end
 function ceil(x) return math.ceil(x) end
 function upper(s) return string.upper(s) end
 function lower(s) return string.lower(s) end
 function format(s, ...) return string.format(s, ...) end
 function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
 -- String split helper
 function strsplit(inputstr, sep)
  if sep == nil then
    sep = "%s"
  end
  local t = {}
  for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
    table.insert(t, str)
  end
  return t
 end
 ---@param table table
 ---@param depth number?
 function DumpTable(table, depth)
 	if depth == nil then
 		depth = 0
 	end
 	if (depth > 200) then
 		print("Error: Depth > 200 in dumpTable()")
 		return
 	end
 	for k, v in pairs(table) do
 		if (type(v) == "table") then
 			print(string.rep("  ", depth) .. k .. ":")
 			DumpTable(v, depth + 1)
 		else
 			print(string.rep("  ", depth) .. k .. ": ", v)
 		end
 	end
 end
 -- String to number conversion helper
 function num(str)
@@ -238,25 +239,21 @@ end
 modified = false
 `
 	if err := L.DoString(helperScript); err != nil {
 		initLuaHelpersLogger.Error("Failed to load Lua helper functions: %v", err)
 		return fmt.Errorf("error loading helper functions: %v", err)
 	}
 	initLuaHelpersLogger.Debug("Lua helper functions loaded")
 	initLuaHelpersLogger.Debug("Setting up Lua print function to Go")
 	L.SetGlobal("print", L.NewFunction(printToGo))
 	L.SetGlobal("fetch", L.NewFunction(fetch))
 	initLuaHelpersLogger.Debug("Lua print and fetch functions bound to Go")
 	return nil
 }
 // Helper utility functions
 // LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	s = strings.ReplaceAll(s, "\n", "\\n")
 	if len(s) <= maxLen {
 		return s
 	}
 	return s[:maxLen-3] + "..."
 }
 func PrependLuaAssignment(luaExpr string) string {
 	prependLuaAssignmentLogger := processorLogger.WithPrefix("PrependLuaAssignment").WithField("originalLuaExpr", luaExpr)
 	prependLuaAssignmentLogger.Debug("Prepending Lua assignment if necessary")
 	// Auto-prepend v1 for expressions starting with operators
 	if strings.HasPrefix(luaExpr, "*") ||
 		strings.HasPrefix(luaExpr, "/") ||
@@ -265,28 +262,32 @@ func PrependLuaAssignment(luaExpr string) string {
 		strings.HasPrefix(luaExpr, "^") ||
 		strings.HasPrefix(luaExpr, "%") {
 		luaExpr = "v1 = v1" + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1 = v1' due to operator prefix")
 	} else if strings.HasPrefix(luaExpr, "=") {
 		// Handle direct assignment with = operator
 		luaExpr = "v1 " + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1' due to direct assignment operator")
 	}
 	// Add assignment if needed
 	if !strings.Contains(luaExpr, "=") {
 		luaExpr = "v1 = " + luaExpr
 		prependLuaAssignmentLogger.Debug("Prepended 'v1 =' as no assignment was found")
 	}
 	prependLuaAssignmentLogger.Trace("Final Lua expression after prepending: %q", luaExpr)
 	return luaExpr
 }
 // BuildLuaScript prepares a Lua expression from shorthand notation
 func BuildLuaScript(luaExpr string) string {
 	buildLuaScriptLogger := processorLogger.WithPrefix("BuildLuaScript").WithField("inputLuaExpr", luaExpr)
 	buildLuaScriptLogger.Debug("Building full Lua script from expression")
 	// Perform $var substitutions from globalVariables
 	luaExpr = replaceVariables(luaExpr)
 	luaExpr = PrependLuaAssignment(luaExpr)
 	// This allows the user to specify whether or not they modified a value
 	// If they do nothing we assume they did modify (no return at all)
 	// If they return before our return then they themselves specify what they did
 	// If nothing is returned lua assumes nil
 	// So we can say our value was modified if the return value is either nil or true
 	// If the return value is false then the user wants to keep the original
 	fullScript := fmt.Sprintf(`
 		function run()
 			%s
@@ -294,36 +295,189 @@ func BuildLuaScript(luaExpr string) string {
 		local res = run()
 		modified = res == nil or res
 	`, luaExpr)
 	buildLuaScriptLogger.Trace("Generated full Lua script: %q", utils.LimitString(fullScript, 200))
 	return fullScript
 }
 // BuildJSONLuaScript prepares a Lua expression for JSON mode
 func BuildJSONLuaScript(luaExpr string) string {
 	buildJsonLuaScriptLogger := processorLogger.WithPrefix("BuildJSONLuaScript").WithField("inputLuaExpr", luaExpr)
 	buildJsonLuaScriptLogger.Debug("Building full Lua script for JSON mode from expression")
 	// Perform $var substitutions from globalVariables
 	luaExpr = replaceVariables(luaExpr)
 	fullScript := fmt.Sprintf(`
 		function run()
 			%s
 		end
 		local res = run()
 		modified = res == nil or res
 	`, luaExpr)
 	buildJsonLuaScriptLogger.Trace("Generated full JSON Lua script: %q", utils.LimitString(fullScript, 200))
 	return fullScript
 }
 func replaceVariables(expr string) string {
 	// $varName -> literal value
 	varNameRe := regexp.MustCompile(`\$(\w+)`)
 	return varNameRe.ReplaceAllStringFunc(expr, func(m string) string {
 		name := varNameRe.FindStringSubmatch(m)[1]
 		if v, ok := globalVariables[name]; ok {
 			switch val := v.(type) {
 			case int, int64, float32, float64:
 				return fmt.Sprintf("%v", val)
 			case bool:
 				if val {
 					return "true"
 				} else {
 					return "false"
 				}
 			case string:
 				// Quote strings for Lua literal
 				return fmt.Sprintf("%q", val)
 			default:
 				return fmt.Sprintf("%q", fmt.Sprintf("%v", val))
 			}
 		}
 		return m
 	})
 }
 func printToGo(L *lua.LState) int {
-	// Get the number of arguments passed to the Lua print function
+	printToGoLogger := processorLogger.WithPrefix("printToGo")
-	n := L.GetTop()
+	printToGoLogger.Debug("Lua print function called, redirecting to Go logger")
-	// Create a slice to hold the arguments
+	top := L.GetTop()
-	args := make([]interface{}, n)
+
-	for i := 1; i <= n; i++ {
+	args := make([]interface{}, top)
-		args[i-1] = L.Get(i) // Get the argument from Lua stack
+	for i := 1; i <= top; i++ {
-	}
+		args[i-1] = L.Get(i)
 	// Print the arguments to Go's stdout
 	log.Print("Lua: ")
 	log.Println(args...)
 	return 0 // No return values
 	}
-// Max returns the maximum of two integers
+	// Format the message with proper spacing between arguments
-func Max(a, b int) int {
+	var parts []string
-	if a > b {
+	for _, arg := range args {
-		return a
+		parts = append(parts, fmt.Sprintf("%v", arg))
 	}
-	return b
+	message := strings.Join(parts, " ")
 	printToGoLogger.Trace("Lua print message: %q", message)
 	// Use the LUA log level with a script tag
 	logger.Lua("%s", message)
 	printToGoLogger.Debug("Message logged from Lua")
 	return 0
 }
-// Min returns the minimum of two integers
+func fetch(L *lua.LState) int {
-func Min(a, b int) int {
+	fetchLogger := processorLogger.WithPrefix("fetch")
-	if a < b {
+	fetchLogger.Debug("Lua fetch function called")
-		return a
+	// Get URL from first argument
 	url := L.ToString(1)
 	if url == "" {
 		fetchLogger.Error("Fetch failed: URL is required")
 		L.Push(lua.LNil)
 		L.Push(lua.LString("URL is required"))
 		return 2
 	}
-	return b
+	fetchLogger.Debug("Fetching URL: %q", url)
 	// Get options from second argument if provided
 	var method string = "GET"
 	var headers map[string]string = make(map[string]string)
 	var body string = ""
 	if L.GetTop() > 1 {
 		options := L.ToTable(2)
 		if options != nil {
 			fetchLogger.Debug("Processing fetch options")
 			// Get method
 			if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
 				method = methodVal.String()
 				fetchLogger.Trace("Method from options: %q", method)
 			}
 			// Get headers
 			if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
 				if headersTable, ok := headersVal.(*lua.LTable); ok {
 					fetchLogger.Trace("Processing headers table")
 					headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
 						headers[key.String()] = value.String()
 						fetchLogger.Trace("Header: %q = %q", key.String(), value.String())
 					})
 				}
 				fetchLogger.Trace("All headers: %v", headers)
 			}
 			// Get body
 			if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
 				body = bodyVal.String()
 				fetchLogger.Trace("Body from options: %q", utils.LimitString(body, 100))
 			}
 		}
 	}
 	fetchLogger.Debug("Fetch request details: Method=%q, URL=%q, BodyLength=%d, Headers=%v", method, url, len(body), headers)
 	// Create HTTP request
 	req, err := http.NewRequest(method, url, strings.NewReader(body))
 	if err != nil {
 		fetchLogger.Error("Error creating HTTP request: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
 		return 2
 	}
 	// Set headers
 	for key, value := range headers {
 		req.Header.Set(key, value)
 	}
 	fetchLogger.Debug("HTTP request created and headers set")
 	fetchLogger.Trace("HTTP Request: %+v", req)
 	// Make request
 	client := &http.Client{}
 	resp, err := client.Do(req)
 	if err != nil {
 		fetchLogger.Error("Error making HTTP request: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
 		return 2
 	}
 	defer func() {
 		fetchLogger.Debug("Closing HTTP response body")
 		resp.Body.Close()
 	}()
 	fetchLogger.Debug("HTTP request executed. Status Code: %d", resp.StatusCode)
 	// Read response body
 	bodyBytes, err := io.ReadAll(resp.Body)
 	if err != nil {
 		fetchLogger.Error("Error reading response body: %v", err)
 		L.Push(lua.LNil)
 		L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
 		return 2
 	}
 	fetchLogger.Trace("Response body length: %d", len(bodyBytes))
 	// Create response table
 	responseTable := L.NewTable()
 	responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
 	responseTable.RawSetString("statusText", lua.LString(resp.Status))
 	responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
 	responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
 	fetchLogger.Debug("Created Lua response table")
 	// Set headers in response
 	headersTable := L.NewTable()
 	for key, values := range resp.Header {
 		headersTable.RawSetString(key, lua.LString(values[0]))
 		fetchLogger.Trace("Response header: %q = %q", key, values[0])
 	}
 	responseTable.RawSetString("headers", headersTable)
 	fetchLogger.Trace("Full response table: %v", responseTable)
 	L.Push(responseTable)
 	fetchLogger.Debug("Pushed response table to Lua stack")
 	return 1
 }
--- a/processor/regex.go
+++ b/processor/regex.go
@@ -1,152 +1,107 @@
 package processor
 import (
 	"cook/utils"
 	"fmt"
 	"log"
 	"regexp"
 	"strconv"
 	"strings"
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
 )
-// RegexProcessor implements the Processor interface using regex patterns
+// regexLogger is a scoped logger for the processor/regex package.
-type RegexProcessor struct{}
+var regexLogger = logger.Default.WithPrefix("processor/regex")
-// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
+type CaptureGroup struct {
 func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
 	captures, ok := data.([]string)
 	if !ok {
 		return fmt.Errorf("expected []string for captures, got %T", data)
 	}
 	// Set variables for each capture group, starting from v1/s1 for the first capture
 	for i := 0; i < len(captures); i++ {
 		// Set string version (always available as s1, s2, etc.)
 		L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
 		// Try to convert to number and set v1, v2, etc.
 		if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
 			L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
 		}
 	}
 	return nil
 }
 // FromLua implements the Processor interface for RegexProcessor
 func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	// Get the modified values after Lua execution
 	modifications := make(map[int]string)
 	// Check for modifications to v1-v12 and s1-s12
 	for i := 0; i < 12; i++ {
 		// Check both v and s variables to see if any were modified
 		vVarName := fmt.Sprintf("v%d", i+1)
 		sVarName := fmt.Sprintf("s%d", i+1)
 		vLuaVal := L.GetGlobal(vVarName)
 		sLuaVal := L.GetGlobal(sVarName)
 		// If our value is a number then it's very likely we want it to be a number
 		// And not a string
 		// If we do want it to be a string we will cast it into a string in lua
 		// wait that wouldn't work... Casting v to a string would not load it here
 		if vLuaVal.Type() == lua.LTNumber {
 			modifications[i] = vLuaVal.String()
 			continue
 		}
 		if sLuaVal.Type() == lua.LTString {
 			modifications[i] = sLuaVal.String()
 			continue
 		}
 	}
 	return modifications, nil
 }
 type NamedCapture struct {
 	Name    string
 	Value   string
 	Updated string
 	Range   [2]int
 }
 // ProcessContent applies regex replacement with Lua processing
-func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
+// The filename here exists ONLY so we can pass it to the lua environment
-	// Handle special pattern modifications
+// It's not used for anything else
-	if !strings.HasPrefix(pattern, "(?s)") {
+func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
-		pattern = "(?s)" + pattern
+	processRegexLogger := regexLogger.WithPrefix("ProcessRegex").WithField("commandName", command.Name).WithField("file", filename)
-		log.Printf("Pattern modified to include (?s): %s", pattern)
+	processRegexLogger.Debug("Starting regex processing for file")
-	}
+	processRegexLogger.Trace("Initial file content length: %d", len(content))
 	processRegexLogger.Trace("Command details: %+v", command)
-	// The order of these replaces is important
+	var commands []utils.ReplaceCommand
-	// This one handles !num-s inside of named capture groups
+	// Start timing the regex processing
-	// If it were not here our !num in a named capture group would
+	startTime := time.Now()
 	// Expand to another capture group in the capture group
 	// We really only want one (our named) capture group
 	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
 	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
 		parts := namedGroupNum.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			return match
 		}
 		replacement := `\d*\.?\d+`
 		return parts[1] + replacement
 	})
 	pattern = strings.ReplaceAll(pattern, "!num", `"?(\d*\.?\d+)"?`)
 	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
 	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
 	// !rep(pattern, count) repeats the pattern n times
 	// Inserting !any between each repetition
 	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
 		parts := repPattern.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			return match
 		}
 		repeatedPattern := parts[1]
 		count := parts[2]
 		repetitions, _ := strconv.Atoi(count)
 		return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
 	})
 	// We don't HAVE to do this multiple times for a pattern
 	// But it's quick enough for us to not care
 	pattern := resolveRegexPlaceholders(command.Regex)
 	processRegexLogger.Debug("Resolved regex placeholders. Pattern: %s", pattern)
 	// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
 	// But it's a compromise that allows us to use | in yaml
 	// Otherwise we would have to escape every god damn pair of quotation marks
 	// And a bunch of other shit
 	pattern = strings.TrimSpace(pattern)
 	processRegexLogger.Debug("Trimmed regex pattern: %s", pattern)
 	patternCompileStart := time.Now()
 	compiledPattern, err := regexp.Compile(pattern)
 	if err != nil {
-		log.Printf("Error compiling pattern: %v", err)
+		processRegexLogger.Error("Error compiling pattern %q: %v", pattern, err)
-		return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
+		return commands, fmt.Errorf("error compiling pattern: %v", err)
 	}
-	log.Printf("Compiled pattern successfully: %s", pattern)
+	processRegexLogger.Debug("Compiled pattern successfully in %v", time.Since(patternCompileStart))
-	previous := luaExpr
+	// Same here, it's just string concatenation, it won't kill us
-	luaExpr = BuildLuaScript(luaExpr)
+	// More important is that we don't fuck up the command
-	log.Printf("Changing Lua expression from: %s to: %s", previous, luaExpr)
+	// But we shouldn't be able to since it's passed by value
-
+	previousLuaExpr := command.Lua
-	// Initialize Lua environment
+	luaExpr := BuildLuaScript(command.Lua)
-	modificationCount := 0
+	processRegexLogger.Debug("Transformed Lua expression: %q → %q", previousLuaExpr, luaExpr)
 	processRegexLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
 	// Process all regex matches
-	result := content
+	matchFindStart := time.Now()
 	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
-	log.Printf("Found %d matches in the content", len(indices))
+	matchFindDuration := time.Since(matchFindStart)
 	processRegexLogger.Debug("Found %d matches in content of length %d (search took %v)",
 		len(indices), len(content), matchFindDuration)
 	processRegexLogger.Trace("Match indices: %v", indices)
 	// Log pattern complexity metrics
 	patternComplexity := estimatePatternComplexity(pattern)
 	processRegexLogger.Debug("Pattern complexity estimate: %d", patternComplexity)
 	if len(indices) == 0 {
 		processRegexLogger.Warning("No matches found for regex: %q", pattern)
 		processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
 		return commands, nil
 	}
 	// We walk backwards because we're replacing something with something else that might be longer
 	// And in the case it is longer than the original all indicces past that change will be fucked up
 	// By going backwards we fuck up all the indices to the end of the file that we don't care about
 	// Because there either aren't any (last match) or they're already modified (subsequent matches)
-	for i := len(indices) - 1; i >= 0; i-- {
+	for i, matchIndices := range indices {
 		matchLogger := processRegexLogger.WithField("matchNum", i+1)
 		matchLogger.Debug("Processing match %d of %d", i+1, len(indices))
 		matchLogger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
 		L, err := NewLuaState()
 		if err != nil {
-			log.Printf("Error creating Lua state: %v", err)
+			matchLogger.Error("Error creating Lua state: %v", err)
-			return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
+			return commands, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		L.SetGlobal("file", lua.LString(filename))
 		// Hmm... Maybe we don't want to defer this..
 		// Maybe we want to close them every iteration
 		// We'll leave it as is for now
 		defer L.Close()
-		log.Printf("Lua state created successfully")
+		matchLogger.Trace("Lua state created successfully for match %d", i+1)
 		matchIndices := indices[i]
 		log.Printf("Processing match indices: %v", matchIndices)
 		// Why we're doing this whole song and dance of indices is to properly handle empty matches
 		// Plus it's a little cleaner to surgically replace our matches
@@ -155,128 +110,390 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
 		// So when we're cutting open the array we say 0:7 + modified + 7:end
 		// As if concatenating in the middle of the array
 		// Plus it supports lookarounds
-		match := content[matchIndices[0]:matchIndices[1]]
+		matchContent := content[matchIndices[0]:matchIndices[1]]
-		log.Printf("Matched content: %s", match)
+		matchPreview := utils.LimitString(matchContent, 50)
 		matchLogger.Trace("Matched content: %q (length: %d)", matchPreview, len(matchContent))
 		groups := matchIndices[2:]
 		if len(groups) <= 0 {
-			log.Println("No capture groups for lua to chew on")
+			matchLogger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
 			continue
 		}
 		if len(groups)%2 == 1 {
-			log.Println("Odd number of indices of groups, what the fuck?")
+			matchLogger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
 			continue
 		}
 		for _, index := range groups {
 			if index == -1 {
 				// return "", 0, 0, fmt.Errorf("negative indices encountered: %v. This indicates that there was an issue with the match indices, possibly due to an empty match or an unexpected pattern. Please check the regex pattern and input content.", matchIndices)
 				log.Printf("Negative indices encountered: %v. This indicates that there was an issue with the match indices, possibly due to an empty match or an unexpected pattern. This is not an error but it's possibly not what you want.", matchIndices)
 				continue
 			}
 		}
-		captures := make([]string, 0, len(groups)/2)
+		// Count how many valid groups we have
 		validGroups := 0
 		for j := 0; j < len(groups); j += 2 {
-			if groups[j] == -1 || groups[j+1] == -1 {
+			if groups[j] != -1 && groups[j+1] != -1 {
 				validGroups++
 			}
 		}
 		matchLogger.Debug("Found %d valid capture groups in match", validGroups)
 		for _, index := range groups {
 			if index == -1 {
 				matchLogger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
 				continue
 			}
 			captures = append(captures, content[groups[j]:groups[j+1]])
 		}
 		log.Printf("Captured groups: %v", captures)
 		// We have to use array to preserve order
 		// Very important for the reconstruction step
 		// Because we must overwrite the values in reverse order
 		// See comments a few dozen lines above for more details
-		namedCaptures := make([]NamedCapture, 0, len(groups)/2)
+		captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
 		groupNames := compiledPattern.SubexpNames()[1:]
 		for i, name := range groupNames {
-			if name == "" {
+			start := groups[i*2]
 			end := groups[i*2+1]
 			if start == -1 || end == -1 {
 				matchLogger.Debug("Skipping empty or unmatched capture group #%d (name: %q)", i+1, name)
 				continue
 			}
-			if groups[i*2] == -1 || groups[i*2+1] == -1 {
+
-				continue
+			value := content[start:end]
-			}
+			captureGroups = append(captureGroups, &CaptureGroup{
 			namedCaptures = append(namedCaptures, NamedCapture{
 				Name:  name,
-				Value: captures[i],
+				Value: value,
-				Range: [2]int{groups[i*2], groups[i*2+1]},
+				Range: [2]int{start, end},
 			})
 		}
-		log.Printf("Named captures: %v", namedCaptures)
+			// Include name info in log if available
-
+			if name != "" {
-		if err := p.ToLua(L, captures); err != nil {
+				matchLogger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
 			log.Printf("Error setting Lua variables: %v", err)
 			continue
 		}
 		log.Println("Lua variables set successfully")
 		for _, capture := range namedCaptures {
 			if capture.Name == "" {
 				continue
 			}
 			if val, err := strconv.ParseFloat(capture.Value, 64); err == nil {
 				L.SetGlobal(capture.Name, lua.LNumber(val))
 			} else {
-				L.SetGlobal(capture.Name, lua.LString(capture.Value))
+				matchLogger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
 			}
 		}
 		// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
 		if !command.NoDedup {
 			matchLogger.Debug("Deduplicating capture groups as specified in command settings")
 			captureGroups = deduplicateGroups(captureGroups)
 			matchLogger.Trace("Capture groups after deduplication: %v", captureGroups)
 		} else {
 			matchLogger.Debug("Skipping deduplication of capture groups (NoDedup is true)")
 		}
 		if err := toLua(L, captureGroups); err != nil {
 			matchLogger.Error("Failed to set Lua variables for capture groups: %v", err)
 			continue
 		}
 		matchLogger.Debug("Set %d capture groups as Lua variables", len(captureGroups))
 		matchLogger.Trace("Lua globals set for capture groups")
 		if err := L.DoString(luaExpr); err != nil {
-			log.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
+			matchLogger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
 				err, utils.LimitString(luaExpr, 200), captureGroups)
 			continue
 		}
-		log.Println("Lua code executed successfully")
+		matchLogger.Debug("Lua script executed successfully")
 		// Get modifications from Lua
-		modResult, err := p.FromLua(L)
+		updatedCaptureGroups, err := fromLua(L, captureGroups)
 		if err != nil {
-			log.Printf("Error getting modifications: %v", err)
+			matchLogger.Error("Failed to retrieve modifications from Lua: %v", err)
 			continue
 		}
 		// Apply modifications to the matched text
 		modsMap, ok := modResult.(map[int]string)
 		if !ok || len(modsMap) == 0 {
 			log.Println("No modifications to apply")
 			continue
 		}
 		matchLogger.Debug("Retrieved updated values from Lua")
 		matchLogger.Trace("Updated capture groups from Lua: %v", updatedCaptureGroups)
 		replacement := ""
 		replacementVar := L.GetGlobal("replacement")
 		if replacementVar.Type() != lua.LTNil {
 			replacement = replacementVar.String()
-		}
+			matchLogger.Debug("Using global replacement variable from Lua: %q", replacement)
 		if replacement == "" {
 			// Apply the modifications to the original match
 			replacement = match
 			for i := len(modsMap) - 1; i >= 0; i-- {
 				newVal := modsMap[i]
 				log.Printf("Applying modification: %s", newVal)
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
 				groupStart := groups[i*2] - matchIndices[0]
 				groupEnd := groups[i*2+1] - matchIndices[0]
 				replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 		}
-			for i := len(namedCaptures) - 1; i >= 0; i-- {
+		// Check if modification flag is set
-				capture := namedCaptures[i]
+		modifiedVal := L.GetGlobal("modified")
-				if capture.Name == "" {
+		if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
 			matchLogger.Debug("Skipping match - no modifications indicated by Lua script")
 			continue
 		}
-				groupStart := capture.Range[0] - matchIndices[0]
+
-				groupEnd := capture.Range[1] - matchIndices[0]
+		if replacement == "" {
-				luaValue := L.GetGlobal(capture.Name).String()
+			// Apply the modifications to the original match
-				replacement = replacement[:groupStart] + luaValue + replacement[groupEnd:]
+			replacement = matchContent
 			// Count groups that were actually modified
 			modifiedGroupsCount := 0
 			for _, capture := range updatedCaptureGroups {
 				if capture.Value != capture.Updated {
 					modifiedGroupsCount++
 				}
 			}
-		modificationCount++
+			matchLogger.Info("%d of %d capture groups identified for modification", modifiedGroupsCount, len(updatedCaptureGroups))
-		result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
+
-		log.Printf("Modification count updated: %d", modificationCount)
+			for _, capture := range updatedCaptureGroups {
 				if capture.Value == capture.Updated {
 					matchLogger.Debug("Capture group unchanged: %s", utils.LimitString(capture.Value, 50))
 					continue
 				}
-	log.Printf("Process completed with %d modifications", modificationCount)
+				// Log what changed with context
-	return result, modificationCount, len(indices), nil
+				matchLogger.Debug("Capture group %q scheduled for modification: %q → %q",
 					capture.Name, utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
 				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 				commands = append(commands, utils.ReplaceCommand{
 					From: capture.Range[0],
 					To:   capture.Range[1],
 					With: capture.Updated,
 				})
 				matchLogger.Trace("Added replacement command: %+v", commands[len(commands)-1])
 			}
 		} else {
 			matchLogger.Debug("Using full replacement string from Lua: %q", utils.LimitString(replacement, 50))
 			commands = append(commands, utils.ReplaceCommand{
 				From: matchIndices[0],
 				To:   matchIndices[1],
 				With: replacement,
 			})
 			matchLogger.Trace("Added full replacement command: %+v", commands[len(commands)-1])
 		}
 	}
 	processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
 	processRegexLogger.Debug("Generated %d total modifications", len(commands))
 	return commands, nil
 }
 func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
 	deduplicateGroupsLogger := regexLogger.WithPrefix("deduplicateGroups")
 	deduplicateGroupsLogger.Debug("Starting deduplication of capture groups")
 	deduplicateGroupsLogger.Trace("Input capture groups: %v", captureGroups)
 	// Preserve input order and drop any group that overlaps with an already accepted group
 	accepted := make([]*CaptureGroup, 0, len(captureGroups))
 	for _, group := range captureGroups {
 		groupLogger := deduplicateGroupsLogger.WithField("groupName", group.Name).WithField("groupRange", group.Range)
 		groupLogger.Debug("Processing capture group")
 		overlaps := false
 		for _, kept := range accepted {
 			// Overlap if start < keptEnd and end > keptStart (adjacent is allowed)
 			if group.Range[0] < kept.Range[1] && group.Range[1] > kept.Range[0] {
 				overlaps = true
 				break
 			}
 		}
 		if overlaps {
 			groupLogger.Warning("Overlapping capture group detected and skipped.")
 			continue
 		}
 		groupLogger.Debug("Capture group does not overlap with previously accepted groups. Adding.")
 		accepted = append(accepted, group)
 	}
 	deduplicateGroupsLogger.Debug("Finished deduplication. Original %d groups, %d deduplicated.", len(captureGroups), len(accepted))
 	deduplicateGroupsLogger.Trace("Deduplicated groups: %v", accepted)
 	return accepted
 }
 // The order of these replaces is important
 // This one handles !num-s inside of named capture groups
 // If it were not here our !num in a named capture group would
 // Expand to another capture group in the capture group
 // We really only want one (our named) capture group
 func resolveRegexPlaceholders(pattern string) string {
 	resolveLogger := regexLogger.WithPrefix("resolveRegexPlaceholders").WithField("originalPattern", utils.LimitString(pattern, 100))
 	resolveLogger.Debug("Resolving regex placeholders in pattern")
 	// Handle special pattern modifications
 	if !strings.HasPrefix(pattern, "(?s)") {
 		pattern = "(?s)" + pattern
 		resolveLogger.Debug("Prepended '(?s)' to pattern for single-line mode")
 	}
 	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
 	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
 		funcLogger := resolveLogger.WithPrefix("namedGroupNumReplace").WithField("match", utils.LimitString(match, 50))
 		funcLogger.Debug("Processing named group !num placeholder")
 		parts := namedGroupNum.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			funcLogger.Warning("Unexpected number of submatches for namedGroupNum: %d. Returning original match.", len(parts))
 			return match
 		}
 		replacement := `-?\d*\.?\d+`
 		funcLogger.Trace("Replacing !num in named group with: %q", replacement)
 		return parts[1] + replacement
 	})
 	resolveLogger.Debug("Handled named group !num placeholders")
 	pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
 	resolveLogger.Debug("Replaced !num with numeric capture group")
 	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
 	resolveLogger.Debug("Replaced !any with non-greedy wildcard")
 	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
 	// !rep(pattern, count) repeats the pattern n times
 	// Inserting !any between each repetition
 	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
 		funcLogger := resolveLogger.WithPrefix("repPatternReplace").WithField("match", utils.LimitString(match, 50))
 		funcLogger.Debug("Processing !rep placeholder")
 		parts := repPattern.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			funcLogger.Warning("Unexpected number of submatches for repPattern: %d. Returning original match.", len(parts))
 			return match
 		}
 		repeatedPattern := parts[1]
 		countStr := parts[2]
 		repetitions, err := strconv.Atoi(countStr)
 		if err != nil {
 			funcLogger.Error("Failed to parse repetition count %q: %v. Returning original match.", countStr, err)
 			return match
 		}
 		var finalReplacement string
 		if repetitions > 0 {
 			finalReplacement = strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
 		} else {
 			finalReplacement = ""
 		}
 		funcLogger.Trace("Replaced !rep with %d repetitions of %q: %q", repetitions, utils.LimitString(repeatedPattern, 30), utils.LimitString(finalReplacement, 100))
 		return finalReplacement
 	})
 	resolveLogger.Debug("Handled !rep placeholders")
 	resolveLogger.Debug("Finished resolving regex placeholders")
 	resolveLogger.Trace("Final resolved pattern: %q", utils.LimitString(pattern, 100))
 	return pattern
 }
 // ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
 func toLua(L *lua.LState, data interface{}) error {
 	toLuaLogger := regexLogger.WithPrefix("toLua")
 	toLuaLogger.Debug("Setting capture groups as Lua variables")
 	captureGroups, ok := data.([]*CaptureGroup)
 	if !ok {
 		toLuaLogger.Error("Invalid data type for toLua. Expected []*CaptureGroup, got %T", data)
 		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
 	}
 	toLuaLogger.Trace("Input capture groups: %v", captureGroups)
 	groupindex := 0
 	for _, capture := range captureGroups {
 		groupLogger := toLuaLogger.WithField("captureGroup", capture.Name).WithField("value", utils.LimitString(capture.Value, 50))
 		groupLogger.Debug("Processing capture group for Lua")
 		if capture.Name == "" {
 			// We don't want to change the name of the capture group
 			// Even if it's empty
 			tempName := fmt.Sprintf("%d", groupindex+1)
 			groupindex++
 			groupLogger.Debug("Unnamed capture group, assigning temporary name: %q", tempName)
 			L.SetGlobal("s"+tempName, lua.LString(capture.Value))
 			groupLogger.Trace("Set Lua global s%s = %q", tempName, capture.Value)
 			val, err := strconv.ParseFloat(capture.Value, 64)
 			if err == nil {
 				L.SetGlobal("v"+tempName, lua.LNumber(val))
 				groupLogger.Trace("Set Lua global v%s = %f", tempName, val)
 			} else {
 				groupLogger.Trace("Value %q is not numeric, skipping v%s assignment", capture.Value, tempName)
 			}
 		} else {
 			val, err := strconv.ParseFloat(capture.Value, 64)
 			if err == nil {
 				L.SetGlobal(capture.Name, lua.LNumber(val))
 				groupLogger.Trace("Set Lua global %s = %f (numeric)", capture.Name, val)
 			} else {
 				L.SetGlobal(capture.Name, lua.LString(capture.Value))
 				groupLogger.Trace("Set Lua global %s = %q (string)", capture.Name, capture.Value)
 			}
 		}
 	}
 	toLuaLogger.Debug("Finished setting capture groups as Lua variables")
 	return nil
 }
 // FromLua implements the Processor interface for RegexProcessor
 func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
 	fromLuaLogger := regexLogger.WithPrefix("fromLua")
 	fromLuaLogger.Debug("Retrieving modifications from Lua for capture groups")
 	fromLuaLogger.Trace("Initial capture groups: %v", captureGroups)
 	captureIndex := 0
 	for _, capture := range captureGroups {
 		groupLogger := fromLuaLogger.WithField("originalCaptureName", capture.Name).WithField("originalValue", utils.LimitString(capture.Value, 50))
 		groupLogger.Debug("Processing capture group to retrieve updated value")
 		if capture.Name == "" {
 			// This case means it was an unnamed capture group originally.
 			// We need to reconstruct the original temporary name to fetch its updated value.
 			// The name will be set to an integer if it was empty, then incremented.
 			// So, we use the captureIndex to get the correct 'vX' and 'sX' variables.
 			tempName := fmt.Sprintf("%d", captureIndex+1)
 			groupLogger.Debug("Retrieving updated value for unnamed group (temp name: %q)", tempName)
 			vVarName := fmt.Sprintf("v%s", tempName)
 			sVarName := fmt.Sprintf("s%s", tempName)
 			captureIndex++
 			vLuaVal := L.GetGlobal(vVarName)
 			sLuaVal := L.GetGlobal(sVarName)
 			groupLogger.Trace("Lua values for unnamed group: v=%v, s=%v", vLuaVal, sLuaVal)
 			if sLuaVal.Type() == lua.LTString {
 				capture.Updated = sLuaVal.String()
 				groupLogger.Trace("Updated value from s%s (string): %q", tempName, capture.Updated)
 			}
 			// Numbers have priority
 			if vLuaVal.Type() == lua.LTNumber {
 				capture.Updated = vLuaVal.String()
 				groupLogger.Trace("Updated value from v%s (numeric): %q", tempName, capture.Updated)
 			}
 		} else {
 			// Easy shit, directly use the named capture group
 			updatedValue := L.GetGlobal(capture.Name)
 			if updatedValue.Type() != lua.LTNil {
 				capture.Updated = updatedValue.String()
 				groupLogger.Trace("Updated value for named group %q: %q", capture.Name, capture.Updated)
 			} else {
 				groupLogger.Debug("Named capture group %q not found in Lua globals or is nil. Keeping original value.", capture.Name)
 				capture.Updated = capture.Value // Keep original if not found or nil
 			}
 		}
 		groupLogger.Debug("Finished processing capture group. Original: %q, Updated: %q", utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
 	}
 	fromLuaLogger.Debug("Finished retrieving modifications from Lua")
 	fromLuaLogger.Trace("Final updated capture groups: %v", captureGroups)
 	return captureGroups, nil
 }
 // estimatePatternComplexity gives a rough estimate of regex pattern complexity
 // This can help identify potentially problematic patterns
 func estimatePatternComplexity(pattern string) int {
 	estimateComplexityLogger := regexLogger.WithPrefix("estimatePatternComplexity").WithField("pattern", utils.LimitString(pattern, 100))
 	estimateComplexityLogger.Debug("Estimating regex pattern complexity")
 	complexity := len(pattern)
 	// Add complexity for potentially expensive operations
 	complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
 	complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
 	complexity += strings.Count(pattern, "[^") * 3  // Negated character class
 	complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
 	complexity += strings.Count(pattern, "(") * 2   // Capture groups
 	complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
 	complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
 	complexity += strings.Count(pattern, "{") * 2   // Counted repetition
 	estimateComplexityLogger.Debug("Estimated pattern complexity: %d", complexity)
 	return complexity
 }
--- a/processor/regex_test.go
+++ b/processor/regex_test.go
--- a/processor/test_helper.go
+++ b/processor/test_helper.go
@@ -0,0 +1,27 @@
 package processor
 import (
 	"io"
 	"os"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 func init() {
 	// Only modify logger in test mode
 	// This checks if we're running under 'go test'
 	if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
 		// Initialize logger with ERROR level for tests
 		// to minimize noise in test output
 		logger.Init(logger.LevelError)
 		// Optionally redirect logger output to discard
 		// This prevents logger output from interfering with test output
 		disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
 		if disableTestLogs {
 			// Create a new logger that writes to nowhere
 			silentLogger := logger.New(io.Discard, "", 0)
 			logger.Default = silentLogger
 		}
 	}
 }
--- a/processor/xml.go
+++ b/processor/xml.go
@@ -1,412 +0,0 @@
 package processor
 import (
 	"fmt"
 	"log"
 	"modify/processor/xpath"
 	"strings"
 	"github.com/antchfx/xmlquery"
 	lua "github.com/yuin/gopher-lua"
 )
 // XMLProcessor implements the Processor interface for XML documents
 type XMLProcessor struct{}
 // ProcessContent implements the Processor interface for XMLProcessor
 func (p *XMLProcessor) ProcessContent(content string, path string, luaExpr string) (string, int, int, error) {
 	// Parse XML document
 	// We can't really use encoding/xml here because it requires a pre defined struct
 	// And we HAVE TO parse dynamic unknown XML
 	doc, err := xmlquery.Parse(strings.NewReader(content))
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
 	}
 	// Find nodes matching the XPath pattern
 	nodes, err := xpath.Get(doc, path)
 	if err != nil {
 		return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
 	}
 	matchCount := len(nodes)
 	if matchCount == 0 {
 		return content, 0, 0, nil
 	}
 	// Apply modifications to each node
 	modCount := 0
 	for _, node := range nodes {
 		L, err := NewLuaState()
 		if err != nil {
 			return content, 0, 0, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		defer L.Close()
 		err = p.ToLua(L, node)
 		if err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
 		}
 		err = L.DoString(BuildLuaScript(luaExpr))
 		if err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
 		}
 		result, err := p.FromLua(L)
 		if err != nil {
 			return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
 		}
 		log.Printf("%#v", result)
 		modified := false
 		modified = L.GetGlobal("modified").String() == "true"
 		if !modified {
 			log.Printf("No changes made to node at path: %s", node.Data)
 			continue
 		}
 		// Apply modification based on the result
 		if updatedValue, ok := result.(string); ok {
 			// If the result is a simple string, update the node value directly
 			xpath.Set(doc, path, updatedValue)
 		} else if nodeData, ok := result.(map[string]interface{}); ok {
 			// If the result is a map, apply more complex updates
 			updateNodeFromMap(node, nodeData)
 		}
 		modCount++
 	}
 	// Serialize the modified XML document to string
 	if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
 		// If we have an XML declaration, start with it
 		declaration := doc.FirstChild.OutputXML(true)
 		// Remove the firstChild (declaration) before serializing the rest of the document
 		doc.FirstChild = doc.FirstChild.NextSibling
 		return ConvertToNamedEntities(declaration + doc.OutputXML(true)), modCount, matchCount, nil
 	}
 	// Convert numeric entities to named entities for better readability
 	return ConvertToNamedEntities(doc.OutputXML(true)), modCount, matchCount, nil
 }
 func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
 	table, err := p.ToLuaTable(L, data)
 	if err != nil {
 		return err
 	}
 	L.SetGlobal("v", table)
 	return nil
 }
 // ToLua converts XML node values to Lua variables
 func (p *XMLProcessor) ToLuaTable(L *lua.LState, data interface{}) (lua.LValue, error) {
 	// Check if data is an xmlquery.Node
 	node, ok := data.(*xmlquery.Node)
 	if !ok {
 		return nil, fmt.Errorf("expected xmlquery.Node, got %T", data)
 	}
 	// Create a simple table with essential data
 	table := L.NewTable()
 	// For element nodes, just provide basic info
 	L.SetField(table, "type", lua.LString(nodeTypeToString(node.Type)))
 	L.SetField(table, "name", lua.LString(node.Data))
 	L.SetField(table, "value", lua.LString(node.InnerText()))
 	// Add children if any
 	children := L.NewTable()
 	for child := node.FirstChild; child != nil; child = child.NextSibling {
 		childTable, err := p.ToLuaTable(L, child)
 		if err == nil {
 			children.Append(childTable)
 		}
 	}
 	L.SetField(table, "children", children)
 	attrs := L.NewTable()
 	if len(node.Attr) > 0 {
 		for _, attr := range node.Attr {
 			L.SetField(attrs, attr.Name.Local, lua.LString(attr.Value))
 		}
 	}
 	L.SetField(table, "attr", attrs)
 	return table, nil
 }
 // FromLua gets modified values from Lua
 func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	luaValue := L.GetGlobal("v")
 	// Handle string values directly
 	if luaValue.Type() == lua.LTString {
 		return luaValue.String(), nil
 	}
 	// Handle tables (for attributes and more complex updates)
 	if luaValue.Type() == lua.LTTable {
 		return luaTableToMap(L, luaValue.(*lua.LTable)), nil
 	}
 	return luaValue.String(), nil
 }
 // Simple helper to convert a Lua table to a Go map
 func luaTableToMap(L *lua.LState, table *lua.LTable) map[string]interface{} {
 	result := make(map[string]interface{})
 	table.ForEach(func(k, v lua.LValue) {
 		if k.Type() == lua.LTString {
 			key := k.String()
 			if v.Type() == lua.LTTable {
 				result[key] = luaTableToMap(L, v.(*lua.LTable))
 			} else {
 				result[key] = v.String()
 			}
 		}
 	})
 	return result
 }
 // Simple helper to convert node type to string
 func nodeTypeToString(nodeType xmlquery.NodeType) string {
 	switch nodeType {
 	case xmlquery.ElementNode:
 		return "element"
 	case xmlquery.TextNode:
 		return "text"
 	case xmlquery.AttributeNode:
 		return "attribute"
 	default:
 		return "other"
 	}
 }
 // Helper function to update an XML node from a map
 func updateNodeFromMap(node *xmlquery.Node, data map[string]interface{}) {
 	// Update node value if present
 	if value, ok := data["value"]; ok {
 		if strValue, ok := value.(string); ok {
 			// For element nodes, replace text content
 			if node.Type == xmlquery.ElementNode {
 				// Find the first text child if it exists
 				var textNode *xmlquery.Node
 				for child := node.FirstChild; child != nil; child = child.NextSibling {
 					if child.Type == xmlquery.TextNode {
 						textNode = child
 						break
 					}
 				}
 				if textNode != nil {
 					// Update existing text node
 					textNode.Data = strValue
 				} else {
 					// Create new text node
 					newText := &xmlquery.Node{
 						Type:   xmlquery.TextNode,
 						Data:   strValue,
 						Parent: node,
 					}
 					// Insert at beginning of children
 					if node.FirstChild != nil {
 						newText.NextSibling = node.FirstChild
 						node.FirstChild.PrevSibling = newText
 						node.FirstChild = newText
 					} else {
 						node.FirstChild = newText
 						node.LastChild = newText
 					}
 				}
 			} else if node.Type == xmlquery.TextNode {
 				// Directly update text node
 				node.Data = strValue
 			} else if node.Type == xmlquery.AttributeNode {
 				// Update attribute value
 				if node.Parent != nil {
 					for i, attr := range node.Parent.Attr {
 						if attr.Name.Local == node.Data {
 							node.Parent.Attr[i].Value = strValue
 							break
 						}
 					}
 				}
 			}
 		}
 	}
 	// Update attributes if present
 	if attrs, ok := data["attr"].(map[string]interface{}); ok && node.Type == xmlquery.ElementNode {
 		for name, value := range attrs {
 			if strValue, ok := value.(string); ok {
 				// Look for existing attribute
 				found := false
 				for i, attr := range node.Attr {
 					if attr.Name.Local == name {
 						node.Attr[i].Value = strValue
 						found = true
 						break
 					}
 				}
 				// Add new attribute if not found
 				if !found {
 					node.Attr = append(node.Attr, xmlquery.Attr{
 						Name: struct {
 							Space, Local string
 						}{Local: name},
 						Value: strValue,
 					})
 				}
 			}
 		}
 	}
 }
 // Helper function to get a string representation of node type
 func nodeTypeName(nodeType xmlquery.NodeType) string {
 	switch nodeType {
 	case xmlquery.ElementNode:
 		return "element"
 	case xmlquery.TextNode:
 		return "text"
 	case xmlquery.AttributeNode:
 		return "attribute"
 	case xmlquery.CommentNode:
 		return "comment"
 	case xmlquery.DeclarationNode:
 		return "declaration"
 	default:
 		return "unknown"
 	}
 }
 // ConvertToNamedEntities replaces numeric XML entities with their named counterparts
 func ConvertToNamedEntities(xml string) string {
 	// Basic XML entities
 	replacements := map[string]string{
 		// Basic XML entities
 		"&#34;": "&quot;", // double quote
 		"&#39;": "&apos;", // single quote
 		"&#60;": "&lt;",   // less than
 		"&#62;": "&gt;",   // greater than
 		"&#38;": "&amp;",  // ampersand
 		// Common symbols
 		"&#160;":  "&nbsp;",   // non-breaking space
 		"&#169;":  "&copy;",   // copyright
 		"&#174;":  "&reg;",    // registered trademark
 		"&#8364;": "&euro;",   // euro
 		"&#163;":  "&pound;",  // pound
 		"&#165;":  "&yen;",    // yen
 		"&#162;":  "&cent;",   // cent
 		"&#167;":  "&sect;",   // section
 		"&#8482;": "&trade;",  // trademark
 		"&#9824;": "&spades;", // spade
 		"&#9827;": "&clubs;",  // club
 		"&#9829;": "&hearts;", // heart
 		"&#9830;": "&diams;",  // diamond
 		// Special characters
 		"&#161;":  "&iexcl;",  // inverted exclamation
 		"&#191;":  "&iquest;", // inverted question
 		"&#171;":  "&laquo;",  // left angle quotes
 		"&#187;":  "&raquo;",  // right angle quotes
 		"&#183;":  "&middot;", // middle dot
 		"&#8226;": "&bull;",   // bullet
 		"&#8230;": "&hellip;", // horizontal ellipsis
 		"&#8242;": "&prime;",  // prime
 		"&#8243;": "&Prime;",  // double prime
 		"&#8254;": "&oline;",  // overline
 		"&#8260;": "&frasl;",  // fraction slash
 		// Math symbols
 		"&#177;":  "&plusmn;", // plus-minus
 		"&#215;":  "&times;",  // multiplication
 		"&#247;":  "&divide;", // division
 		"&#8734;": "&infin;",  // infinity
 		"&#8776;": "&asymp;",  // almost equal
 		"&#8800;": "&ne;",     // not equal
 		"&#8804;": "&le;",     // less than or equal
 		"&#8805;": "&ge;",     // greater than or equal
 		"&#8721;": "&sum;",    // summation
 		"&#8730;": "&radic;",  // square root
 		"&#8747;": "&int;",    // integral
 		// Accented characters
 		"&#192;": "&Agrave;", // A grave
 		"&#193;": "&Aacute;", // A acute
 		"&#194;": "&Acirc;",  // A circumflex
 		"&#195;": "&Atilde;", // A tilde
 		"&#196;": "&Auml;",   // A umlaut
 		"&#197;": "&Aring;",  // A ring
 		"&#198;": "&AElig;",  // AE ligature
 		"&#199;": "&Ccedil;", // C cedilla
 		"&#200;": "&Egrave;", // E grave
 		"&#201;": "&Eacute;", // E acute
 		"&#202;": "&Ecirc;",  // E circumflex
 		"&#203;": "&Euml;",   // E umlaut
 		"&#204;": "&Igrave;", // I grave
 		"&#205;": "&Iacute;", // I acute
 		"&#206;": "&Icirc;",  // I circumflex
 		"&#207;": "&Iuml;",   // I umlaut
 		"&#208;": "&ETH;",    // Eth
 		"&#209;": "&Ntilde;", // N tilde
 		"&#210;": "&Ograve;", // O grave
 		"&#211;": "&Oacute;", // O acute
 		"&#212;": "&Ocirc;",  // O circumflex
 		"&#213;": "&Otilde;", // O tilde
 		"&#214;": "&Ouml;",   // O umlaut
 		"&#216;": "&Oslash;", // O slash
 		"&#217;": "&Ugrave;", // U grave
 		"&#218;": "&Uacute;", // U acute
 		"&#219;": "&Ucirc;",  // U circumflex
 		"&#220;": "&Uuml;",   // U umlaut
 		"&#221;": "&Yacute;", // Y acute
 		"&#222;": "&THORN;",  // Thorn
 		"&#223;": "&szlig;",  // Sharp s
 		"&#224;": "&agrave;", // a grave
 		"&#225;": "&aacute;", // a acute
 		"&#226;": "&acirc;",  // a circumflex
 		"&#227;": "&atilde;", // a tilde
 		"&#228;": "&auml;",   // a umlaut
 		"&#229;": "&aring;",  // a ring
 		"&#230;": "&aelig;",  // ae ligature
 		"&#231;": "&ccedil;", // c cedilla
 		"&#232;": "&egrave;", // e grave
 		"&#233;": "&eacute;", // e acute
 		"&#234;": "&ecirc;",  // e circumflex
 		"&#235;": "&euml;",   // e umlaut
 		"&#236;": "&igrave;", // i grave
 		"&#237;": "&iacute;", // i acute
 		"&#238;": "&icirc;",  // i circumflex
 		"&#239;": "&iuml;",   // i umlaut
 		"&#240;": "&eth;",    // eth
 		"&#241;": "&ntilde;", // n tilde
 		"&#242;": "&ograve;", // o grave
 		"&#243;": "&oacute;", // o acute
 		"&#244;": "&ocirc;",  // o circumflex
 		"&#245;": "&otilde;", // o tilde
 		"&#246;": "&ouml;",   // o umlaut
 		"&#248;": "&oslash;", // o slash
 		"&#249;": "&ugrave;", // u grave
 		"&#250;": "&uacute;", // u acute
 		"&#251;": "&ucirc;",  // u circumflex
 		"&#252;": "&uuml;",   // u umlaut
 		"&#253;": "&yacute;", // y acute
 		"&#254;": "&thorn;",  // thorn
 		"&#255;": "&yuml;",   // y umlaut
 	}
 	result := xml
 	for numeric, named := range replacements {
 		result = strings.ReplaceAll(result, numeric, named)
 	}
 	return result
 }
--- a/processor/xml_test.go
+++ b/processor/xml_test.go
--- a/processor/xpath/parser_manual_test.go
+++ b/processor/xpath/parser_manual_test.go
@@ -1,4 +0,0 @@
 // The package is now using github.com/antchfx/xmlquery for XPath parsing.
 // The parsing functionality tests have been removed since we're now
 // delegating XPath parsing to the xmlquery library.
 package xpath
--- a/processor/xpath/parser_test.go
+++ b/processor/xpath/parser_test.go
@@ -1,4 +0,0 @@
 // The package is now using github.com/antchfx/xmlquery for XPath parsing.
 // The parsing functionality tests have been removed since we're now
 // delegating XPath parsing to the xmlquery library.
 package xpath
--- a/processor/xpath/xpath.go
+++ b/processor/xpath/xpath.go
@@ -1,133 +0,0 @@
 package xpath
 import (
 	"errors"
 	"fmt"
 	"github.com/antchfx/xmlquery"
 )
 // Get retrieves nodes from XML data using an XPath expression
 func Get(node *xmlquery.Node, path string) ([]*xmlquery.Node, error) {
 	if node == nil {
 		return nil, errors.New("nil node provided")
 	}
 	// Execute xpath query directly
 	nodes, err := xmlquery.QueryAll(node, path)
 	if err != nil {
 		return nil, fmt.Errorf("failed to execute XPath query: %v", err)
 	}
 	return nodes, nil
 }
 // Set updates a single node in the XML data using an XPath expression
 func Set(node *xmlquery.Node, path string, value interface{}) error {
 	if node == nil {
 		return errors.New("nil node provided")
 	}
 	// Find the node to update
 	nodes, err := xmlquery.QueryAll(node, path)
 	if err != nil {
 		return fmt.Errorf("failed to execute XPath query: %v", err)
 	}
 	if len(nodes) == 0 {
 		return fmt.Errorf("no nodes found for path: %s", path)
 	}
 	// Update the first matching node
 	updateNodeValue(nodes[0], value)
 	return nil
 }
 // SetAll updates all nodes that match the XPath expression
 func SetAll(node *xmlquery.Node, path string, value interface{}) error {
 	if node == nil {
 		return errors.New("nil node provided")
 	}
 	// Find all nodes to update
 	nodes, err := xmlquery.QueryAll(node, path)
 	if err != nil {
 		return fmt.Errorf("failed to execute XPath query: %v", err)
 	}
 	if len(nodes) == 0 {
 		return fmt.Errorf("no nodes found for path: %s", path)
 	}
 	// Update all matching nodes
 	for _, matchNode := range nodes {
 		updateNodeValue(matchNode, value)
 	}
 	return nil
 }
 // Helper function to update a node's value
 func updateNodeValue(node *xmlquery.Node, value interface{}) {
 	strValue := fmt.Sprintf("%v", value)
 	// Handle different node types
 	switch node.Type {
 	case xmlquery.AttributeNode:
 		// For attribute nodes, update the attribute value
 		parent := node.Parent
 		if parent != nil {
 			for i, attr := range parent.Attr {
 				if attr.Name.Local == node.Data {
 					parent.Attr[i].Value = strValue
 					break
 				}
 			}
 		}
 	case xmlquery.TextNode:
 		// For text nodes, update the text content
 		node.Data = strValue
 	case xmlquery.ElementNode:
 		// For element nodes, clear existing text children and add a new text node
 		// First, remove all existing text children
 		var nonTextChildren []*xmlquery.Node
 		for child := node.FirstChild; child != nil; child = child.NextSibling {
 			if child.Type != xmlquery.TextNode {
 				nonTextChildren = append(nonTextChildren, child)
 			}
 		}
 		// Clear all children
 		node.FirstChild = nil
 		node.LastChild = nil
 		// Add a new text node
 		textNode := &xmlquery.Node{
 			Type:   xmlquery.TextNode,
 			Data:   strValue,
 			Parent: node,
 		}
 		// Set the text node as the first child
 		node.FirstChild = textNode
 		node.LastChild = textNode
 		// Add back non-text children
 		for _, child := range nonTextChildren {
 			child.Parent = node
 			// If this is the first child being added back
 			if node.FirstChild == textNode && node.LastChild == textNode {
 				node.FirstChild.NextSibling = child
 				child.PrevSibling = node.FirstChild
 				node.LastChild = child
 			} else {
 				// Add to the end of the chain
 				node.LastChild.NextSibling = child
 				child.PrevSibling = node.LastChild
 				node.LastChild = child
 			}
 		}
 	}
 }
--- a/processor/xpath/xpath_test.go
+++ b/processor/xpath/xpath_test.go
@@ -1,474 +0,0 @@
 package xpath
 import (
 	"strings"
 	"testing"
 	"github.com/antchfx/xmlquery"
 )
 // Parse test XML data once at the beginning for use in multiple tests
 func parseTestXML(t *testing.T, xmlData string) *xmlquery.Node {
 	doc, err := xmlquery.Parse(strings.NewReader(xmlData))
 	if err != nil {
 		t.Fatalf("Failed to parse test XML: %v", err)
 	}
 	return doc
 }
 // XML test data as a string for our tests
 var testXML = `
 <store>
  <book category="fiction">
    <title lang="en">The Fellowship of the Ring</title>
    <author>J.R.R. Tolkien</author>
    <year>1954</year>
    <price>22.99</price>
  </book>
  <book category="fiction">
    <title lang="en">The Two Towers</title>
    <author>J.R.R. Tolkien</author>
    <year>1954</year>
    <price>23.45</price>
  </book>
  <book category="technical">
    <title lang="en">Learning XML</title>
    <author>Erik T. Ray</author>
    <year>2003</year>
    <price>39.95</price>
  </book>
  <bicycle>
    <color>red</color>
    <price>199.95</price>
  </bicycle>
 </store>
 `
 func TestEvaluator(t *testing.T) {
 	// Parse the test XML data once for all test cases
 	doc := parseTestXML(t, testXML)
 	tests := []struct {
 		name  string
 		path  string
 		error bool
 	}{
 		{
 			name: "simple_element_access",
 			path: "/store/bicycle/color",
 		},
 		{
 			name: "recursive_element_access",
 			path: "//price",
 		},
 		{
 			name: "wildcard_element_access",
 			path: "/store/book/*",
 		},
 		{
 			name: "attribute_exists_predicate",
 			path: "//title[@lang]",
 		},
 		{
 			name: "attribute_equals_predicate",
 			path: "//title[@lang='en']",
 		},
 		{
 			name:  "value_comparison_predicate",
 			path:  "/store/book[price>35.00]/title",
 			error: true,
 		},
 		{
 			name:  "last_predicate",
 			path:  "/store/book[last()]/title",
 			error: true,
 		},
 		{
 			name:  "last_minus_predicate",
 			path:  "/store/book[last()-1]/title",
 			error: true,
 		},
 		{
 			name:  "position_predicate",
 			path:  "/store/book[position()<3]/title",
 			error: true,
 		},
 		{
 			name:  "invalid_index",
 			path:  "/store/book[10]/title",
 			error: true,
 		},
 		{
 			name: "nonexistent_element",
 			path: "/store/nonexistent",
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(doc, tt.path)
 			// Handle expected errors
 			if tt.error {
 				if err == nil && len(result) == 0 {
 					// If we expected an error but got empty results instead, that's okay
 					return
 				}
 				if err != nil {
 					// If we got an error as expected, that's okay
 					return
 				}
 			} else if err != nil {
 				// If we didn't expect an error but got one, that's a test failure
 				t.Errorf("Get(%q) returned unexpected error: %v", tt.path, err)
 				return
 			}
 			// Special cases where we don't care about exact matches
 			switch tt.name {
 			case "wildcard_element_access":
 				// Just check that we got some elements
 				if len(result) == 0 {
 					t.Errorf("Expected multiple elements for wildcard, got none")
 				}
 				return
 			case "attribute_exists_predicate", "attribute_equals_predicate":
 				// Just check that we got some titles
 				if len(result) == 0 {
 					t.Errorf("Expected titles with lang attribute, got none")
 				}
 				// Ensure all are title elements
 				for _, node := range result {
 					if node.Data != "title" {
 						t.Errorf("Expected title elements, got: %s", node.Data)
 					}
 				}
 				return
 			case "nonexistent_element":
 				// Just check that we got empty results
 				if len(result) != 0 {
 					t.Errorf("Expected empty results for nonexistent element, got %d items", len(result))
 				}
 				return
 			}
 			// For other cases, just verify we got results
 			if len(result) == 0 {
 				t.Errorf("Expected results for path %s, got none", tt.path)
 			}
 		})
 	}
 }
 func TestEdgeCases(t *testing.T) {
 	t.Run("nil_node", func(t *testing.T) {
 		result, err := Get(nil, "/store/book")
 		if err == nil {
 			t.Errorf("Expected error for nil node")
 			return
 		}
 		if len(result) > 0 {
 			t.Errorf("Expected empty result, got %v", result)
 		}
 	})
 	t.Run("invalid_xml", func(t *testing.T) {
 		invalidXML, err := xmlquery.Parse(strings.NewReader("<invalid>xml"))
 		if err != nil {
 			// If parsing fails, that's expected
 			return
 		}
 		_, err = Get(invalidXML, "/store")
 		if err == nil {
 			t.Error("Expected error for invalid XML structure")
 		}
 	})
 	// For these tests with the simple XML, we expect just one result
 	simpleXML := `<root><book><title lang="en">Test</title></book></root>`
 	doc := parseTestXML(t, simpleXML)
 	t.Run("current_node", func(t *testing.T) {
 		result, err := Get(doc, "/root/book/.")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) > 1 {
 			t.Errorf("Expected at most 1 result, got %d", len(result))
 		}
 		if len(result) > 0 {
 			// Verify it's the book node
 			if result[0].Data != "book" {
 				t.Errorf("Expected book node, got %v", result[0].Data)
 			}
 		}
 	})
 	t.Run("attributes", func(t *testing.T) {
 		result, err := Get(doc, "/root/book/title/@lang")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 || result[0].InnerText() != "en" {
 			t.Errorf("Expected 'en', got %v", result[0].InnerText())
 		}
 	})
 }
 func TestGetWithPaths(t *testing.T) {
 	// Use a simplified, well-formed XML document
 	simpleXML := `<store>
  <book category="fiction">
    <title lang="en">The Book Title</title>
    <author>Author Name</author>
    <price>19.99</price>
  </book>
  <bicycle>
    <color>red</color>
    <price>199.95</price>
  </bicycle>
 </store>`
 	// Parse the XML for testing
 	doc := parseTestXML(t, simpleXML)
 	// Debug: Print the test XML
 	t.Logf("Test XML:\n%s", simpleXML)
 	tests := []struct {
 		name          string
 		path          string
 		expectedValue string
 	}{
 		{
 			name:          "simple_element_access",
 			path:          "/store/bicycle/color",
 			expectedValue: "red",
 		},
 		{
 			name:          "attribute_access",
 			path:          "/store/book/title/@lang",
 			expectedValue: "en",
 		},
 		{
 			name:          "recursive_with_attribute",
 			path:          "//title[@lang='en']",
 			expectedValue: "The Book Title",
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			// Debug: Print the path we're looking for
 			t.Logf("Looking for path: %s", tt.path)
 			result, err := Get(doc, tt.path)
 			if err != nil {
 				t.Errorf("Get(%q) returned error: %v", tt.path, err)
 				return
 			}
 			// Debug: Print the results
 			t.Logf("Got %d results", len(result))
 			for i, r := range result {
 				t.Logf("Result %d: Node=%s, Value=%v", i, r.Data, r.InnerText())
 			}
 			// Check that we got results
 			if len(result) == 0 {
 				t.Errorf("Get(%q) returned no results", tt.path)
 				return
 			}
 			// For attribute access test, do more specific checks
 			if tt.name == "attribute_access" {
 				// Check the first result's value matches expected
 				if result[0].InnerText() != tt.expectedValue {
 					t.Errorf("Attribute value: got %v, expected %s", result[0].InnerText(), tt.expectedValue)
 				}
 			}
 			// For simple element access, check the text content
 			if tt.name == "simple_element_access" {
 				if text := result[0].InnerText(); text != tt.expectedValue {
 					t.Errorf("Element text: got %s, expected %s", text, tt.expectedValue)
 				}
 			}
 			// For recursive with attribute test, check title elements with lang="en"
 			if tt.name == "recursive_with_attribute" {
 				for _, node := range result {
 					// Check the node is a title
 					if node.Data != "title" {
 						t.Errorf("Expected title element, got %s", node.Data)
 					}
 					// Check text content
 					if text := node.InnerText(); text != tt.expectedValue {
 						t.Errorf("Text content: got %s, expected %s", text, tt.expectedValue)
 					}
 					// Check attributes - find the lang attribute
 					hasLang := false
 					for _, attr := range node.Attr {
 						if attr.Name.Local == "lang" && attr.Value == "en" {
 							hasLang = true
 							break
 						}
 					}
 					if !hasLang {
 						t.Errorf("Expected lang=\"en\" attribute, but it was not found")
 					}
 				}
 			}
 		})
 	}
 }
 func TestSet(t *testing.T) {
 	t.Run("simple element", func(t *testing.T) {
 		xmlData := `<root><name>John</name></root>`
 		doc := parseTestXML(t, xmlData)
 		err := Set(doc, "/root/name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change
 		result, err := Get(doc, "/root/name")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 {
 			t.Errorf("Expected 1 result, got %d", len(result))
 			return
 		}
 		// Check text content
 		if text := result[0].InnerText(); text != "Jane" {
 			t.Errorf("Expected text 'Jane', got '%s'", text)
 		}
 	})
 	t.Run("attribute", func(t *testing.T) {
 		xmlData := `<root><element id="123"></element></root>`
 		doc := parseTestXML(t, xmlData)
 		err := Set(doc, "/root/element/@id", "456")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change
 		result, err := Get(doc, "/root/element/@id")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 {
 			t.Errorf("Expected 1 result, got %d", len(result))
 			return
 		}
 		// For attributes, check the inner text
 		if text := result[0].InnerText(); text != "456" {
 			t.Errorf("Expected attribute value '456', got '%s'", text)
 		}
 	})
 	t.Run("indexed element", func(t *testing.T) {
 		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
 		doc := parseTestXML(t, xmlData)
 		err := Set(doc, "/root/items/item[1]", "changed")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change using XPath that specifically targets the first item
 		result, err := Get(doc, "/root/items/item[1]")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		// Check if we have results
 		if len(result) == 0 {
 			t.Errorf("Expected at least one result for /root/items/item[1]")
 			return
 		}
 		// Check text content
 		if text := result[0].InnerText(); text != "changed" {
 			t.Errorf("Expected text 'changed', got '%s'", text)
 		}
 	})
 }
 func TestSetAll(t *testing.T) {
 	t.Run("multiple elements", func(t *testing.T) {
 		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
 		doc := parseTestXML(t, xmlData)
 		err := SetAll(doc, "//item", "changed")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Verify all items are changed
 		result, err := Get(doc, "//item")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 2 {
 			t.Errorf("Expected 2 results, got %d", len(result))
 			return
 		}
 		// Check each node
 		for i, node := range result {
 			if text := node.InnerText(); text != "changed" {
 				t.Errorf("Item %d: expected text 'changed', got '%s'", i, text)
 			}
 		}
 	})
 	t.Run("attributes", func(t *testing.T) {
 		xmlData := `<root><item id="1"/><item id="2"/></root>`
 		doc := parseTestXML(t, xmlData)
 		err := SetAll(doc, "//item/@id", "new")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Verify all attributes are changed
 		result, err := Get(doc, "//item/@id")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 2 {
 			t.Errorf("Expected 2 results, got %d", len(result))
 			return
 		}
 		// For attributes, check inner text
 		for i, node := range result {
 			if text := node.InnerText(); text != "new" {
 				t.Errorf("Attribute %d: expected value 'new', got '%s'", i, text)
 			}
 		}
 	})
 }
--- a/regression/regression_test.go
+++ b/regression/regression_test.go
@@ -0,0 +1,137 @@
 package regression
 import (
 	"cook/processor"
 	"cook/utils"
 	"os"
 	"path/filepath"
 	"testing"
 )
 func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
 	command := utils.ModifyCommand{
 		Regex:    regex,
 		Lua:      lua,
 		LogLevel: "TRACE",
 	}
 	commands, err := processor.ProcessRegex(content, command, "test")
 	if err != nil {
 		return "", 0, 0, err
 	}
 	result, modifications := utils.ExecuteModifications(commands, content)
 	return result, modifications, len(commands), nil
 }
 func TestTalentsMechanicOutOfRange(t *testing.T) {
 	given := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>`
 	actual := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="30" color="gui.green"/>
      <Replace tag="[duration]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="20"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>`
 	result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	if matches != 4 {
 		t.Errorf("Expected 4 matches, got %d", matches)
 	}
 	if mods != 4 {
 		t.Errorf("Expected 4 modifications, got %d", mods)
 	}
 	if result != actual {
 		t.Errorf("expected %s, got %s", actual, result)
 	}
 }
 func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
 	cwd, err := os.Getwd()
 	if err != nil {
 		t.Fatalf("Error getting current working directory: %v", err)
 	}
 	given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	// We don't really care how many god damn matches there are as long as the result is correct
 	// if matches != 45 {
 	// 	t.Errorf("Expected 45 match, got %d", matches)
 	// }
 	//
 	// if mods != 45 {
 	// 	t.Errorf("Expected 45 modification, got %d", mods)
 	// }
 	if string(result) != string(expected) {
 		t.Errorf("expected %s, got %s", expected, result)
 	}
 }
--- a/test.xml
+++ b/test.xml
@@ -1 +0,0 @@
 <config><item><value>100</value></item></config>
--- a/test_complex.xml
+++ b/test_complex.xml
@@ -1,12 +0,0 @@
 <config>
  <item>
    <value>75</value>
    <multiplier>2</multiplier>
    <divider>4</divider>
  </item>
  <item>
    <value>150</value>
    <multiplier>3</multiplier>
    <divider>2</divider>
  </item>
 </config>
--- a/test_data.xml
+++ b/test_data.xml
@@ -1,37 +0,0 @@
 <?xml version="1.0" encoding="UTF-8"?>
 <testdata>
    <!-- Numeric values -->
    <item>
        <id>1</id>
        <value>200</value>
        <price>24.99</price>
        <quantity>5</quantity>
    </item>
    <!-- Text values -->
    <item>
        <id>2</id>
        <name>Test Product</name>
        <description>This is a test product description</description>
        <category>Test</category>
    </item>
    <!-- Mixed content -->
    <item>
        <id>3</id>
        <name>Mixed Product</name>
        <price>19.99</price>
        <code>PRD-123</code>
        <tags>sale,discount,new</tags>
    </item>
    <!-- Empty and special values -->
    <item>
        <id>4</id>
        <value></value>
        <specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
        <multiline>Line 1
 Line 2
 Line 3</multiline>
    </item>
 </testdata> 
--- a/testfiles/OutpostItems.xml
+++ b/testfiles/OutpostItems.xml
--- a/testfiles/OutpostItemsExpected.xml
+++ b/testfiles/OutpostItemsExpected.xml
--- a/testfiles/foo/bar/test.xml
+++ b/testfiles/foo/bar/test.xml
@@ -1 +0,0 @@
 <config><item><value>100</value></item></config>
--- a/utils/db.go
+++ b/utils/db.go
@@ -0,0 +1,157 @@
 package utils
 import (
 	"path/filepath"
 	"time"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	"gorm.io/driver/sqlite"
 	"gorm.io/gorm"
 	gormlogger "gorm.io/gorm/logger"
 )
 // dbLogger is a scoped logger for the utils/db package.
 var dbLogger = logger.Default.WithPrefix("utils/db")
 type DB interface {
 	DB() *gorm.DB
 	Raw(sql string, args ...any) *gorm.DB
 	SaveFile(filePath string, fileData []byte) error
 	GetFile(filePath string) ([]byte, error)
 	GetAllFiles() ([]FileSnapshot, error)
 	RemoveAllFiles() error
 }
 type FileSnapshot struct {
 	Date     time.Time `gorm:"primaryKey"`
 	FilePath string    `gorm:"primaryKey"`
 	FileData []byte    `gorm:"type:blob"`
 }
 type DBWrapper struct {
 	db *gorm.DB
 }
 var globalDB *DBWrapper
 func GetDB() (DB, error) {
 	getDBLogger := dbLogger.WithPrefix("GetDB")
 	getDBLogger.Debug("Attempting to get database connection")
 	var err error
 	dbFile := filepath.Join("data.sqlite")
 	getDBLogger.Debug("Opening database file: %q", dbFile)
 	db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
 		// SkipDefaultTransaction: true,
 		PrepareStmt: true,
 		Logger:      gormlogger.Default.LogMode(gormlogger.Silent),
 	})
 	if err != nil {
 		getDBLogger.Error("Failed to open database: %v", err)
 		return nil, err
 	}
 	getDBLogger.Debug("Database opened successfully, running auto migration")
 	if err := db.AutoMigrate(&FileSnapshot{}); err != nil {
 		getDBLogger.Error("Auto migration failed: %v", err)
 		return nil, err
 	}
 	getDBLogger.Debug("Auto migration completed")
 	globalDB = &DBWrapper{db: db}
 	getDBLogger.Debug("Database wrapper initialized")
 	return globalDB, nil
 }
 // Just a wrapper
 func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
 	rawLogger := dbLogger.WithPrefix("Raw").WithField("sql", sql)
 	rawLogger.Debug("Executing raw SQL query with args: %v", args)
 	return db.db.Raw(sql, args...)
 }
 func (db *DBWrapper) DB() *gorm.DB {
 	dbLogger.WithPrefix("DB").Debug("Returning GORM DB instance")
 	return db.db
 }
 func (db *DBWrapper) FileExists(filePath string) (bool, error) {
 	fileExistsLogger := dbLogger.WithPrefix("FileExists").WithField("filePath", filePath)
 	fileExistsLogger.Debug("Checking if file exists in database")
 	var count int64
 	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
 	if err != nil {
 		fileExistsLogger.Error("Error checking if file exists: %v", err)
 		return false, err
 	}
 	fileExistsLogger.Debug("File exists: %t", count > 0)
 	return count > 0, err
 }
 func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
 	saveFileLogger := dbLogger.WithPrefix("SaveFile").WithField("filePath", filePath)
 	saveFileLogger.Debug("Attempting to save file to database")
 	saveFileLogger.Trace("File data length: %d", len(fileData))
 	exists, err := db.FileExists(filePath)
 	if err != nil {
 		saveFileLogger.Error("Error checking if file exists: %v", err)
 		return err
 	}
 	if exists {
 		saveFileLogger.Debug("File already exists, skipping save")
 		return nil
 	}
 	saveFileLogger.Debug("Creating new file snapshot in database")
 	err = db.db.Create(&FileSnapshot{
 		Date:     time.Now(),
 		FilePath: filePath,
 		FileData: fileData,
 	}).Error
 	if err != nil {
 		saveFileLogger.Error("Failed to create file snapshot: %v", err)
 	} else {
 		saveFileLogger.Debug("File saved successfully to database")
 	}
 	return err
 }
 func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
 	getFileLogger := dbLogger.WithPrefix("GetFile").WithField("filePath", filePath)
 	getFileLogger.Debug("Getting file from database")
 	var fileSnapshot FileSnapshot
 	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
 	if err != nil {
 		// Downgrade not-found to warning to avoid noisy errors during first run
 		getFileLogger.Warning("Failed to get file from database: %v", err)
 		return nil, err
 	}
 	getFileLogger.Debug("File found in database")
 	getFileLogger.Trace("Retrieved file data length: %d", len(fileSnapshot.FileData))
 	return fileSnapshot.FileData, nil
 }
 func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
 	getAllFilesLogger := dbLogger.WithPrefix("GetAllFiles")
 	getAllFilesLogger.Debug("Getting all files from database")
 	var fileSnapshots []FileSnapshot
 	err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
 	if err != nil {
 		getAllFilesLogger.Error("Failed to get all files from database: %v", err)
 		return nil, err
 	}
 	getAllFilesLogger.Debug("Found %d files in database", len(fileSnapshots))
 	getAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
 	return fileSnapshots, nil
 }
 func (db *DBWrapper) RemoveAllFiles() error {
 	removeAllFilesLogger := dbLogger.WithPrefix("RemoveAllFiles")
 	removeAllFilesLogger.Debug("Removing all files from database")
 	err := db.db.Exec("DELETE FROM file_snapshots").Error
 	if err != nil {
 		removeAllFilesLogger.Error("Failed to remove all files from database: %v", err)
 	} else {
 		removeAllFilesLogger.Debug("All files removed from database")
 	}
 	return err
 }
--- a/utils/file.go
+++ b/utils/file.go
@@ -0,0 +1,152 @@
 package utils
 import (
 	"os"
 	"path/filepath"
 	"strconv"
 	"strings"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // fileLogger is a scoped logger for the utils/file package.
 var fileLogger = logger.Default.WithPrefix("utils/file")
 func CleanPath(path string) string {
 	cleanPathLogger := fileLogger.WithPrefix("CleanPath")
 	cleanPathLogger.Debug("Cleaning path: %q", path)
 	cleanPathLogger.Trace("Original path: %q", path)
 	path = filepath.Clean(path)
 	path = strings.ReplaceAll(path, "\\", "/")
 	cleanPathLogger.Trace("Cleaned path result: %q", path)
 	return path
 }
 func ToAbs(path string) string {
 	toAbsLogger := fileLogger.WithPrefix("ToAbs")
 	toAbsLogger.Debug("Converting path to absolute: %q", path)
 	toAbsLogger.Trace("Input path: %q", path)
 	if filepath.IsAbs(path) {
 		toAbsLogger.Debug("Path is already absolute, cleaning it.")
 		cleanedPath := CleanPath(path)
 		toAbsLogger.Trace("Already absolute path after cleaning: %q", cleanedPath)
 		return cleanedPath
 	}
 	cwd, err := os.Getwd()
 	if err != nil {
 		toAbsLogger.Error("Error getting current working directory: %v", err)
 		return CleanPath(path)
 	}
 	toAbsLogger.Trace("Current working directory: %q", cwd)
 	cleanedPath := CleanPath(filepath.Join(cwd, path))
 	toAbsLogger.Trace("Converted absolute path result: %q", cleanedPath)
 	return cleanedPath
 }
 // LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	limitStringLogger := fileLogger.WithPrefix("LimitString").WithField("originalLength", len(s)).WithField("maxLength", maxLen)
 	limitStringLogger.Debug("Limiting string length")
 	s = strings.ReplaceAll(s, "\n", "\\n")
 	if len(s) <= maxLen {
 		limitStringLogger.Trace("String length (%d) is within max length (%d), no truncation", len(s), maxLen)
 		return s
 	}
 	limited := s[:maxLen-3] + "..."
 	limitStringLogger.Trace("String truncated from %d to %d characters: %q", len(s), len(limited), limited)
 	return limited
 }
 // StrToFloat converts a string to a float64, returning 0 on error.
 func StrToFloat(s string) float64 {
 	strToFloatLogger := fileLogger.WithPrefix("StrToFloat").WithField("inputString", s)
 	strToFloatLogger.Debug("Attempting to convert string to float")
 	f, err := strconv.ParseFloat(s, 64)
 	if err != nil {
 		strToFloatLogger.Warning("Failed to convert string %q to float, returning 0: %v", s, err)
 		return 0
 	}
 	strToFloatLogger.Trace("Successfully converted %q to float: %f", s, f)
 	return f
 }
 func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
 	resetWhereNecessaryLogger := fileLogger.WithPrefix("ResetWhereNecessary")
 	resetWhereNecessaryLogger.Debug("Starting reset where necessary operation")
 	resetWhereNecessaryLogger.Trace("File-command associations input: %v", associations)
 	dirtyFiles := make(map[string]struct{})
 	for _, association := range associations {
 		resetWhereNecessaryLogger.Debug("Processing association for file: %q", association.File)
 		for _, command := range association.Commands {
 			resetWhereNecessaryLogger.Debug("Checking command %q for reset requirement", command.Name)
 			resetWhereNecessaryLogger.Trace("Command details: %v", command)
 			if command.Reset {
 				resetWhereNecessaryLogger.Debug("Command %q requires reset for file %q, marking as dirty", command.Name, association.File)
 				dirtyFiles[association.File] = struct{}{}
 			}
 		}
 		for _, command := range association.IsolateCommands {
 			resetWhereNecessaryLogger.Debug("Checking isolate command %q for reset requirement", command.Name)
 			resetWhereNecessaryLogger.Trace("Isolate command details: %v", command)
 			if command.Reset {
 				resetWhereNecessaryLogger.Debug("Isolate command %q requires reset for file %q, marking as dirty", command.Name, association.File)
 				dirtyFiles[association.File] = struct{}{}
 			}
 		}
 	}
 	resetWhereNecessaryLogger.Debug("Identified %d files that need to be reset", len(dirtyFiles))
 	resetWhereNecessaryLogger.Trace("Dirty files identified: %v", dirtyFiles)
 	for file := range dirtyFiles {
 		resetWhereNecessaryLogger.Debug("Resetting file %q", file)
 		fileData, err := db.GetFile(file)
 		if err != nil {
 			resetWhereNecessaryLogger.Warning("Failed to get original content for file %q from database: %v", file, err)
 			// Seed the snapshot from current disk content if missing, then use it as fallback
 			currentData, readErr := os.ReadFile(file)
 			if readErr != nil {
 				resetWhereNecessaryLogger.Warning("Additionally failed to read current file content for %q: %v", file, readErr)
 				continue
 			}
 			// Best-effort attempt to save baseline; ignore errors to avoid blocking reset
 			if saveErr := db.SaveFile(file, currentData); saveErr != nil {
 				resetWhereNecessaryLogger.Warning("Failed to seed baseline snapshot for %q: %v", file, saveErr)
 			}
 			fileData = currentData
 		}
 		resetWhereNecessaryLogger.Trace("Retrieved original file data length for %q: %d", file, len(fileData))
 		resetWhereNecessaryLogger.Debug("Writing original content back to file %q", file)
 		err = os.WriteFile(file, fileData, 0644)
 		if err != nil {
 			resetWhereNecessaryLogger.Warning("Failed to write original content back to file %q: %v", file, err)
 			continue
 		}
 		resetWhereNecessaryLogger.Debug("Successfully reset file %q", file)
 	}
 	resetWhereNecessaryLogger.Debug("Finished reset where necessary operation")
 	return nil
 }
 func ResetAllFiles(db DB) error {
 	resetAllFilesLogger := fileLogger.WithPrefix("ResetAllFiles")
 	resetAllFilesLogger.Debug("Starting reset all files operation")
 	fileSnapshots, err := db.GetAllFiles()
 	if err != nil {
 		resetAllFilesLogger.Error("Failed to get all file snapshots from database: %v", err)
 		return err
 	}
 	resetAllFilesLogger.Debug("Found %d files in database to reset", len(fileSnapshots))
 	resetAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
 	for _, fileSnapshot := range fileSnapshots {
 		resetAllFilesLogger.Debug("Resetting file %q", fileSnapshot.FilePath)
 		err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
 		if err != nil {
 			resetAllFilesLogger.Warning("Failed to write file %q to disk: %v", fileSnapshot.FilePath, err)
 			continue
 		}
 		resetAllFilesLogger.Debug("File %q written to disk successfully", fileSnapshot.FilePath)
 	}
 	resetAllFilesLogger.Debug("Finished reset all files operation")
 	return nil
 }
--- a/utils/flags.go
+++ b/utils/flags.go
@@ -0,0 +1,21 @@
 package utils
 import (
 	"flag"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // flagsLogger is a scoped logger for the utils/flags package.
 var flagsLogger = logger.Default.WithPrefix("utils/flags")
 var (
 	ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
 	Filter        = flag.String("f", "", "Filter commands before running them")
 	JSON          = flag.Bool("json", false, "Enable JSON mode for processing JSON files")
 )
 func init() {
 	flagsLogger.Debug("Initializing flags")
 	flagsLogger.Trace("ParallelFiles initial value: %d, Filter initial value: %q, JSON initial value: %t", *ParallelFiles, *Filter, *JSON)
 }
--- a/utils/modifycommand.go
+++ b/utils/modifycommand.go
@@ -0,0 +1,375 @@
 package utils
 import (
 	"fmt"
 	"os"
 	"path/filepath"
 	"strings"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 	"github.com/bmatcuk/doublestar/v4"
 	"gopkg.in/yaml.v3"
 )
 // modifyCommandLogger is a scoped logger for the utils/modifycommand package.
 var modifyCommandLogger = logger.Default.WithPrefix("utils/modifycommand")
 type ModifyCommand struct {
 	Name      string                 `yaml:"name,omitempty"`
 	Regex     string                 `yaml:"regex,omitempty"`
 	Regexes   []string               `yaml:"regexes,omitempty"`
 	Lua       string                 `yaml:"lua,omitempty"`
 	Files     []string               `yaml:"files,omitempty"`
 	Reset     bool                   `yaml:"reset,omitempty"`
 	LogLevel  string                 `yaml:"loglevel,omitempty"`
 	Isolate   bool                   `yaml:"isolate,omitempty"`
 	NoDedup   bool                   `yaml:"nodedup,omitempty"`
 	Disabled  bool                   `yaml:"disable,omitempty"`
 	JSON      bool                   `yaml:"json,omitempty"`
 	Modifiers map[string]interface{} `yaml:"modifiers,omitempty"`
 }
 type CookFile []ModifyCommand
 func (c *ModifyCommand) Validate() error {
 	validateLogger := modifyCommandLogger.WithPrefix("Validate").WithField("commandName", c.Name)
 	validateLogger.Debug("Validating command")
 	// For JSON mode, regex patterns are not required
 	if !c.JSON {
 		if c.Regex == "" && len(c.Regexes) == 0 {
 			validateLogger.Error("Validation failed: Regex pattern is required for non-JSON mode")
 			return fmt.Errorf("pattern is required for non-JSON mode")
 		}
 	}
 	if c.Lua == "" {
 		validateLogger.Error("Validation failed: Lua expression is required")
 		return fmt.Errorf("lua expression is required")
 	}
 	if len(c.Files) == 0 {
 		validateLogger.Error("Validation failed: At least one file is required")
 		return fmt.Errorf("at least one file is required")
 	}
 	if c.LogLevel == "" {
 		validateLogger.Debug("LogLevel not specified, defaulting to INFO")
 		c.LogLevel = "INFO"
 	}
 	validateLogger.Debug("Command validated successfully")
 	return nil
 }
 // Ehh.. Not much better... Guess this wasn't the big deal
 var matchesMemoTable map[string]bool = make(map[string]bool)
 func Matches(path string, glob string) (bool, error) {
 	matchesLogger := modifyCommandLogger.WithPrefix("Matches").WithField("path", path).WithField("glob", glob)
 	matchesLogger.Debug("Checking if path matches glob")
 	key := fmt.Sprintf("%s:%s", path, glob)
 	if matches, ok := matchesMemoTable[key]; ok {
 		matchesLogger.Debug("Found match in memo table: %t", matches)
 		return matches, nil
 	}
 	matches, err := doublestar.Match(glob, path)
 	if err != nil {
 		matchesLogger.Error("Failed to match glob: %v", err)
 		return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
 	}
 	matchesMemoTable[key] = matches
 	matchesLogger.Debug("Match result: %t, storing in memo table", matches)
 	return matches, nil
 }
 func SplitPattern(pattern string) (string, string) {
 	splitPatternLogger := modifyCommandLogger.WithPrefix("SplitPattern").WithField("pattern", pattern)
 	splitPatternLogger.Debug("Splitting pattern")
 	splitPatternLogger.Trace("Original pattern: %q", pattern)
 	static, pattern := doublestar.SplitPattern(pattern)
 	cwd, err := os.Getwd()
 	if err != nil {
 		splitPatternLogger.Error("Error getting current working directory: %v", err)
 		return "", ""
 	}
 	splitPatternLogger.Trace("Current working directory: %q", cwd)
 	if static == "" {
 		splitPatternLogger.Debug("Static part is empty, defaulting to current working directory")
 		static = cwd
 	}
 	if !filepath.IsAbs(static) {
 		splitPatternLogger.Debug("Static part is not absolute, joining with current working directory")
 		static = filepath.Join(cwd, static)
 		static = filepath.Clean(static)
 		splitPatternLogger.Trace("Static path after joining and cleaning: %q", static)
 	}
 	static = strings.ReplaceAll(static, "\\", "/")
 	splitPatternLogger.Trace("Final static path: %q, Remaining pattern: %q", static, pattern)
 	return static, pattern
 }
 type FileCommandAssociation struct {
 	File            string
 	IsolateCommands []ModifyCommand
 	Commands        []ModifyCommand
 }
 func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
 	associateFilesLogger := modifyCommandLogger.WithPrefix("AssociateFilesWithCommands")
 	associateFilesLogger.Debug("Associating files with commands")
 	associateFilesLogger.Trace("Input files: %v", files)
 	associateFilesLogger.Trace("Input commands: %v", commands)
 	associationCount := 0
 	fileCommands := make(map[string]FileCommandAssociation)
 	for _, file := range files {
 		file = strings.ReplaceAll(file, "\\", "/")
 		associateFilesLogger.Debug("Processing file: %q", file)
 		fileCommands[file] = FileCommandAssociation{
 			File:            file,
 			IsolateCommands: []ModifyCommand{},
 			Commands:        []ModifyCommand{},
 		}
 		for _, command := range commands {
 			associateFilesLogger.Debug("Checking command %q for file %q", command.Name, file)
 			for _, glob := range command.Files {
 				glob = strings.ReplaceAll(glob, "\\", "/")
 				static, pattern := SplitPattern(glob)
 				associateFilesLogger.Trace("Glob parts for %q → static=%q pattern=%q", glob, static, pattern)
 				// Build absolute path for the current file to compare with static
 				cwd, err := os.Getwd()
 				if err != nil {
 					associateFilesLogger.Warning("Failed to get CWD when matching %q for file %q: %v", glob, file, err)
 					continue
 				}
 				var absFile string
 				if filepath.IsAbs(file) {
 					absFile = filepath.Clean(file)
 				} else {
 					absFile = filepath.Clean(filepath.Join(cwd, file))
 				}
 				absFile = strings.ReplaceAll(absFile, "\\", "/")
 				associateFilesLogger.Trace("Absolute file path resolved for matching: %q", absFile)
 				// Only match if the file is under the static root
 				if !(strings.HasPrefix(absFile, static+"/") || absFile == static) {
 					associateFilesLogger.Trace("Skipping glob %q for file %q because file is outside static root %q", glob, file, static)
 					continue
 				}
 				patternFile := strings.TrimPrefix(absFile, static+`/`)
 				associateFilesLogger.Trace("Pattern-relative path used for match: %q", patternFile)
 				matches, err := Matches(patternFile, pattern)
 				if err != nil {
 					associateFilesLogger.Warning("Failed to match glob %q with file %q: %v", glob, file, err)
 					continue
 				}
 				if matches {
 					associateFilesLogger.Debug("File %q matches glob %q. Associating with command %q", file, glob, command.Name)
 					association := fileCommands[file]
 					if command.Isolate {
 						associateFilesLogger.Debug("Command %q is an isolate command, adding to isolate list", command.Name)
 						association.IsolateCommands = append(association.IsolateCommands, command)
 					} else {
 						associateFilesLogger.Debug("Command %q is a regular command, adding to regular list", command.Name)
 						association.Commands = append(association.Commands, command)
 					}
 					fileCommands[file] = association
 					associationCount++
 				} else {
 					associateFilesLogger.Trace("File %q did not match glob %q (pattern=%q, rel=%q)", file, glob, pattern, patternFile)
 				}
 			}
 		}
 		currentFileCommands := fileCommands[file]
 		associateFilesLogger.Debug("Finished processing file %q. Found %d regular commands and %d isolate commands", file, len(currentFileCommands.Commands), len(currentFileCommands.IsolateCommands))
 		associateFilesLogger.Trace("Commands for file %q: %v", file, currentFileCommands.Commands)
 		associateFilesLogger.Trace("Isolate commands for file %q: %v", file, currentFileCommands.IsolateCommands)
 	}
 	associateFilesLogger.Info("Completed association. Found %d total associations for %d files and %d commands", associationCount, len(files), len(commands))
 	return fileCommands, nil
 }
 func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
 	aggregateGlobsLogger := modifyCommandLogger.WithPrefix("AggregateGlobs")
 	aggregateGlobsLogger.Debug("Aggregating glob patterns from commands")
 	aggregateGlobsLogger.Trace("Input commands for aggregation: %v", commands)
 	globs := make(map[string]struct{})
 	for _, command := range commands {
 		aggregateGlobsLogger.Debug("Processing command %q for glob patterns", command.Name)
 		for _, glob := range command.Files {
 			resolvedGlob := strings.Replace(glob, "~", os.Getenv("HOME"), 1)
 			resolvedGlob = strings.ReplaceAll(resolvedGlob, "\\", "/")
 			aggregateGlobsLogger.Trace("Adding glob: %q (resolved to %q)", glob, resolvedGlob)
 			globs[resolvedGlob] = struct{}{}
 		}
 	}
 	aggregateGlobsLogger.Debug("Finished aggregating globs. Found %d unique glob patterns", len(globs))
 	aggregateGlobsLogger.Trace("Aggregated unique globs: %v", globs)
 	return globs
 }
 func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
 	expandGlobsLogger := modifyCommandLogger.WithPrefix("ExpandGLobs")
 	expandGlobsLogger.Debug("Expanding glob patterns to actual files")
 	expandGlobsLogger.Trace("Input patterns for expansion: %v", patterns)
 	var files []string
 	filesMap := make(map[string]bool)
 	cwd, err := os.Getwd()
 	if err != nil {
 		expandGlobsLogger.Error("Failed to get current working directory: %v", err)
 		return nil, fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	expandGlobsLogger.Debug("Current working directory: %q", cwd)
 	for pattern := range patterns {
 		expandGlobsLogger.Debug("Processing glob pattern: %q", pattern)
 		static, pattern := SplitPattern(pattern)
 		matches, err := doublestar.Glob(os.DirFS(static), pattern)
 		if err != nil {
 			expandGlobsLogger.Warning("Error expanding glob %q in %q: %v", pattern, static, err)
 			continue
 		}
 		expandGlobsLogger.Debug("Found %d matches for pattern %q", len(matches), pattern)
 		expandGlobsLogger.Trace("Raw matches for pattern %q: %v", pattern, matches)
 		for _, m := range matches {
 			m = filepath.Join(static, m)
 			info, err := os.Stat(m)
 			if err != nil {
 				expandGlobsLogger.Warning("Error getting file info for %q: %v", m, err)
 				continue
 			}
 			if !info.IsDir() && !filesMap[m] {
 				expandGlobsLogger.Trace("Adding unique file to list: %q", m)
 				filesMap[m], files = true, append(files, m)
 			}
 		}
 	}
 	if len(files) > 0 {
 		expandGlobsLogger.Debug("Finished expanding globs. Found %d unique files to process", len(files))
 		expandGlobsLogger.Trace("Unique files to process: %v", files)
 	} else {
 		expandGlobsLogger.Warning("No files found after expanding glob patterns.")
 	}
 	return files, nil
 }
 func LoadCommands(args []string) ([]ModifyCommand, error) {
 	loadCommandsLogger := modifyCommandLogger.WithPrefix("LoadCommands")
 	loadCommandsLogger.Debug("Loading commands from arguments (cook files or direct patterns)")
 	loadCommandsLogger.Trace("Input arguments: %v", args)
 	commands := []ModifyCommand{}
 	for _, arg := range args {
 		loadCommandsLogger.Debug("Processing argument for commands: %q", arg)
 		newCommands, err := LoadCommandsFromCookFiles(arg)
 		if err != nil {
 			loadCommandsLogger.Error("Failed to load commands from argument %q: %v", arg, err)
 			return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
 		}
 		loadCommandsLogger.Debug("Successfully loaded %d commands from %q", len(newCommands), arg)
 		for _, cmd := range newCommands {
 			if cmd.Disabled {
 				loadCommandsLogger.Debug("Skipping disabled command: %q", cmd.Name)
 				continue
 			}
 			commands = append(commands, cmd)
 			loadCommandsLogger.Trace("Added command %q. Current total commands: %d", cmd.Name, len(commands))
 		}
 	}
 	loadCommandsLogger.Info("Finished loading commands. Total %d commands loaded", len(commands))
 	return commands, nil
 }
 func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
 	loadCookFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFiles").WithField("pattern", pattern)
 	loadCookFilesLogger.Debug("Loading commands from cook files based on pattern")
 	loadCookFilesLogger.Trace("Input pattern: %q", pattern)
 	static, pattern := SplitPattern(pattern)
 	commands := []ModifyCommand{}
 	cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
 	if err != nil {
 		loadCookFilesLogger.Error("Failed to glob cook files for pattern %q: %v", pattern, err)
 		return nil, fmt.Errorf("failed to glob cook files: %w", err)
 	}
 	loadCookFilesLogger.Debug("Found %d cook files for pattern %q", len(cookFiles), pattern)
 	loadCookFilesLogger.Trace("Cook files found: %v", cookFiles)
 	for _, cookFile := range cookFiles {
 		cookFile = filepath.Join(static, cookFile)
 		cookFile = filepath.Clean(cookFile)
 		cookFile = strings.ReplaceAll(cookFile, "\\", "/")
 		loadCookFilesLogger.Debug("Loading commands from individual cook file: %q", cookFile)
 		cookFileData, err := os.ReadFile(cookFile)
 		if err != nil {
 			loadCookFilesLogger.Error("Failed to read cook file %q: %v", cookFile, err)
 			return nil, fmt.Errorf("failed to read cook file: %w", err)
 		}
 		loadCookFilesLogger.Trace("Read %d bytes from cook file %q", len(cookFileData), cookFile)
 		newCommands, err := LoadCommandsFromCookFile(cookFileData)
 		if err != nil {
 			loadCookFilesLogger.Error("Failed to load commands from cook file data for %q: %v", cookFile, err)
 			return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
 		}
 		commands = append(commands, newCommands...)
 		loadCookFilesLogger.Debug("Added %d commands from cook file %q. Total commands now: %d", len(newCommands), cookFile, len(commands))
 	}
 	loadCookFilesLogger.Debug("Finished loading commands from cook files. Total %d commands", len(commands))
 	return commands, nil
 }
 func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
 	loadCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFile")
 	loadCommandLogger.Debug("Unmarshaling commands from cook file data")
 	loadCommandLogger.Trace("Cook file data length: %d", len(cookFileData))
 	commands := []ModifyCommand{}
 	err := yaml.Unmarshal(cookFileData, &commands)
 	if err != nil {
 		loadCommandLogger.Error("Failed to unmarshal cook file data: %v", err)
 		return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
 	}
 	loadCommandLogger.Debug("Successfully unmarshaled %d commands", len(commands))
 	loadCommandLogger.Trace("Unmarshaled commands: %v", commands)
 	return commands, nil
 }
 // CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
 func CountGlobsBeforeDedup(commands []ModifyCommand) int {
 	countGlobsLogger := modifyCommandLogger.WithPrefix("CountGlobsBeforeDedup")
 	countGlobsLogger.Debug("Counting glob patterns before deduplication")
 	count := 0
 	for _, cmd := range commands {
 		countGlobsLogger.Trace("Processing command %q, adding %d globs", cmd.Name, len(cmd.Files))
 		count += len(cmd.Files)
 	}
 	countGlobsLogger.Debug("Total glob patterns before deduplication: %d", count)
 	return count
 }
 func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
 	filterCommandsLogger := modifyCommandLogger.WithPrefix("FilterCommands").WithField("filter", filter)
 	filterCommandsLogger.Debug("Filtering commands")
 	filterCommandsLogger.Trace("Input commands: %v", commands)
 	filteredCommands := []ModifyCommand{}
 	filters := strings.Split(filter, ",")
 	filterCommandsLogger.Trace("Split filters: %v", filters)
 	for _, cmd := range commands {
 		filterCommandsLogger.Debug("Checking command %q against filters", cmd.Name)
 		for _, f := range filters {
 			if strings.Contains(cmd.Name, f) {
 				filterCommandsLogger.Debug("Command %q matches filter %q, adding to filtered list", cmd.Name, f)
 				filteredCommands = append(filteredCommands, cmd)
 				break // Command matches, no need to check other filters
 			}
 		}
 	}
 	filterCommandsLogger.Debug("Finished filtering commands. Found %d filtered commands", len(filteredCommands))
 	filterCommandsLogger.Trace("Filtered commands: %v", filteredCommands)
 	return filteredCommands
 }
--- a/utils/modifycommand_test.go
+++ b/utils/modifycommand_test.go
--- a/utils/replacecommand.go
+++ b/utils/replacecommand.go
@@ -0,0 +1,79 @@
 package utils
 import (
 	"fmt"
 	"sort"
 	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 // replaceCommandLogger is a scoped logger for the utils/replacecommand package.
 var replaceCommandLogger = logger.Default.WithPrefix("utils/replacecommand")
 type ReplaceCommand struct {
 	From int
 	To   int
 	With string
 }
 func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
 	executeModificationsLogger := replaceCommandLogger.WithPrefix("ExecuteModifications")
 	executeModificationsLogger.Debug("Executing a batch of text modifications")
 	executeModificationsLogger.Trace("Number of modifications: %d, Original file data length: %d", len(modifications), len(fileData))
 	var err error
 	sort.Slice(modifications, func(i, j int) bool {
 		return modifications[i].From > modifications[j].From
 	})
 	executeModificationsLogger.Debug("Modifications sorted in reverse order for safe replacement")
 	executeModificationsLogger.Trace("Sorted modifications: %v", modifications)
 	executed := 0
 	for idx, modification := range modifications {
 		executeModificationsLogger.Debug("Applying modification %d/%d", idx+1, len(modifications))
 		executeModificationsLogger.Trace("Current modification details: From=%d, To=%d, With=%q", modification.From, modification.To, modification.With)
 		fileData, err = modification.Execute(fileData)
 		if err != nil {
 			executeModificationsLogger.Error("Failed to execute replacement for modification %+v: %v", modification, err)
 			continue
 		}
 		executed++
 		executeModificationsLogger.Trace("File data length after modification: %d", len(fileData))
 	}
 	executeModificationsLogger.Info("Successfully applied %d text replacements", executed)
 	return fileData, executed
 }
 func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
 	executeLogger := replaceCommandLogger.WithPrefix("Execute").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With))
 	executeLogger.Debug("Attempting to execute single replacement")
 	err := m.Validate(len(fileDataStr))
 	if err != nil {
 		executeLogger.Error("Failed to validate modification: %v", err)
 		return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
 	}
 	executeLogger.Trace("Applying replacement: fileDataStr[:%d] + %q + fileDataStr[%d:]", m.From, m.With, m.To)
 	result := fileDataStr[:m.From] + m.With + fileDataStr[m.To:]
 	executeLogger.Trace("Replacement executed. Result length: %d", len(result))
 	return result, nil
 }
 func (m *ReplaceCommand) Validate(maxsize int) error {
 	validateLogger := replaceCommandLogger.WithPrefix("Validate").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With)).WithField("maxSize", maxsize)
 	validateLogger.Debug("Validating replacement command against max size")
 	if m.To < m.From {
 		validateLogger.Error("Validation failed: 'To' (%d) is less than 'From' (%d)", m.To, m.From)
 		return fmt.Errorf("command to is less than from: %v", m)
 	}
 	if m.From > maxsize || m.To > maxsize {
 		validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is greater than max size (%d)", m.From, m.To, maxsize)
 		return fmt.Errorf("command from or to is greater than replacement length: %v", m)
 	}
 	if m.From < 0 || m.To < 0 {
 		validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is less than 0", m.From, m.To)
 		return fmt.Errorf("command from or to is less than 0: %v", m)
 	}
 	validateLogger.Debug("Modification command validated successfully")
 	return nil
 }
--- a/utils/replacecommand_test.go
+++ b/utils/replacecommand_test.go
@@ -0,0 +1,504 @@
 package utils
 import (
 	"testing"
 	"github.com/stretchr/testify/assert"
 )
 func TestReplaceCommandExecute(t *testing.T) {
 	tests := []struct {
 		name        string
 		input       string
 		command     ReplaceCommand
 		expected    string
 		shouldError bool
 	}{
 		{
 			name:        "Simple replacement",
 			input:       "This is a test string",
 			command:     ReplaceCommand{From: 5, To: 7, With: "was"},
 			expected:    "This was a test string",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at beginning",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 5, With: "Hi"},
 			expected:    "Hi world",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at end",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 6, To: 11, With: "everyone"},
 			expected:    "Hello everyone",
 			shouldError: false,
 		},
 		{
 			name:        "Replace entire string",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
 			expected:    "Goodbye!",
 			shouldError: false,
 		},
 		{
 			name:        "Error: From > To",
 			input:       "Test string",
 			command:     ReplaceCommand{From: 7, To: 5, With: "fail"},
 			expected:    "Test string",
 			shouldError: true,
 		},
 		{
 			name:        "Error: From > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 10, To: 12, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 		{
 			name:        "Error: To > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 2, To: 10, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			result, err := tc.command.Execute(tc.input)
 			if tc.shouldError {
 				if err == nil {
 					t.Errorf("Expected an error for command %+v but got none", tc.command)
 				}
 			} else {
 				if err != nil {
 					t.Errorf("Unexpected error: %v", err)
 				}
 				if result != tc.expected {
 					t.Errorf("Expected %q, got %q", tc.expected, result)
 				}
 			}
 		})
 	}
 }
 func TestExecuteModifications(t *testing.T) {
 	tests := []struct {
 		name          string
 		input         string
 		modifications []ReplaceCommand
 		expected      string
 		expectedCount int
 	}{
 		{
 			name:  "Single modification",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 			},
 			expected:      "Hi world",
 			expectedCount: 1,
 		},
 		{
 			name:  "Multiple modifications",
 			input: "This is a test string",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 4, With: "That"},
 				{From: 8, To: 14, With: "sample"},
 			},
 			expected:      "That is sample string",
 			expectedCount: 2,
 		},
 		{
 			name:  "Overlapping modifications",
 			input: "ABCDEF",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 3, With: "123"}, // ABC -> 123
 				{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
 			},
 			// The actual behavior with the current implementation
 			expected:      "123yzF",
 			expectedCount: 2,
 		},
 		{
 			name:  "Sequential modifications",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 				{From: 5, To: 6, With: ""}, // Remove the space
 				{From: 6, To: 11, With: "everyone"},
 			},
 			expected:      "Hieveryone",
 			expectedCount: 3,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			// Make a copy of the modifications to avoid modifying the test case
 			mods := make([]ReplaceCommand, len(tc.modifications))
 			copy(mods, tc.modifications)
 			result, count := ExecuteModifications(mods, tc.input)
 			if count != tc.expectedCount {
 				t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
 			}
 			if result != tc.expected {
 				t.Errorf("Expected %q, got %q", tc.expected, result)
 			}
 		})
 	}
 }
 func TestReverseOrderExecution(t *testing.T) {
 	// This test verifies the current behavior of modification application
 	input := "Original text with multiple sections"
 	// Modifications in specific positions
 	modifications := []ReplaceCommand{
 		{From: 0, To: 8, With: "Modified"},  // Original -> Modified
 		{From: 9, To: 13, With: "document"}, // text -> document
 		{From: 14, To: 22, With: "without"}, // with -> without
 		{From: 23, To: 31, With: "any"},     // multiple -> any
 	}
 	// The actual current behavior of our implementation
 	expected := "Modified document withouttanytions"
 	result, count := ExecuteModifications(modifications, input)
 	if count != 4 {
 		t.Errorf("Expected 4 modifications, got %d", count)
 	}
 	if result != expected {
 		t.Errorf("Expected %q, got %q", expected, result)
 	}
 }
 // Replace text in the middle of a string with new content
 func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello replaced, how are you?", result)
 }
 // Replace with empty string (deletion)
 func TestReplaceCommandExecute_DeletesText(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello , how are you?", result)
 }
 // Replace with longer string than original segment
 func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "longerreplacement",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello longerreplacement, how are you?", result)
 }
 // From and To values are the same (zero-length replacement)
 func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   5,
 		With: "inserted",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Helloinserted world", result)
 }
 // From value is greater than To value
 func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 10,
 		To:   5,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // From or To values exceed string length
 func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   50, // Exceeds the length of the fileContent
 		With: "replaced",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world", result)
 }
 // From or To values are negative
 func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: -1,
 		To:   10,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // Modifications are applied in reverse order (from highest to lowest 'From' value)
 func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 4, With: "That"},
 		{From: 10, To: 14, With: "sample"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a sample string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // One or more modifications fail but others succeed
 func TestExecuteModificationsWithPartialFailures(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	// Create a custom ReplaceCommand implementation that will fail
 	failingCommand := ReplaceCommand{
 		From: 15,
 		To:   10, // Invalid range (To < From) to cause failure
 		With: "will fail",
 	}
 	// Valid commands
 	validCommand1 := ReplaceCommand{
 		From: 0,
 		To:   4,
 		With: "That",
 	}
 	validCommand2 := ReplaceCommand{
 		From: 26,
 		To:   38,
 		With: "modifications",
 	}
 	modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a test string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	// Only 2 out of 3 modifications should succeed
 	if executed != 2 {
 		t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
 	}
 }
 // All valid modifications are executed and the modified string is returned
 func TestExecuteModificationsAllValid(t *testing.T) {
 	// Setup test data
 	fileData := "Hello world, this is a test"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 5, With: "Hi"},
 		{From: 18, To: 20, With: "was"},
 		{From: 21, To: 27, With: "an example"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "Hi world, this was an example"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // The count of successfully executed modifications is returned
 func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
 	// Setup test data
 	fileData := "Initial text for testing"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 7, With: "Final"},
 		{From: 12, To: 16, With: "example"},
 		{From: 17, To: 24, With: "process"},
 	}
 	// Execute the function
 	_, executed := ExecuteModifications(modifications, fileData)
 	// Verify the count of executed modifications
 	expectedExecuted := 3
 	if executed != expectedExecuted {
 		t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
 	}
 }
 // Empty modifications list returns the original string with zero executed count
 func TestExecuteModificationsWithEmptyList(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	if result != fileData {
 		t.Errorf("Expected result to be %q, but got %q", fileData, result)
 	}
 	if executed != 0 {
 		t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications with identical 'From' values
 func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 10, To: 14, With: "sample"},
 		{From: 10, To: 14, With: "example"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	// Yes, it's mangled, yes, it's intentional
 	// Every subsequent command works with the modified contents of the previous command
 	// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
 	// So we prepend "example" and end up with "examplele"
 	// Whether sample or example goes first here is irrelevant to us
 	// But it just so happens that sample goes first, so we end up with "examplele"
 	expectedResult := "This is a examplele string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications that would affect each other if not sorted properly
 func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
 	// Setup test data
 	fileData := "The quick brown fox jumps over the lazy dog"
 	modifications := []ReplaceCommand{
 		{From: 4, To: 9, With: "slow"},
 		{From: 10, To: 15, With: "red"},
 		{From: 16, To: 19, With: "cat"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "The slow red cat jumps over the lazy dog"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
Author	SHA1	Message	Date
PhatPhuckDave	bff7cc2a27	Hallucinate a json mode implementation	2025-08-21 20:39:35 +02:00
PhatPhuckDave	ff30b00e71	refactor(db.go, file.go): improve database error handling and file snapshot seeding	2025-08-09 16:12:26 +02:00
PhatPhuckDave	e1eb5eeaa6	Improve config readability by removing unnecessary fields and adding omitempty	2025-08-08 09:58:03 +02:00
PhatPhuckDave	2a2e11d8e0	Add more examples to the configuration file generator	2025-08-08 09:52:47 +02:00
PhatPhuckDave	6eb4f31127	Implement regexes, an entry option allow for same modification to apply to multiple regexes and variables that can be referenced in lua	2025-08-08 09:50:31 +02:00
PhatPhuckDave	4b58e00c26	Hallucinate some logs Hallucinate more logs fix(utils/db.go): handle auto migration errors gracefully fix(utils/modifycommand.go): improve file matching accuracy fix(processor/regex.go): improve capture group deduplication logic fix(utils/db.go): add logging for database wrapper initialization feat(processor/regex.go): preserve input order when deduplicating capture groups fix(utils/modifycommand.go): add logging for file matching skips feat(processor/regex.go): add logging for capture group processing feat(main.go): add trace logging for arguments and parallel workers fix(main.go): add trace logging for file content fix(utils/db.go): add logging for database opening fix(main.go): add trace logging for file processing fix(utils/modifycommand.go): improve file matching by using absolute paths feat(modifycommand.go): add trace logging for file matching in AssociateFilesWithCommands feat(main.go): add per-file association summary for better visibility when debugging	2025-08-08 08:10:51 +02:00
PhatPhuckDave	8ffd8af13c	Use atomic values instead of mutexes	2025-08-01 16:38:31 +02:00
PhatPhuckDave	67861d4455	Now only save CHANGED files to database (before changes of course)	2025-08-01 16:34:48 +02:00
PhatPhuckDave	299e6d8bfe	Fix glob matching when backslashes are used as separators	2025-07-30 14:41:38 +02:00
PhatPhuckDave	388822e90a	Create example yml even when no args are provided ie. invalid usage	2025-07-30 14:38:29 +02:00
PhatPhuckDave	91993b4548	Improve error handling in ResetAllFiles function by logging warnings for failed file writes instead of returning errors	2025-07-27 12:47:21 +02:00
PhatPhuckDave	bb69558aaa	Fix issue where invalid isolate commands would prevent other isolate commands from running	2025-07-21 21:28:12 +02:00
PhatPhuckDave	052c670627	Add a simple trim to lua	2025-07-21 21:00:11 +02:00
PhatPhuckDave	67fd215d0e	Don't stroke out when backup doesn't exist in db	2025-07-20 11:48:55 +02:00
PhatPhuckDave	9ecbbff6fa	Implement special flags for dump and reset db	2025-07-20 11:47:45 +02:00
PhatPhuckDave	774ac0f0ca	Implement proper "reset" that reads snapshots from database	2025-07-20 11:43:25 +02:00
PhatPhuckDave	b785d24a08	Implement saving snapshots to a database	2025-07-20 11:38:08 +02:00
PhatPhuckDave	22f991e72e	Clean up shop a bit	2025-07-20 11:20:19 +02:00
PhatPhuckDave	5518b27663	Remove deprecated flags and rename filter to f	2025-07-20 11:12:58 +02:00
PhatPhuckDave	0b899dea2c	Add Disabled flag to ModifyCommand	2025-07-19 11:08:51 +02:00
PhatPhuckDave	3424fea8ad	Dump a basic "config" to example usage on failed command	2025-07-19 01:15:48 +02:00
PhatPhuckDave	ddc1d83d58	Fix file associations It was fucked because we were removing the static path and then cramming that into assications	2025-04-22 10:53:25 +02:00
PhatPhuckDave	4b0a85411d	From cook FILE - F I L E - FILEEEEE This is the 4th time I make the SAME fix	2025-04-22 10:46:03 +02:00
PhatPhuckDave	46e871b626	Fix flag collision with logger	2025-04-22 10:45:11 +02:00
PhatPhuckDave	258dcc88e7	Fix reference to utils	2025-04-18 12:48:24 +02:00
PhatPhuckDave	75bf449bed	Remove logger and replace it with a library	2025-04-18 12:47:47 +02:00
PhatPhuckDave	58586395fb	Add file util for later	2025-04-13 21:31:19 +02:00
PhatPhuckDave	c5a68af5e6	PROPERLY implement doublestar	2025-04-13 21:29:18 +02:00
PhatPhuckDave	b4c0284734	Add rimworld cook file	2025-04-09 09:47:53 +02:00
PhatPhuckDave	c5d1dad8de	Rename project to "cook" and ditch loading fgrom args, now files exclusively	2025-04-09 09:47:53 +02:00
PhatPhuckDave	4ff2ee80ee	And fix the god damn backslashes fuck windows	2025-04-01 11:29:57 +02:00
PhatPhuckDave	633eebfd2a	Support ~ in globs	2025-04-01 11:29:02 +02:00
PhatPhuckDave	5a31703840	Implement per command logger	2025-03-29 17:29:21 +01:00
PhatPhuckDave	162d0c758d	Fix some tests	2025-03-29 17:29:21 +01:00
PhatPhuckDave	14d64495b6	Add deduplicate flag	2025-03-29 17:29:21 +01:00
PhatPhuckDave	fe6e97e832	Don't deduplicate (yet)	2025-03-29 17:23:21 +01:00
PhatPhuckDave	35b3d8b099	Reduce some of the reads and writes It's really not necessary	2025-03-28 23:39:11 +01:00
PhatPhuckDave	2e3e958e15	Fix some tests and add some logs	2025-03-28 23:31:44 +01:00
PhatPhuckDave	955afc4295	Refactor running commands to separate functions	2025-03-28 16:59:22 +01:00
PhatPhuckDave	2c487bc443	Implement "Isolate" commands Commands that run alone one by one on reading and writing the file This should be used on commands that will modify a large part of the file (or generally large parts) Since that can fuck up the indices of other commands when ran together	2025-03-28 16:56:39 +01:00
PhatPhuckDave	b77224176b	Add file lua value	2025-03-28 16:47:21 +01:00
PhatPhuckDave	a2201053c5	Remove some random ass fmt printf	2025-03-28 13:24:12 +01:00
PhatPhuckDave	04cedf5ece	Fix the concurrent map writes	2025-03-28 11:35:38 +01:00
PhatPhuckDave	ebb07854cc	Memoize the match table	2025-03-28 11:31:27 +01:00
PhatPhuckDave	8a86ae2f40	Add filter flag	2025-03-28 11:20:44 +01:00
PhatPhuckDave	e8f16dda2b	Housekeeping	2025-03-28 02:14:27 +01:00
PhatPhuckDave	513773f641	Again	2025-03-28 01:26:26 +01:00
PhatPhuckDave	22914fe243	Add a lil log	2025-03-28 01:24:23 +01:00
PhatPhuckDave	2d523dfe64	Rename pattern to regex	2025-03-28 01:08:48 +01:00
PhatPhuckDave	2629722f67	Minor fixes and tweaks	2025-03-28 01:03:27 +01:00
PhatPhuckDave	1f6c4e4976	Fix up the tests and some minor bugs	2025-03-28 00:51:26 +01:00
PhatPhuckDave	bfd08e754e	Replace old tests with asserts	2025-03-28 00:40:53 +01:00
PhatPhuckDave	750010b71a	Add more tests to regex	2025-03-28 00:28:51 +01:00
PhatPhuckDave	9064a53820	Add more tests (and fix some things) for replacecommand	2025-03-28 00:23:42 +01:00
PhatPhuckDave	294c04a11a	Add more tests for modifycommand	2025-03-28 00:03:23 +01:00
PhatPhuckDave	ba7ac07001	Fix up the logs a little	2025-03-27 23:36:56 +01:00
PhatPhuckDave	5d10178bf9	Update old and add new tests	2025-03-27 23:33:57 +01:00
PhatPhuckDave	f91c2b4795	More cleaning up	2025-03-27 23:07:22 +01:00
PhatPhuckDave	057db23d09	Implement panic recovery :??	2025-03-27 23:06:46 +01:00
PhatPhuckDave	bf72734b90	Clean up regex.go a little	2025-03-27 23:04:39 +01:00
PhatPhuckDave	cc30c2bdcb	Cleanup	2025-03-27 22:56:42 +01:00
PhatPhuckDave	f453079c72	Fix up regex.go	2025-03-27 22:50:15 +01:00
PhatPhuckDave	e634fe28bd	Clean up processor	2025-03-27 22:24:59 +01:00
PhatPhuckDave	4e4b7bbd19	Implement parallel file processing	2025-03-27 22:22:43 +01:00
PhatPhuckDave	89eed3f847	Refactor git shit to its own module	2025-03-27 22:20:22 +01:00
PhatPhuckDave	f008efd5e1	Refactor modify and replace to their own files	2025-03-27 22:18:12 +01:00
PhatPhuckDave	f6def1e5a5	Refactor entirety of replace command to main for now	2025-03-27 22:11:03 +01:00
PhatPhuckDave	867b188718	Work out file reading and writing	2025-03-27 22:02:36 +01:00
PhatPhuckDave	aac29a4074	Refactor more stuff around	2025-03-27 21:58:52 +01:00
PhatPhuckDave	8a40f463f7	Implement file command association	2025-03-27 21:54:46 +01:00
PhatPhuckDave	8d4db1da91	Clean up code add some log lines and tidy up expandglobs	2025-03-27 21:49:28 +01:00
PhatPhuckDave	d41e2afe17	Update	2025-03-27 21:43:36 +01:00
PhatPhuckDave	76457d22cf	Partially rework reading args to modify command loading	2025-03-27 21:39:16 +01:00
PhatPhuckDave	912950d463	Remove the vestiges of xml and json	2025-03-27 21:31:45 +01:00
PhatPhuckDave	25326ea11b	Remove xml and json They are simply not as useful as regex at all There is nothing they can do regex cannot And they have one massive penalty: the encoding Which often results in MASSIVE diffs	2025-03-27 21:28:20 +01:00
PhatPhuckDave	df212b7fcc	Remove jsonpath and xpath	2025-03-27 21:27:47 +01:00
PhatPhuckDave	f4a963760a	Add dumptable helper function	2025-03-27 20:07:59 +01:00
PhatPhuckDave	d236811cb9	Introduce a new logging level for lua values	2025-03-27 20:06:50 +01:00
PhatPhuckDave	da93770334	Add strsplit lua helper	2025-03-27 19:56:31 +01:00
PhatPhuckDave	d9f54a8354	Fix test again	2025-03-27 19:49:57 +01:00
PhatPhuckDave	dc8da8ab63	Fix overlapping capture groups	2025-03-27 19:43:06 +01:00
PhatPhuckDave	24262a7dca	Remove old unused xml files	2025-03-27 19:31:54 +01:00
PhatPhuckDave	d77b13c363	Update regression test	2025-03-27 19:31:20 +01:00
PhatPhuckDave	a9c60a3698	Neatly align log columns	2025-03-27 19:26:14 +01:00
PhatPhuckDave	66bcf21d79	Add goroutine numbers to log lines	2025-03-27 19:19:39 +01:00
PhatPhuckDave	e847e5c3ce	Make little better logging	2025-03-27 18:53:02 +01:00
PhatPhuckDave	9a70c9696e	Fix logger	2025-03-27 18:46:28 +01:00
PhatPhuckDave	9cea103042	Implement a more better logging solution	2025-03-27 17:53:43 +01:00
PhatPhuckDave	81d8259dfc	Comment out some xml tests for now We're not working on it for now	2025-03-27 17:46:43 +01:00
PhatPhuckDave	5c5fbac63f	Make doublestar a little cleaner	2025-03-27 17:21:13 +01:00
PhatPhuckDave	3e818e61c7	Add string.format shortcut to lua	2025-03-27 15:38:07 +01:00
PhatPhuckDave	001470ffe4	Fix up regression tests	2025-03-27 15:37:57 +01:00
PhatPhuckDave	d88a76c4e2	Fix logging of groups	2025-03-26 22:26:02 +01:00
PhatPhuckDave	d3a1f1bd96	Rework regex grouping to avoid changing the same area twice	2025-03-26 22:24:19 +01:00
PhatPhuckDave	07a5f3f1a4	Add replaceCommands to avoid index suicide	2025-03-26 21:55:34 +01:00
PhatPhuckDave	e2257e082a	Add a regression test	2025-03-26 21:55:17 +01:00
PhatPhuckDave	b3fce4244d	Fix regex for numbers to support negative numbers	2025-03-26 18:30:21 +01:00
		`@@ -1 +0,0 @@`
			`<config><item><value>100</value></item></config>`