15 Commits

44 changed files with 5641 additions and 12085 deletions

3
.gitignore vendored
View File

@@ -1,4 +1 @@
*.exe *.exe
.qodo
*.sqlite
testfiles

106
.vscode/launch.json vendored
View File

@@ -5,112 +5,12 @@
"version": "0.2.0", "version": "0.2.0",
"configurations": [ "configurations": [
{ {
"name": "Launch Package (Barotrauma)", "name": "Launch Package",
"type": "go", "type": "go",
"request": "launch", "request": "launch",
"mode": "auto", "mode": "auto",
"program": "${workspaceFolder}", "program": "${fileDirname}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma", "args": []
"args": [
"-loglevel",
"trace",
"-cook",
"*.yml",
]
},
{
"name": "Launch Package (Payday 2)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
"args": [
"-loglevel",
"trace",
"*.yml",
]
},
{
"name": "Launch Package (Barotrauma cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"cookassistant.yml",
]
},
{
"name": "Launch Package (Quasimorph cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
"args": [
"cook.yml",
]
},
{
"name": "Launch Package (Rimworld cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
"args": [
"cookVehicles.yml",
]
},
{
"name": "Launch Package (Workspace)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"args": [
"tester.yml",
]
},
{
"name": "Launch Package (Avorion)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
"args": [
"*.yml",
]
},
{
"name": "Launch Package (Minecraft)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Minecraft",
"args": [
"cook_tacz.yml",
]
},
{
"name": "Launch Package (ICARUS)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-ICARUS/Icarus/Saved/IME3/Mods",
"args": [
"-loglevel",
"trace",
"cook_processorrecipes.yml",
]
} }
] ]
} }

198
README.md
View File

@@ -1,198 +0,0 @@
# Big Chef
A Go-based tool for modifying XML, JSON, and text documents using XPath/JSONPath/Regex expressions and Lua transformations.
## Features
- **Multi-Format Processing**:
- XML (XPath)
- JSON (JSONPath)
- Text (Regex)
- **Node Value Modification**: Update text values in XML elements, JSON properties or text matches
- **Attribute Manipulation**: Modify XML attributes, JSON object keys or regex capture groups
- **Conditional Logic**: Apply transformations based on document content
- **Complex Operations**:
- Mathematical calculations
- String manipulations
- Date conversions
- Structural changes
- CSV/TSV parsing with comments and headers
- Whole ass Lua environment
- **Error Handling**: Comprehensive error detection for:
- Invalid XML/JSON
- Malformed XPath/JSONPath
- Lua syntax errors
## Usage Examples
### 1. Basic field modification
```xml
<!-- Input -->
<price>44.95</price>
<!-- Command -->
chef -xml "//price" "v=v*2" input.xml
<!-- Output -->
<price>89.9</price>
```
### 2. Supports glob patterns
```xml
chef -xml "//price" "v=v*2" data/**.xml
```
### 3. Attribute Update
```xml
<!-- Input -->
<item price="10.50"/>
<!-- Command -->
chef -xml "//item/@price" "v=v*2" input.xml
<!-- Output -->
<item price="21"/>
```
### 3. JSONPath Transformation
```json
// Input
{
"products": [
{"name": "Widget", "price": 19.99},
{"name": "Gadget", "price": 29.99}
]
}
// Command
chef -json "$.products[*].price" "v=v*0.75" input.json
// Output
{
"products": [
{"name": "Widget", "price": 14.99},
{"name": "Gadget", "price": 22.49}
]
}
```
### 4. Regex Text Replacement
Regex works slightly differently, up to 12 match groups are provided as v1..v12 and s1..s12 for numbers and strings respectively.
A special shorthand "!num" is also provided that simply expands to `(\d*\.?\d+)`.
```xml
<!-- Input -->
<description>Price: $15.00 Special Offer</description>
<!-- Command -->
chef "Price: $!num Special Offer" "v1 = v1 * 0.92" input.xml
<!-- Output -->
<description>Price: $13.80 Special Offer</description>
```
### 5. Conditional Transformation
```xml
<!-- Input -->
<item stock="5" price="10.00"/>
<!-- Command -->
chef -xml "//item" "if tonumber(v.stock) > 0 then v.price = v.price * 0.8 end" input.xml
<!-- Output -->
<item stock="5" price="8.00"/>
```
### 6. CSV/TSV Processing
The Lua environment includes CSV parsing functions that support comments, headers, and custom delimiters.
```lua
-- Basic CSV parsing
local rows = fromCSV(csvText)
-- With options
local rows = fromCSV(csvText, {
delimiter = "\t", -- Tab delimiter for TSV (default: ",")
hasHeaders = true, -- First row is headers (default: false)
hasComments = true -- Filter lines starting with # (default: false)
})
-- Access by index
local value = rows[1][2]
-- Access by header name (when hasHeaders = true)
local value = rows[1].Name
-- Convert back to CSV
local csv = toCSV(rows, "\t") -- Optional delimiter parameter
```
**Example with commented TSV file:**
```lua
-- Input file:
-- #mercenary_profiles
-- Id Name Value
-- 1 Test 100
-- 2 Test2 200
local csv = readFile("mercenaries.tsv")
local rows = fromCSV(csv, {
delimiter = "\t",
hasHeaders = true,
hasComments = true
})
-- Access data
rows[1].Name -- "Test"
rows[2].Value -- "200"
```
## Lua Helper Functions
The Lua environment includes many helper functions:
### Math Functions
- `min(a, b)`, `max(a, b)` - Min/max of two numbers
- `round(x, n)` - Round to n decimal places
- `floor(x)`, `ceil(x)` - Floor/ceiling functions
### String Functions
- `upper(s)`, `lower(s)` - Case conversion
- `trim(s)` - Remove leading/trailing whitespace
- `format(s, ...)` - String formatting
- `strsplit(inputstr, sep)` - Split string by separator
### CSV Functions
- `fromCSV(csv, options)` - Parse CSV/TSV text into table of rows
- Options: `delimiter` (default: ","), `hasHeaders` (default: false), `hasComments` (default: false)
- `toCSV(rows, delimiter)` - Convert table of rows back to CSV text
### Conversion Functions
- `num(str)` - Convert string to number (returns 0 if invalid)
- `str(num)` - Convert number to string
- `is_number(str)` - Check if string is numeric
### Table Functions
- `isArray(t)` - Check if table is a sequential array
- `dump(table, depth)` - Print table structure recursively
### HTTP Functions
- `fetch(url, options)` - Make HTTP request, returns response table
- Options: `method`, `headers`, `body`
- Returns: `{status, statusText, ok, body, headers}`
### Regex Functions
- `re(pattern, input)` - Apply regex pattern, returns table with matches
## Installation
```bash
go build -o chef main.go
```
```bash
# Process XML file
./chef -xml "//price" "v=v*1.2" input.xml
# Process JSON file
./chef -json "$.prices[*]" "v=v*0.9" input.json
```

651
TalentsMechanic.xml Normal file
View File

@@ -0,0 +1,651 @@
<?xml version="1.0" encoding="utf-8"?>
<Talents>
<Talent identifier="powerarmor">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.powerarmor">
<Replace tag="[bonusmovement]" value="25" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHasItem tags="deepdivinglarge" />
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
</Abilities>
</AbilityGroupInterval>
<AddedRecipe itemidentifier="exosuit"/>
</Talent>
<Talent identifier="foolhardy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="foolhardy" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="berserker">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="berserker" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="mudraptorwrestler">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.mudraptorwrestler">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattypeself">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData weapontype="NoWeapon,Melee" />
<AbilityConditionCharacter>
<Conditional group="eq mudraptor" />
</AbilityConditionCharacter>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="heavylifting">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.heavylifting">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHoldingItem tags="alienartifact,crate"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="iamthatguy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.iamthatguy">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.skillbonus">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
<Abilities>
<CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="heavywrench"/>
</Talent>
<Talent identifier="robotics">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.robotics"/>
<Description tag="talentdescription.roboticsreminder">
<Replace tag="[amount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="defensebotspawner"/>
<AddedRecipe itemidentifier="defensebotammobox"/>
</Talent>
<Talent identifier="ironstorm">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.ironstorm">
<Replace tag="[chance]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="scrapcannon"/>
</Talent>
<Talent identifier="residualwaste">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.residualwaste">
<Replace tag="[chance]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomChance="0.2"/>
<!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
<AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="massproduction">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.massproduction">
<Replace tag="[chance]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
<Conditions>
<AbilityConditionServerRandom randomChance="0.4" />
</Conditions>
<Abilities>
<CharacterAbilityRemoveRandomIngredient>
<AbilityConditionItem category="Material"/>
</CharacterAbilityRemoveRandomIngredient>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="toolmaintenance">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.toolmaintenance">
<Replace tag="[amount]" value="1" color="gui.green"/>
</Description>
<!-- Give once when unlocking the talent -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupEffect>
<!-- Give every 60 seconds for late comers -->
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="miner">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
<Description tag="talentdescription.miner">
<Replace tag="[probability]" value="320" color="gui.green"/>
</Description>
<Description tag="talentdescription.gainoredetachspeed">
<Replace tag="[amount]" value="1600" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomchance="12.8"/>
<AbilityConditionItem tags="ore"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="retrofit">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.retrofit" />
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ironman">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="ironhelmet"/>
<AddedRecipe itemidentifier="makeshiftarmor"/>
</Talent>
<Talent identifier="oiledmachinery">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.oiledmachinery">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="pumpndump">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.pumpndump">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<conditions>
<AbilityConditionItem tags="pump"/>
</conditions>
<Abilities>
<CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ballastdenizen">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.ballastdenizen">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="engineengineer">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.engineengineer">
<Replace tag="[amount]" value="2.5" color="gui.green"/>
<Replace tag="[max]" value="5" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="1" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="2" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="3" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="4" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="5" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="6" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="7" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel minlevel="8" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="multifunctional">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.multifunctional">
<Replace tag="[powerincrease]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="wrenchitem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="crowbaritem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="salvagecrew">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.bonusxponmission">
<Replace tag="[xpbonus]" value="30" color="gui.green"/>
<Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
</Description>
<Description tag="talentdescription.salvagecrew">
<Replace tag="[swimbonus]" value="50" color="gui.green"/>
<Replace tag="[resistanceamount]" value="10" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
<Conditions>
<AbilityConditionMission missiontype="Salvage"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="1.3"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionInSubmarine submarinetype="Wreck" />
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="This" disabledeltatime="true">
<Affliction identifier="salvagecrew" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.machinemaniac">
<Replace tag="[bonus]" value="80" color="gui.green"/>
<Replace tag="[amount]" value="3" color="gui.orange"/>
</Description>
<Description tag="talentdescription.machinemaniac.30">
<Replace tag="[requirement]" value="12" color="gui.green"/>
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
<Replace tag="[xpamount]" value="500" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.50">
<Replace tag="[requirement]" value="20" color="gui.green"/>
<Replace tag="[level]" value="1" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.100">
<Replace tag="[requirement]" value="40" color="gui.green"/>
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<!-- Give the player stats that tracks if the rewards should be given -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
</Conditions>
<Abilities>
<CharacterAbilityGiveExperience amount="2000"/>
<CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
</Conditions>
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="tinkerer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.increasemaxrepairmechanical">
<Replace tag="[percentage]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="modularrepairs">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
</Description>
<Description tag="talentdescription.freeupgrade">
<Replace tag="[level]" value="1" color="gui.green"/>
<Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="repairpack"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="hullfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="25" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="fixfoamgrenade"/>
<AddedRecipe itemidentifier="handheldstatusmonitor"/>
</Talent>
<Talent identifier="letitdrain">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.letitdrain"/>
<Description tag="talentdescription.letitdrainreminder">
<Replace tag="[itemcount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="portablepump"/>
</Talent>
<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="scrapsavant">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
<Description tag="talentdescription.doublescrapoutput" />
<Description tag="talentdescription.findadditionalscrap">
<Replace tag="[probability]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionItem tags="scrap"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
<Conditions>
<AbilityConditionItemInSubmarine submarinetype="Wreck"/>
<AbilityConditionItem tags="container"/>
</Conditions>
<Abilities>
<CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
<StatusEffects>
<StatusEffect type="OnAbility" target="UseTarget" >
<SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
</StatusEffect>
</StatusEffects>
</CharacterAbilitySpawnItemsToContainer>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="safetyfirst">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="safetyharness"/>
</Talent>
</Talents>

View File

@@ -1,28 +0,0 @@
package main
import (
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
)
func main() {
// Initialize logger with DEBUG level
logger.Init(logger.LevelDebug)
// Test different log levels
logger.Info("This is an info message")
logger.Debug("This is a debug message")
logger.Warning("This is a warning message")
logger.Error("This is an error message")
logger.Trace("This is a trace message (not visible at DEBUG level)")
// Test with a goroutine
logger.SafeGo(func() {
time.Sleep(10 * time.Millisecond)
logger.Info("Message from goroutine")
})
// Wait for goroutine to complete
time.Sleep(20 * time.Millisecond)
}

View File

@@ -1,119 +0,0 @@
# Global variables (no name/regex/lua/files - only modifiers)
[[commands]]
modifiers = { foobar = 4, multiply = 1.5, prefix = 'NEW_', enabled = true }
# Multi-regex example using variable in Lua
[[commands]]
name = 'RFToolsMultiply'
regexes = [
'generatePerTick = !num',
'ticksPer\w+ = !num',
'generatorRFPerTick = !num',
]
lua = '* foobar'
files = [
'polymc/instances/**/rftools*.toml',
'polymc\instances\**\rftools*.toml',
]
reset = true
# Named capture groups with arithmetic and string ops
[[commands]]
name = 'UpdateAmountsAndItems'
regex = '(?P<amount>!num)\s+units\s+of\s+(?P<item>[A-Za-z_\-]+)'
lua = 'amount = amount * multiply; item = upper(item); return true'
files = ['data/**/*.txt']
# Full replacement via Lua 'replacement' variable
[[commands]]
name = 'BumpMinorVersion'
regex = 'version\s*=\s*"(?P<major>!num)\.(?P<minor>!num)\.(?P<patch>!num)"'
lua = 'replacement = format("version=\"%s.%s.%s\"", major, num(minor)+1, 0); return true'
files = ['config/*.ini', 'config/*.cfg']
# TOML multiline regex example - single quotes make regex natural!
[[commands]]
name = 'StressValues'
regex = '''
\[kinetics\.stressValues\.v2\.capacity\]
steam_engine = !num
water_wheel = !num
copper_valve_handle = !num
hand_crank = !num
creative_motor = !num'''
lua = 'v1 * multiply'
files = ['*.txt']
isolate = true
# Network configuration with complex multiline regex
[[commands]]
name = 'NetworkConfig'
regex = '''
networking\.firewall\.allowPing = true
networking\.firewall\.allowedTCPPorts = \[ 47984 47989 47990 \]
networking\.firewall\.allowedUDPPortRanges = \[
\{ from = \d+; to = \d+; \}
\{ from = 8000; to = 8010; \}
\]'''
lua = "replacement = string.gsub(block[1], 'true', 'false')"
files = ['*.conf']
isolate = true
# Simple regex with single quotes - no escaping needed!
[[commands]]
name = 'EnableFlags'
regex = 'enabled\s*=\s*(true|false)'
lua = '= enabled'
files = ['**/*.toml']
# Demonstrate NoDedup to allow overlapping replacements
[[commands]]
name = 'OverlappingGroups'
regex = '(?P<a>!num)(?P<b>!num)'
lua = 'a = num(a) + 1; b = num(b) + 1; return true'
files = ['overlap/**/*.txt']
nodedup = true
# Isolate command example operating on entire matched block
[[commands]]
name = 'IsolateUppercaseBlock'
regex = '''BEGIN
(?P<block>!any)
END'''
lua = 'block = upper(block); return true'
files = ['logs/**/*.log']
loglevel = 'TRACE'
isolate = true
# Using !rep placeholder and arrays of files
[[commands]]
name = 'RepeatPlaceholderExample'
regex = 'name: (.*) !rep(, .* , 2)'
lua = '-- no-op, just demonstrate placeholder; return false'
files = ['lists/**/*.yml', 'lists/**/*.yaml']
# Using string variable in Lua expression
[[commands]]
name = 'PrefixKeys'
regex = '(?P<key>[A-Za-z0-9_]+)\s*='
lua = 'key = prefix .. key; return true'
files = ['**/*.properties']
# JSON mode examples
[[commands]]
name = 'JSONArrayMultiply'
json = true
lua = 'for i, item in ipairs(data.items) do data.items[i].value = item.value * 2 end; return true'
files = ['data/**/*.json']
[[commands]]
name = 'JSONObjectUpdate'
json = true
lua = 'data.version = "2.0.0"; data.enabled = true; return true'
files = ['config/**/*.json']
[[commands]]
name = 'JSONNestedModify'
json = true
lua = 'if data.settings and data.settings.performance then data.settings.performance.multiplier = data.settings.performance.multiplier * 1.5 end; return true'
files = ['settings/**/*.json']

View File

@@ -1,7 +1,6 @@
package main package main
import ( import (
"cook/utils"
"os" "os"
"path/filepath" "path/filepath"
"testing" "testing"
@@ -77,14 +76,9 @@ func TestGlobExpansion(t *testing.T) {
for _, tc := range tests { for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) { t.Run(tc.name, func(t *testing.T) {
// Convert string patterns to map[string]struct{} for ExpandGLobs files, err := expandFilePatterns(tc.patterns)
patternMap := make(map[string]struct{})
for _, pattern := range tc.patterns {
patternMap[pattern] = struct{}{}
}
files, err := utils.ExpandGLobs(patternMap)
if err != nil { if err != nil {
t.Fatalf("ExpandGLobs failed: %v", err) t.Fatalf("expandFilePatterns failed: %v", err)
} }
if len(files) != tc.expected { if len(files) != tc.expected {

43
go.mod
View File

@@ -1,41 +1,20 @@
module cook module modify
go 1.23.2 go 1.24.1
require ( require (
git.site.quack-lab.dev/dave/cylogger v1.3.0 github.com/antchfx/xmlquery v1.4.4
github.com/bmatcuk/doublestar/v4 v4.8.1 github.com/bmatcuk/doublestar/v4 v4.8.1
github.com/stretchr/testify v1.10.0
github.com/yuin/gopher-lua v1.1.1 github.com/yuin/gopher-lua v1.1.1
gopkg.in/yaml.v3 v3.0.1
gorm.io/gorm v1.30.0
) )
require ( require (
github.com/BurntSushi/toml v1.5.0 // indirect github.com/PaesslerAG/gval v1.0.0 // indirect
github.com/davecgh/go-spew v1.1.1 // indirect github.com/PaesslerAG/jsonpath v0.1.1 // indirect
github.com/hexops/valast v1.5.0 // indirect github.com/antchfx/xpath v1.3.3 // indirect
github.com/inconshreveable/mousetrap v1.1.0 // indirect github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da // indirect
github.com/jinzhu/inflection v1.0.0 // indirect github.com/sergi/go-diff v1.3.1 // indirect
github.com/jinzhu/now v1.1.5 // indirect github.com/stretchr/testify v1.10.0 // indirect
github.com/kr/pretty v0.3.1 // indirect golang.org/x/net v0.33.0 // indirect
github.com/mattn/go-sqlite3 v1.14.22 // indirect golang.org/x/text v0.21.0 // indirect
github.com/pmezard/go-difflib v1.0.0 // indirect
github.com/rogpeppe/go-internal v1.14.1 // indirect
github.com/spf13/cobra v1.10.1 // indirect
github.com/spf13/pflag v1.0.9 // indirect
github.com/tidwall/match v1.1.1 // indirect
github.com/tidwall/pretty v1.2.0 // indirect
golang.org/x/mod v0.21.0 // indirect
golang.org/x/sync v0.11.0 // indirect
golang.org/x/text v0.22.0 // indirect
golang.org/x/tools v0.26.0 // indirect
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
mvdan.cc/gofumpt v0.4.0 // indirect
)
require (
github.com/google/go-cmp v0.6.0
github.com/tidwall/gjson v1.18.0
gorm.io/driver/sqlite v1.6.0
) )

149
go.sum
View File

@@ -1,75 +1,98 @@
git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw= github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk= github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
github.com/BurntSushi/toml v1.5.0 h1:W5quZX/G/csjUnuI8SUYlsHs9M38FC7znL0lIO+DvMg= github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
github.com/BurntSushi/toml v1.5.0/go.mod h1:ukJfTF/6rtPPRCnwkur4qwRxa8vTRFBF0uk2lLoLwho= github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38= github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc= github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
github.com/cpuguy83/go-md2man/v2 v2.0.6/go.mod h1:oOW0eioCTA6cOiMLiUPZOpcVxMig6NIQQ7OS05n1F4g= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE= github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da h1:oI5xCqsCo564l8iNU+DwB5epxmsaqB+rhGL0m5jtYqE=
github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps= github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
github.com/inconshreveable/mousetrap v1.1.0 h1:wN+x4NVGpMsO7ErUn/mUI3vEoE6Jt13X2s0bqwp9tc8=
github.com/inconshreveable/mousetrap v1.1.0/go.mod h1:vpF70FUmC8bwa3OWnCshd2FqLfsEA9PFc4w1p2J65bw=
github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs= github.com/sergi/go-diff v1.3.1 h1:xkr+Oxo4BOQKmkn/B9eMK0g5Kg/983T9DqqPHwYqD+8=
github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ= github.com/sergi/go-diff v1.3.1/go.mod h1:aMJSSKb2lpPvRNec0+w3fl7LP9IOFzdc9Pa4NFbPK1I=
github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM= github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
github.com/spf13/cobra v1.10.1 h1:lJeBwCfmrnXthfAupyUTzJ/J4Nc1RsHC/mSRU2dll/s=
github.com/spf13/cobra v1.10.1/go.mod h1:7SmJGaTHFVBY0jW4NXGluQoLvhqFQM+6XSKD+P4XaB0=
github.com/spf13/pflag v1.0.9 h1:9exaQaMOCwffKiiiYk6/BndUBv+iRViNW+4lEMi0PvY=
github.com/spf13/pflag v1.0.9/go.mod h1:McXfInJRrz4CZXVZOBLb0bTZqETkiAhM9Iw0y3An2Bg=
github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA= github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY= github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
github.com/tidwall/gjson v1.18.0 h1:FIDeeyB800efLX89e5a8Y0BNH+LOngJyGrIWxG2FKQY= github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
github.com/tidwall/gjson v1.18.0/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk=
github.com/tidwall/match v1.1.1 h1:+Ho715JplO36QYgwN9PGYNhgZvoUSc9X2c80KVTi+GA=
github.com/tidwall/match v1.1.1/go.mod h1:eRSPERbgtNPcGhD8UCthc6PmLEQXEWd3PRB5JTxsfmM=
github.com/tidwall/pretty v1.2.0 h1:RWIZEg2iJ8/g6fDDYzMpobmaoGh5OLl4AXtGUGPcqCs=
github.com/tidwall/pretty v1.2.0/go.mod h1:ITEVvHYasfjBbM0u2Pg8T2nJnzm8xPwvNhhsoaGGjNU=
github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M= github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw= github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w= golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk= golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM= golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY= golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0= golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
golang.org/x/net v0.33.0 h1:74SYHlV8BIgHIFC/LrYkOGIwL19eTYXQ5wc6TBuO36I=
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo=
golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk= gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=

View File

@@ -1,417 +0,0 @@
package main
import (
"os"
"path/filepath"
"testing"
"cook/utils"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/stretchr/testify/assert"
)
func TestIsolateCommandsSequentialExecution(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-sequential-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test file content
testContent := `BEGIN
block1 content with value 42
END
Some other content
BEGIN
block2 content with value 100
END
More content
BEGIN
block3 content with value 200
END`
testFile := filepath.Join(tmpDir, "test.txt")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create isolate commands that work sequentially on the same block
// First command: 42 -> 84
// Second command: 84 -> 168 (works on result of first command)
// Third command: 168 -> 336 (works on result of second command)
commands := []utils.ModifyCommand{
{
Name: "MultiplyFirst",
Regex: `BEGIN\n(?P<block>.*?value 42.*?)\nEND`,
Lua: `replacement = "BEGIN\n" .. string.gsub(block, "42", "84") .. "\nEND"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
{
Name: "MultiplySecond",
Regex: `BEGIN\nblock1 content with value (?P<value>!num)\nEND`,
Lua: `value = "168"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
{
Name: "MultiplyThird",
Regex: `BEGIN\nblock1 content with value (?P<value>!num)\nEND`,
Lua: `value = "336"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
}
// Associate files with commands
files := []string{"test.txt"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Verify that all three isolate commands are associated
association := associations["test.txt"]
assert.Len(t, association.IsolateCommands, 3, "Expected 3 isolate commands to be associated")
assert.Len(t, association.Commands, 0, "Expected 0 regular commands")
// Run the isolate commands
result, err := RunIsolateCommands(association, "test.txt", testContent, false)
if err != nil && err != NothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify that all isolate commands were applied sequentially
// First command: 42 -> 84
// Second command: 84 -> 168 (works on result of first)
// Third command: 168 -> 336 (works on result of second)
assert.Contains(t, result, "value 336", "Final result should be 336 after sequential processing")
// Verify that intermediate and original values are no longer present
assert.NotContains(t, result, "value 42", "Original value 42 should be replaced")
assert.NotContains(t, result, "value 84", "Intermediate value 84 should be replaced")
assert.NotContains(t, result, "value 168", "Intermediate value 168 should be replaced")
// Verify other blocks remain unchanged
assert.Contains(t, result, "value 100", "Second block should remain unchanged")
assert.Contains(t, result, "value 200", "Third block should remain unchanged")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("Result content:\n%s\n", result)
}
func TestIsolateCommandsWithDifferentPatterns(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-different-patterns-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test file content with distinct patterns
testContent := `SECTION1
value = 10
END_SECTION1
SECTION2
value = 20
END_SECTION2`
testFile := filepath.Join(tmpDir, "test.txt")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create isolate commands with different patterns on the same content
commands := []utils.ModifyCommand{
{
Name: "UpdateSection1",
Regex: `SECTION1.*?value = (?P<value>!num).*?END_SECTION1`,
Lua: `value = "100"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
{
Name: "UpdateSection2",
Regex: `SECTION2.*?value = (?P<value>!num).*?END_SECTION2`,
Lua: `value = "200"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
}
// Associate files with commands
files := []string{"test.txt"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Run the isolate commands
result, err := RunIsolateCommands(associations["test.txt"], "test.txt", testContent, false)
if err != nil && err != NothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify that both isolate commands were applied
assert.Contains(t, result, "value = 100", "Section1 should be updated")
assert.Contains(t, result, "value = 200", "Section2 should be updated")
// Verify original values are gone (use exact matches)
assert.NotContains(t, result, "\nvalue = 10\n", "Original Section1 value should be replaced")
assert.NotContains(t, result, "\nvalue = 20\n", "Original Section2 value should be replaced")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("Result content:\n%s\n", result)
}
func TestIsolateCommandsWithJSONMode(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-json-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test JSON content
testContent := `{
"section1": {
"value": 42
},
"section2": {
"value": 100
}
}`
testFile := filepath.Join(tmpDir, "test.json")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create isolate commands with JSON mode
commands := []utils.ModifyCommand{
{
Name: "UpdateJSONFirst",
JSON: true,
Lua: `data.section1.value = data.section1.value * 2; return true`,
Files: []string{"test.json"},
Isolate: true,
},
{
Name: "UpdateJSONSecond",
JSON: true,
Lua: `data.section2.value = data.section2.value * 3; return true`,
Files: []string{"test.json"},
Isolate: true,
},
}
// Associate files with commands
files := []string{"test.json"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Run the isolate commands
result, err := RunIsolateCommands(associations["test.json"], "test.json", testContent, false)
if err != nil && err != NothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify that both JSON isolate commands were applied
assert.Contains(t, result, `"value": 84`, "Section1 value should be doubled (42 * 2 = 84)")
assert.Contains(t, result, `"value": 300`, "Section2 value should be tripled (100 * 3 = 300)")
// Verify original values are gone
assert.NotContains(t, result, `"value": 42`, "Original Section1 value should be replaced")
assert.NotContains(t, result, `"value": 100`, "Original Section2 value should be replaced")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("Result content:\n%s\n", result)
}
func TestIsolateVsRegularCommands(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-regular-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test file with distinct sections
testContent := `ISOLATE_SECTION
value = 5
END_ISOLATE
REGULAR_SECTION
value = 10
END_REGULAR`
testFile := filepath.Join(tmpDir, "test.txt")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create both isolate and regular commands
commands := []utils.ModifyCommand{
{
Name: "IsolateMultiply",
Regex: `ISOLATE_SECTION.*?value = (?P<value>!num).*?END_ISOLATE`,
Lua: `value = tostring(num(value) * 10); return true`,
Files: []string{"test.txt"},
Isolate: true,
},
{
Name: "RegularMultiply",
Regex: `value = (?P<value>!num)`,
Lua: `value = tostring(num(value) + 100); return true`,
Files: []string{"test.txt"},
},
}
// Associate files with commands
files := []string{"test.txt"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Verify the association
association := associations["test.txt"]
assert.Len(t, association.IsolateCommands, 1, "Expected 1 isolate command")
assert.Len(t, association.Commands, 1, "Expected 1 regular command")
// First run isolate commands
isolateResult, err := RunIsolateCommands(association, "test.txt", testContent, false)
if err != nil && err != NothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify isolate command result
assert.Contains(t, isolateResult, "value = 50", "Isolate section should be 5 * 10 = 50")
assert.Contains(t, isolateResult, "value = 10", "Regular section should be unchanged by isolate commands")
// Then run regular commands
commandLoggers := make(map[string]*logger.Logger)
finalResult, err := RunOtherCommands("test.txt", isolateResult, association, commandLoggers, false)
if err != nil && err != NothingToDo {
t.Fatalf("Failed to run regular commands: %v", err)
}
// Verify final results - regular commands should affect ALL values
assert.Contains(t, finalResult, "value = 150", "Isolate section should be 50 + 100 = 150")
assert.Contains(t, finalResult, "value = 110", "Regular section should be 10 + 100 = 110")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("After isolate commands:\n%s\n", isolateResult)
t.Logf("Final result:\n%s\n", finalResult)
}
func TestMultipleIsolateModifiersOnSameValue(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-same-value-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test file content that matches the scenario in the issue
testContent := `irons_spellbooks:chain_creeper
SpellPowerMultiplier = 1
irons_spellbooks:chain_lightning
SpellPowerMultiplier = 1`
testFile := filepath.Join(tmpDir, "irons_spellbooks-server.toml")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create isolate commands that match the issue scenario
// First command: targets chain_creeper and chain_lightning with multiplier *4
// Second command: targets all SpellPowerMultiplier with multiplier *4
commands := []utils.ModifyCommand{
{
Name: "healing",
Regexes: []string{
`irons_spellbooks:chain_creeper[\s\S]*?SpellPowerMultiplier = !num`,
`irons_spellbooks:chain_lightning[\s\S]*?SpellPowerMultiplier = !num`,
},
Lua: `v1 * 4`, // This should multiply by 4
Files: []string{"irons_spellbooks-server.toml"},
Reset: true,
Isolate: true,
},
{
Name: "spellpower",
Regex: `SpellPowerMultiplier = !num`,
Lua: `v1 * 4`, // This should multiply by 4 again
Files: []string{"irons_spellbooks-server.toml"},
Reset: true,
Isolate: true,
},
}
// Associate files with commands
files := []string{"irons_spellbooks-server.toml"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Verify that both isolate commands are associated
association := associations["irons_spellbooks-server.toml"]
assert.Len(t, association.IsolateCommands, 2, "Expected 2 isolate commands to be associated")
assert.Len(t, association.Commands, 0, "Expected 0 regular commands")
// Run the isolate commands
result, err := RunIsolateCommands(association, "irons_spellbooks-server.toml", testContent, false)
if err != nil && err != NothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify that both isolate commands were applied sequentially
// Expected: 1 -> 4 (first command) -> 16 (second command)
assert.Contains(t, result, "SpellPowerMultiplier = 16", "Final result should be 16 after sequential processing (1 * 4 * 4)")
// The system is actually working correctly! Both isolate commands are applied:
// First command (healing): 1 -> 4
// Second command (spellpower): 4 -> 16
// The final result shows 16, which means both modifiers were applied
assert.Contains(t, result, "SpellPowerMultiplier = 16", "The system correctly applies both isolate modifiers sequentially")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("Result content:\n%s\n", result)
}

745
main.go
View File

@@ -1,669 +1,182 @@
package main package main
import ( import (
_ "embed" "flag"
"errors" "fmt"
"log"
"os" "os"
"sort"
"sync" "sync"
"sync/atomic"
"time"
"cook/processor" "github.com/bmatcuk/doublestar/v4"
"cook/utils"
logger "git.site.quack-lab.dev/dave/cylogger" "modify/processor"
"github.com/spf13/cobra"
) )
//go:embed example_cook.toml
var exampleTOMLContent string
// mainLogger is a scoped logger for the main package.
var mainLogger = logger.Default.WithPrefix("main")
type GlobalStats struct { type GlobalStats struct {
TotalMatches int64 TotalMatches int
TotalModifications int64 TotalModifications int
ProcessedFiles int64 ProcessedFiles int
FailedFiles int64 FailedFiles int
ModificationsPerCommand sync.Map
} }
var ( type FileMode string
stats GlobalStats = GlobalStats{
ModificationsPerCommand: sync.Map{}, const (
} ModeRegex FileMode = "regex"
ModeXML FileMode = "xml"
ModeJSON FileMode = "json"
) )
// rootCmd represents the base command when called without any subcommands var stats GlobalStats
var rootCmd *cobra.Command var logger *log.Logger
var (
fileModeFlag = flag.String("mode", "regex", "Processing mode: regex, xml, json")
verboseFlag = flag.Bool("verbose", false, "Enable verbose output")
)
func init() { func init() {
rootCmd = &cobra.Command{ log.SetFlags(log.Lmicroseconds | log.Lshortfile)
Use: "modifier [options] <pattern> <lua_expression> <...files_or_globs>", logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
Short: "A powerful file modification tool with Lua scripting",
Long: `Modifier is a powerful file processing tool that supports regex patterns,
JSON manipulation, and YAML to TOML conversion with Lua scripting capabilities.
Features: stats = GlobalStats{}
- Regex-based pattern matching and replacement
- JSON file processing with query support
- YAML to TOML conversion
- Lua scripting for complex transformations
- Parallel file processing
- Command filtering and organization`,
PersistentPreRun: func(cmd *cobra.Command, args []string) {
logger.InitFlag()
mainLogger.Info("Initializing with log level: %s", logger.GetLevel().String())
mainLogger.Trace("Full argv: %v", os.Args)
},
Run: func(cmd *cobra.Command, args []string) {
exampleFlag, _ := cmd.Flags().GetBool("example")
if exampleFlag {
CreateExampleConfig()
return
}
if len(args) == 0 {
cmd.Usage()
return
}
runModifier(args, cmd)
},
}
// Global flags
rootCmd.PersistentFlags().StringP("loglevel", "l", "INFO", "Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE")
// Local flags
rootCmd.Flags().IntP("parallel", "P", 100, "Number of files to process in parallel")
rootCmd.Flags().StringP("filter", "f", "", "Filter commands before running them")
rootCmd.Flags().Bool("json", false, "Enable JSON mode for processing JSON files")
rootCmd.Flags().BoolP("conv", "c", false, "Convert YAML files to TOML format")
rootCmd.Flags().BoolP("example", "e", false, "Generate example_cook.toml and exit")
// Set up examples in the help text
rootCmd.SetUsageTemplate(`Usage:{{if .Runnable}}
{{.UseLine}}{{end}}{{if .HasAvailableSubCommands}}
{{.CommandPath}} [command]{{end}} {{if gt (len .Aliases) 0}}
Aliases:
{{.NameAndAliases}}{{end}}{{if .HasExample}}
Examples:
{{.Example}}{{end}}{{if .HasAvailableSubCommands}}
Available Commands:{{range .Commands}}{{if (or .IsAvailableCommand (eq .Name "help"))}}
{{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableLocalFlags}}
Flags:
{{.LocalFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasAvailableInheritedFlags}}
Global Flags:
{{.InheritedFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasHelpSubCommands}}
Additional help topics:{{range .Commands}}{{if .IsAdditionalHelpTopicCommand}}
{{rpad .CommandPath .CommandPathPadding}} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableSubCommands}}
Use "{{.CommandPath}} [command] --help" for more information about a command.{{end}}
`)
// Add examples
rootCmd.Example = ` Regex mode (default):
modifier "<value>(\\d+)</value>" "*1.5" data.xml
JSON mode:
modifier -json data.json
YAML to TOML conversion:
modifier -conv *.yml
modifier -conv **/*.yaml
With custom parallelism and filtering:
modifier -P 50 -f "mycommand" "pattern" "expression" files.txt
Note: v1, v2, etc. are used to refer to capture groups as numbers.
s1, s2, etc. are used to refer to capture groups as strings.
Helper functions: num(str) converts string to number, str(num) converts number to string
is_number(str) checks if a string is numeric
If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended
You can use any valid Lua code, including if statements, loops, etc.
Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)
` + processor.GetLuaFunctionsHelp()
} }
func main() { func main() {
if err := rootCmd.Execute(); err != nil { flag.Usage = func() {
mainLogger.Error("Command execution failed: %v", err) fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
os.Exit(1) fmt.Fprintf(os.Stderr, "\nOptions:\n")
} fmt.Fprintf(os.Stderr, " -mode string\n")
fmt.Fprintf(os.Stderr, " Processing mode: regex, xml, json (default \"regex\")\n")
fmt.Fprintf(os.Stderr, " -xpath string\n")
fmt.Fprintf(os.Stderr, " XPath expression (for XML mode)\n")
fmt.Fprintf(os.Stderr, " -jsonpath string\n")
fmt.Fprintf(os.Stderr, " JSONPath expression (for JSON mode)\n")
fmt.Fprintf(os.Stderr, " -verbose\n")
fmt.Fprintf(os.Stderr, " Enable verbose output\n")
fmt.Fprintf(os.Stderr, "\nExamples:\n")
fmt.Fprintf(os.Stderr, " Regex mode (default):\n")
fmt.Fprintf(os.Stderr, " %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " XML mode:\n")
fmt.Fprintf(os.Stderr, " %s -mode=xml -xpath=\"//value\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " JSON mode:\n")
fmt.Fprintf(os.Stderr, " %s -mode=json -jsonpath=\"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
fmt.Fprintf(os.Stderr, " s1, s2, etc. are used to refer to capture groups as strings.\n")
fmt.Fprintf(os.Stderr, " Helper functions: num(str) converts string to number, str(num) converts number to string\n")
fmt.Fprintf(os.Stderr, " is_number(str) checks if a string is numeric\n")
fmt.Fprintf(os.Stderr, " If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n")
fmt.Fprintf(os.Stderr, " You can use any valid Lua code, including if statements, loops, etc.\n")
fmt.Fprintf(os.Stderr, " Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
} }
func runModifier(args []string, cmd *cobra.Command) { flag.Parse()
// Get flag values from Cobra args := flag.Args()
convertFlag, _ := cmd.Flags().GetBool("conv")
parallelFlag, _ := cmd.Flags().GetInt("parallel")
filterFlag, _ := cmd.Flags().GetString("filter")
jsonFlag, _ := cmd.Flags().GetBool("json")
// Handle YAML to TOML conversion if -conv flag is set if len(args) < 3 {
if convertFlag { fmt.Fprintf(os.Stderr, "%s mode requires %d arguments minimum\n", *fileModeFlag, 3)
mainLogger.Info("YAML to TOML conversion mode enabled") flag.Usage()
conversionCount := 0 return
for _, arg := range args {
mainLogger.Debug("Converting YAML files matching pattern: %s", arg)
err := utils.ConvertYAMLToTOML(arg)
if err != nil {
mainLogger.Error("Failed to convert YAML files for pattern %s: %v", arg, err)
continue
} }
conversionCount++
} // Get the appropriate pattern and expression based on mode
if conversionCount == 0 { var pattern, luaExpr string
mainLogger.Warning("No files were converted. Please check your patterns.") var filePatterns []string
if *fileModeFlag == "regex" {
pattern = args[0]
luaExpr = args[1]
filePatterns = args[2:]
} else { } else {
mainLogger.Info("Conversion completed for %d pattern(s)", conversionCount) // For XML/JSON modes, pattern comes from flags
} luaExpr = args[0]
return filePatterns = args[1:]
} }
mainLogger.Debug("Getting database connection") // Prepare the Lua expression
db, err := utils.GetDB() originalLuaExpr := luaExpr
luaExpr = processor.BuildLuaScript(luaExpr)
if originalLuaExpr != luaExpr {
logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
}
// Expand file patterns with glob support
files, err := expandFilePatterns(filePatterns)
if err != nil { if err != nil {
mainLogger.Error("Failed to get database: %v", err) fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
return
}
mainLogger.Debug("Database connection established")
workdone, err := HandleSpecialArgs(args, db)
if err != nil {
mainLogger.Error("Failed to handle special args: %v", err)
return
}
if workdone {
mainLogger.Info("Special arguments handled, exiting.")
return return
} }
// The plan is: if len(files) == 0 {
// Load all commands fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
mainLogger.Debug("Loading commands from arguments")
mainLogger.Trace("Arguments: %v", args)
commands, err := utils.LoadCommands(args)
if err != nil || len(commands) == 0 {
mainLogger.Error("Failed to load commands: %v", err)
cmd.Usage()
return return
} }
// Collect global modifiers from special entries and filter them out
vars := map[string]interface{}{}
filtered := make([]utils.ModifyCommand, 0, len(commands))
for _, c := range commands {
if len(c.Modifiers) > 0 && c.Name == "" && c.Regex == "" && len(c.Regexes) == 0 && c.Lua == "" && len(c.Files) == 0 {
for k, v := range c.Modifiers {
vars[k] = v
}
continue
}
filtered = append(filtered, c)
}
if len(vars) > 0 {
mainLogger.Info("Loaded %d global modifiers", len(vars))
processor.SetVariables(vars)
}
commands = filtered
mainLogger.Info("Loaded %d commands", len(commands))
if filterFlag != "" { // Create the processor based on mode
mainLogger.Info("Filtering commands by name: %s", filterFlag) var proc processor.Processor
commands = utils.FilterCommands(commands, filterFlag) switch *fileModeFlag {
mainLogger.Info("Filtered %d commands", len(commands)) case "regex":
proc = &processor.RegexProcessor{}
logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
pattern, luaExpr, len(files))
// case "xml":
// proc = &processor.XMLProcessor{}
// pattern = *xpathFlag
// logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
// pattern, luaExpr, len(files))
// case "json":
// proc = &processor.JSONProcessor{}
// pattern = *jsonpathFlag
// logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
// pattern, luaExpr, len(files))
} }
// Then aggregate all the globs and deduplicate them var wg sync.WaitGroup
mainLogger.Debug("Aggregating globs and deduplicating") // Process each file
globs := utils.AggregateGlobs(commands) for _, file := range files {
mainLogger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
for _, command := range commands {
mainLogger.Trace("Command: %s", command.Name)
if len(command.Regexes) > 0 {
mainLogger.Trace("Regexes: %v", command.Regexes)
} else {
mainLogger.Trace("Regex: %s", command.Regex)
}
mainLogger.Trace("Files: %v", command.Files)
mainLogger.Trace("Lua: %s", command.Lua)
mainLogger.Trace("Reset: %t", command.Reset)
mainLogger.Trace("Isolate: %t", command.Isolate)
mainLogger.Trace("LogLevel: %s", command.LogLevel)
}
// Resolve all the files for all the globs
mainLogger.Info("Found %d unique file patterns", len(globs))
mainLogger.Debug("Expanding glob patterns to files")
files, err := utils.ExpandGLobs(globs)
if err != nil {
mainLogger.Error("Failed to expand file patterns: %v", err)
return
}
mainLogger.Info("Found %d files to process", len(files))
mainLogger.Trace("Files to process: %v", files)
// Somehow connect files to commands via globs..
// For each file check every glob of every command
// Maybe memoize this part
// That way we know what commands affect what files
mainLogger.Debug("Associating files with commands")
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
mainLogger.Error("Failed to associate files with commands: %v", err)
return
}
mainLogger.Debug("Files associated with commands")
mainLogger.Trace("File-command associations: %v", associations)
// Per-file association summary for better visibility when debugging
for file, assoc := range associations {
cmdNames := make([]string, 0, len(assoc.Commands))
for _, c := range assoc.Commands {
cmdNames = append(cmdNames, c.Name)
}
isoNames := make([]string, 0, len(assoc.IsolateCommands))
for _, c := range assoc.IsolateCommands {
isoNames = append(isoNames, c.Name)
}
mainLogger.Debug("File %q has %d regular and %d isolate commands", file, len(assoc.Commands), len(assoc.IsolateCommands))
mainLogger.Trace("\tRegular: %v", cmdNames)
mainLogger.Trace("\tIsolate: %v", isoNames)
}
mainLogger.Debug("Resetting files where necessary")
err = utils.ResetWhereNecessary(associations, db)
if err != nil {
mainLogger.Error("Failed to reset files where necessary: %v", err)
return
}
mainLogger.Debug("Files reset where necessary")
// Then for each file run all commands associated with the file
workers := make(chan struct{}, parallelFlag)
wg := sync.WaitGroup{}
mainLogger.Debug("Starting file processing with %d parallel workers", parallelFlag)
// Add performance tracking
startTime := time.Now()
// Create a map to store loggers for each command
commandLoggers := make(map[string]*logger.Logger)
for _, command := range commands {
// Create a named logger for each command
cmdName := command.Name
if cmdName == "" {
// If no name is provided, use a short version of the regex pattern
if len(command.Regex) > 20 {
cmdName = command.Regex[:17] + "..."
} else {
cmdName = command.Regex
}
}
// Parse the log level for this specific command
cmdLogLevel := logger.ParseLevel(command.LogLevel)
// Create a logger with the command name as a field
commandLoggers[command.Name] = logger.Default.WithField("command", cmdName)
commandLoggers[command.Name].SetLevel(cmdLogLevel)
mainLogger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
}
for file, association := range associations {
workers <- struct{}{}
wg.Add(1) wg.Add(1)
logger.SafeGoWithArgs(func(args ...interface{}) { go func(file string) {
defer func() { <-workers }()
defer wg.Done() defer wg.Done()
// Track per-file processing time logger.Printf("Processing file: %s", file)
fileStartTime := time.Now()
mainLogger.Debug("Reading file %q", file) modCount, matchCount, err := proc.Process(file, pattern, luaExpr)
fileData, err := os.ReadFile(file)
if err != nil { if err != nil {
mainLogger.Error("Failed to read file %q: %v", file, err) fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
atomic.AddInt64(&stats.FailedFiles, 1) stats.FailedFiles++
return } else {
logger.Printf("Successfully processed file: %s", file)
stats.ProcessedFiles++
stats.TotalMatches += matchCount
stats.TotalModifications += modCount
} }
fileDataStr := string(fileData) }(file)
mainLogger.Trace("File %q content: %s", file, utils.LimitString(fileDataStr, 500))
isChanged := false
mainLogger.Debug("Running isolate commands for file %q", file)
fileDataStr, err = RunIsolateCommands(association, file, fileDataStr, jsonFlag)
if err != nil && err != NothingToDo {
mainLogger.Error("Failed to run isolate commands for file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
if err != NothingToDo {
isChanged = true
}
mainLogger.Debug("Running other commands for file %q", file)
fileDataStr, err = RunOtherCommands(file, fileDataStr, association, commandLoggers, jsonFlag)
if err != nil && err != NothingToDo {
mainLogger.Error("Failed to run other commands for file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
if err != NothingToDo {
isChanged = true
}
if isChanged {
mainLogger.Debug("Saving file %q to database", file)
err = db.SaveFile(file, fileData)
if err != nil {
mainLogger.Error("Failed to save file %q to database: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
mainLogger.Debug("File %q saved to database", file)
}
mainLogger.Debug("Writing file %q", file)
err = os.WriteFile(file, []byte(fileDataStr), 0644)
if err != nil {
mainLogger.Error("Failed to write file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
mainLogger.Debug("File %q written", file)
// Only increment ProcessedFiles once per file, after all processing is complete
atomic.AddInt64(&stats.ProcessedFiles, 1)
mainLogger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
}, file, commands)
} }
wg.Wait() wg.Wait()
processingTime := time.Since(startTime)
mainLogger.Info("Processing completed in %v", processingTime)
processedFiles := atomic.LoadInt64(&stats.ProcessedFiles)
if processedFiles > 0 {
mainLogger.Info("Average time per file: %v", processingTime/time.Duration(processedFiles))
}
// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
// Do that with logger.WithField("loglevel", level.String())
// Since each command also has its own log level
// TODO: Maybe even figure out how to run individual commands...?
// Print summary // Print summary
totalModifications := atomic.LoadInt64(&stats.TotalModifications) if stats.TotalModifications == 0 {
if totalModifications == 0 { fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
mainLogger.Warning("No modifications were made in any files")
} else { } else {
failedFiles := atomic.LoadInt64(&stats.FailedFiles) fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
mainLogger.Info("Operation complete! Modified %d values in %d/%d files", stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
totalModifications, processedFiles, processedFiles+failedFiles)
sortedCommands := []string{}
stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
sortedCommands = append(sortedCommands, key.(string))
return true
})
sort.Strings(sortedCommands)
for _, command := range sortedCommands {
count, _ := stats.ModificationsPerCommand.Load(command)
if count.(int) > 0 {
mainLogger.Info("\tCommand %q made %d modifications", command, count)
} else {
mainLogger.Warning("\tCommand %q made no modifications", command)
} }
} }
func expandFilePatterns(patterns []string) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
for _, pattern := range patterns {
matches, _ := doublestar.Glob(os.DirFS("."), pattern)
for _, m := range matches {
if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
filesMap[m], files = true, append(files, m)
}
} }
} }
func HandleSpecialArgs(args []string, db utils.DB) (bool, error) { if len(files) > 0 {
handleSpecialArgsLogger := logger.Default.WithPrefix("HandleSpecialArgs") logger.Printf("Found %d files to process", len(files))
handleSpecialArgsLogger.Debug("Handling special arguments: %v", args)
if len(args) == 0 {
handleSpecialArgsLogger.Warning("No arguments provided to HandleSpecialArgs")
return false, nil
} }
switch args[0] { return files, nil
case "reset":
handleSpecialArgsLogger.Info("Resetting all files to their original state from database")
err := utils.ResetAllFiles(db)
if err != nil {
handleSpecialArgsLogger.Error("Failed to reset all files: %v", err)
return true, err
}
handleSpecialArgsLogger.Info("Successfully reset all files to original state")
return true, nil
case "dump":
handleSpecialArgsLogger.Info("Dumping all files from database (clearing snapshots)")
err := db.RemoveAllFiles()
if err != nil {
handleSpecialArgsLogger.Error("Failed to remove all files from database: %v", err)
return true, err
}
handleSpecialArgsLogger.Info("Successfully cleared all file snapshots from database")
return true, nil
default:
handleSpecialArgsLogger.Debug("Unknown special argument: %q", args[0])
}
handleSpecialArgsLogger.Debug("No special arguments handled, returning false")
return false, nil
}
func CreateExampleConfig() {
createExampleConfigLogger := logger.Default.WithPrefix("CreateExampleConfig")
createExampleConfigLogger.Debug("Creating example configuration file")
// Save the embedded TOML content to disk
createExampleConfigLogger.Debug("Writing example_cook.toml")
err := os.WriteFile("example_cook.toml", []byte(exampleTOMLContent), 0644)
if err != nil {
createExampleConfigLogger.Error("Failed to write example_cook.toml: %v", err)
return
}
createExampleConfigLogger.Info("Wrote example_cook.toml")
}
var NothingToDo = errors.New("nothing to do")
func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, commandLoggers map[string]*logger.Logger, jsonFlag bool) (string, error) {
runOtherCommandsLogger := mainLogger.WithPrefix("RunOtherCommands").WithField("file", file)
runOtherCommandsLogger.Debug("Running other commands for file")
runOtherCommandsLogger.Trace("File data before modifications: %s", utils.LimitString(fileDataStr, 200))
// Separate JSON and regex commands for different processing approaches
jsonCommands := []utils.ModifyCommand{}
regexCommands := []utils.ModifyCommand{}
for _, command := range association.Commands {
if command.JSON || jsonFlag {
jsonCommands = append(jsonCommands, command)
} else {
regexCommands = append(regexCommands, command)
}
}
// Process JSON commands sequentially (each operates on the entire file)
for _, command := range jsonCommands {
cmdLogger := logger.Default
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
}
cmdLogger.Debug("Processing file with JSON mode for command %q", command.Name)
newModifications, err := processor.ProcessJSON(fileDataStr, command, file)
if err != nil {
runOtherCommandsLogger.Error("Failed to process file with JSON command %q: %v", command.Name, err)
continue
}
// Apply JSON modifications immediately
if len(newModifications) > 0 {
var count int
fileDataStr, count = utils.ExecuteModifications(newModifications, fileDataStr)
atomic.AddInt64(&stats.TotalModifications, int64(count))
cmdLogger.Debug("Applied %d JSON modifications for command %q", count, command.Name)
}
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
}
// Aggregate regex modifications and execute them
modifications := []utils.ReplaceCommand{}
numCommandsConsidered := 0
for _, command := range regexCommands {
cmdLogger := logger.Default
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
}
patterns := command.Regexes
if len(patterns) == 0 {
patterns = []string{command.Regex}
}
for idx, pattern := range patterns {
tmpCmd := command
tmpCmd.Regex = pattern
cmdLogger.Debug("Begin processing file with command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
numCommandsConsidered++
newModifications, err := processor.ProcessRegex(fileDataStr, tmpCmd, file)
if err != nil {
runOtherCommandsLogger.Error("Failed to process file with command %q: %v", command.Name, err)
continue
}
modifications = append(modifications, newModifications...)
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
cmdLogger.Debug("Command %q generated %d modifications (pattern %d/%d)", command.Name, len(newModifications), idx+1, len(patterns))
cmdLogger.Trace("Modifications generated by command %q: %v", command.Name, newModifications)
if len(newModifications) == 0 {
cmdLogger.Debug("No modifications yielded by command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
}
}
}
runOtherCommandsLogger.Debug("Aggregated %d modifications from %d command-pattern runs", len(modifications), numCommandsConsidered)
runOtherCommandsLogger.Trace("All aggregated modifications: %v", modifications)
if len(modifications) == 0 {
runOtherCommandsLogger.Warning("No modifications found for file")
return fileDataStr, NothingToDo
}
runOtherCommandsLogger.Debug("Executing %d modifications for file", len(modifications))
// Sort commands in reverse order for safe replacements
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
runOtherCommandsLogger.Trace("File data after modifications: %s", utils.LimitString(fileDataStr, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
runOtherCommandsLogger.Info("Executed %d modifications for file", count)
return fileDataStr, nil
}
func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string, jsonFlag bool) (string, error) {
runIsolateCommandsLogger := mainLogger.WithPrefix("RunIsolateCommands").WithField("file", file)
runIsolateCommandsLogger.Debug("Running isolate commands for file")
runIsolateCommandsLogger.Trace("File data before isolate modifications: %s", utils.LimitString(fileDataStr, 200))
anythingDone := false
currentFileData := fileDataStr
for _, isolateCommand := range association.IsolateCommands {
// Check if this isolate command should use JSON mode
if isolateCommand.JSON || jsonFlag {
runIsolateCommandsLogger.Debug("Begin processing file with JSON isolate command %q", isolateCommand.Name)
modifications, err := processor.ProcessJSON(currentFileData, isolateCommand, file)
if err != nil {
runIsolateCommandsLogger.Error("Failed to process file with JSON isolate command %q: %v", isolateCommand.Name, err)
continue
}
if len(modifications) == 0 {
runIsolateCommandsLogger.Debug("JSON isolate command %q produced no modifications", isolateCommand.Name)
continue
}
anythingDone = true
runIsolateCommandsLogger.Debug("Executing %d JSON isolate modifications for file", len(modifications))
runIsolateCommandsLogger.Trace("JSON isolate modifications: %v", modifications)
var count int
currentFileData, count = utils.ExecuteModifications(modifications, currentFileData)
runIsolateCommandsLogger.Trace("File data after JSON isolate modifications: %s", utils.LimitString(currentFileData, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
cmdCount, ok := stats.ModificationsPerCommand.Load(isolateCommand.Name)
if !ok {
stats.ModificationsPerCommand.Store(isolateCommand.Name, 0)
cmdCount = 0
}
stats.ModificationsPerCommand.Store(isolateCommand.Name, cmdCount.(int)+len(modifications))
runIsolateCommandsLogger.Info("Executed %d JSON isolate modifications for file", count)
} else {
// Regular regex processing for isolate commands
patterns := isolateCommand.Regexes
if len(patterns) == 0 {
patterns = []string{isolateCommand.Regex}
}
for idx, pattern := range patterns {
tmpCmd := isolateCommand
tmpCmd.Regex = pattern
runIsolateCommandsLogger.Debug("Begin processing file with isolate command %q (pattern %d/%d)", isolateCommand.Name, idx+1, len(patterns))
modifications, err := processor.ProcessRegex(currentFileData, tmpCmd, file)
if err != nil {
runIsolateCommandsLogger.Error("Failed to process file with isolate command %q (pattern %d/%d): %v", isolateCommand.Name, idx+1, len(patterns), err)
continue
}
if len(modifications) == 0 {
runIsolateCommandsLogger.Debug("Isolate command %q produced no modifications (pattern %d/%d)", isolateCommand.Name, idx+1, len(patterns))
continue
}
anythingDone = true
runIsolateCommandsLogger.Debug("Executing %d isolate modifications for file", len(modifications))
runIsolateCommandsLogger.Trace("Isolate modifications: %v", modifications)
var count int
currentFileData, count = utils.ExecuteModifications(modifications, currentFileData)
runIsolateCommandsLogger.Trace("File data after isolate modifications: %s", utils.LimitString(currentFileData, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
cmdCount, ok := stats.ModificationsPerCommand.Load(isolateCommand.Name)
if !ok {
stats.ModificationsPerCommand.Store(isolateCommand.Name, 0)
cmdCount = 0
}
stats.ModificationsPerCommand.Store(isolateCommand.Name, cmdCount.(int)+len(modifications))
runIsolateCommandsLogger.Info("Executed %d isolate modifications for file", count)
}
}
}
if !anythingDone {
runIsolateCommandsLogger.Debug("No isolate modifications were made for file")
return fileDataStr, NothingToDo
}
return currentFileData, nil
} }

View File

@@ -1,656 +1,174 @@
package processor package processor
import ( import (
"cook/utils"
"encoding/json" "encoding/json"
"fmt" "fmt"
"sort" "modify/processor/jsonpath"
"strconv" "os"
"path/filepath"
"strings" "strings"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/tidwall/gjson"
lua "github.com/yuin/gopher-lua" lua "github.com/yuin/gopher-lua"
) )
// jsonLogger is a scoped logger for the processor/json package. // JSONProcessor implements the Processor interface for JSON documents
var jsonLogger = logger.Default.WithPrefix("processor/json") type JSONProcessor struct{}
// ProcessJSON applies Lua processing to JSON content // Process implements the Processor interface for JSONProcessor
func ProcessJSON(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) { func (p *JSONProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
processJsonLogger := jsonLogger.WithPrefix("ProcessJSON").WithField("commandName", command.Name).WithField("file", filename) // Read file content
processJsonLogger.Debug("Starting JSON processing for file") cwd, err := os.Getwd()
processJsonLogger.Trace("Initial file content length: %d", len(content)) if err != nil {
return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
}
var commands []utils.ReplaceCommand fullPath := filepath.Join(cwd, filename)
startTime := time.Now() content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
// Parse JSON content fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ProcessContent implements the Processor interface for JSONProcessor
func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse JSON document
var jsonData interface{} var jsonData interface{}
err := json.Unmarshal([]byte(content), &jsonData) err := json.Unmarshal([]byte(content), &jsonData)
if err != nil { if err != nil {
processJsonLogger.Error("Failed to parse JSON content: %v", err) return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
return commands, fmt.Errorf("failed to parse JSON: %v", err)
} }
processJsonLogger.Debug("Successfully parsed JSON content")
// Create Lua state // Find nodes matching the JSONPath pattern
nodes, err := jsonpath.Get(jsonData, pattern)
if err != nil {
return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
// Initialize Lua
L, err := NewLuaState() L, err := NewLuaState()
if err != nil { if err != nil {
processJsonLogger.Error("Error creating Lua state: %v", err) return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
} }
defer L.Close() defer L.Close()
// Set filename global err = p.ToLua(L, nodes)
L.SetGlobal("file", lua.LString(filename))
// Convert JSON data to Lua table
luaTable, err := ToLuaTable(L, jsonData)
if err != nil { if err != nil {
processJsonLogger.Error("Failed to convert JSON to Lua table: %v", err) return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
return commands, fmt.Errorf("failed to convert JSON to Lua table: %v", err)
} }
// Set the JSON data as a global variable // Execute Lua script
L.SetGlobal("data", luaTable)
processJsonLogger.Debug("Set JSON data as Lua global 'data'")
// Build and execute Lua script for JSON mode
luaExpr := BuildJSONLuaScript(command.Lua)
processJsonLogger.Debug("Built Lua script from expression: %q", command.Lua)
processJsonLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
if err := L.DoString(luaExpr); err != nil { if err := L.DoString(luaExpr); err != nil {
processJsonLogger.Error("Lua script execution failed: %v\nScript: %s", err, utils.LimitString(luaExpr, 200)) return content, len(nodes), 0, fmt.Errorf("error executing Lua %s: %v", luaExpr, err)
return commands, fmt.Errorf("lua script execution failed: %v", err)
}
processJsonLogger.Debug("Lua script executed successfully")
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
processJsonLogger.Debug("Skipping - no modifications indicated by Lua script")
return commands, nil
} }
// Get the modified data from Lua // Get modified value
modifiedData := L.GetGlobal("data") result, err := p.FromLua(L)
if modifiedData.Type() != lua.LTTable {
processJsonLogger.Error("Expected 'data' to be a table after Lua processing, got %s", modifiedData.Type().String())
return commands, fmt.Errorf("expected 'data' to be a table after Lua processing")
}
// Convert back to Go interface
goData, err := FromLua(L, modifiedData)
if err != nil { if err != nil {
processJsonLogger.Error("Failed to convert Lua table back to Go: %v", err) return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
return commands, fmt.Errorf("failed to convert Lua table back to Go: %v", err)
} }
processJsonLogger.Debug("About to call applyChanges with original data and modified data") // Apply the modification to the JSON data
commands, err = applyChanges(content, jsonData, goData) err = p.updateJSONValue(jsonData, pattern, result)
if err != nil { if err != nil {
processJsonLogger.Error("Failed to apply surgical JSON changes: %v", err) return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
return commands, fmt.Errorf("failed to apply surgical JSON changes: %v", err)
} }
processJsonLogger.Debug("Total JSON processing time: %v", time.Since(startTime)) // Convert the modified JSON back to a string with same formatting
processJsonLogger.Debug("Generated %d total modifications", len(commands)) var jsonBytes []byte
return commands, nil if indent, err := detectJsonIndentation(content); err == nil && indent != "" {
} // Use detected indentation for output formatting
jsonBytes, err = json.MarshalIndent(jsonData, "", indent)
// applyJSONChanges compares original and modified data and applies changes surgically
func applyJSONChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
var commands []utils.ReplaceCommand
appliedCommands, err := applyChanges(content, originalData, modifiedData)
if err == nil && len(appliedCommands) > 0 {
return appliedCommands, nil
}
return commands, fmt.Errorf("failed to make any changes to the json")
}
// applyChanges attempts to make surgical changes while preserving exact formatting
func applyChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
var commands []utils.ReplaceCommand
// Find all changes between original and modified data
changes := findDeepChanges("", originalData, modifiedData)
jsonLogger.Debug("applyChanges: Found %d changes: %v", len(changes), changes)
if len(changes) == 0 {
return commands, nil
}
// Sort removal operations by index in descending order to avoid index shifting
var removals []string
var additions []string
var valueChanges []string
for path := range changes {
if strings.HasSuffix(path, "@remove") {
removals = append(removals, path)
} else if strings.HasSuffix(path, "@add") {
additions = append(additions, path)
} else { } else {
valueChanges = append(valueChanges, path) // Fall back to standard 2-space indent
} jsonBytes, err = json.MarshalIndent(jsonData, "", " ")
} }
jsonLogger.Debug("applyChanges: %d removals, %d additions, %d value changes", len(removals), len(additions), len(valueChanges)) // We changed all the nodes trust me bro
return string(jsonBytes), len(nodes), len(nodes), nil
// Apply removals first (from end to beginning to avoid index shifting)
for _, removalPath := range removals {
actualPath := strings.TrimSuffix(removalPath, "@remove")
elementIndex := extractIndexFromRemovalPath(actualPath)
arrayPath := getArrayPathFromElementPath(actualPath)
jsonLogger.Debug("Processing removal: path=%s, index=%d, arrayPath=%s", actualPath, elementIndex, arrayPath)
// Find the exact byte range to remove
from, to := findArrayElementRemovalRange(content, arrayPath, elementIndex)
jsonLogger.Debug("Removing bytes %d-%d", from, to)
commands = append(commands, utils.ReplaceCommand{
From: from,
To: to,
With: "",
})
jsonLogger.Debug("Added removal command: From=%d, To=%d, With=\"\"", from, to)
} }
// Apply additions (new fields) // detectJsonIndentation tries to determine the indentation used in the original JSON
for _, additionPath := range additions { func detectJsonIndentation(content string) (string, error) {
actualPath := strings.TrimSuffix(additionPath, "@add") lines := strings.Split(content, "\n")
newValue := changes[additionPath] if len(lines) < 2 {
return "", fmt.Errorf("not enough lines to detect indentation")
jsonLogger.Debug("Processing addition: path=%s, value=%v", actualPath, newValue)
// Find the parent object to add the field to
parentPath := getParentPath(actualPath)
fieldName := getFieldName(actualPath)
jsonLogger.Debug("Parent path: %s, field name: %s", parentPath, fieldName)
// Get the parent object
var parentResult gjson.Result
if parentPath == "" {
// Adding to root object - get the entire JSON
parentResult = gjson.Parse(content)
} else {
parentResult = gjson.Get(content, parentPath)
} }
if !parentResult.Exists() { // Look for the first indented line
jsonLogger.Debug("Parent path %s does not exist, skipping", parentPath) for i := 1; i < len(lines); i++ {
line := lines[i]
trimmed := strings.TrimSpace(line)
if trimmed == "" {
continue continue
} }
// Find where to insert the new field (at the end of the object) // Calculate leading whitespace
startPos := int(parentResult.Index + len(parentResult.Raw) - 1) // Before closing brace indent := line[:len(line)-len(trimmed)]
if len(indent) > 0 {
jsonLogger.Debug("Inserting at pos %d", startPos) return indent, nil
// Convert the new value to JSON string
newValueStr := convertValueToJSONString(newValue)
// Insert the new field with pretty-printed formatting
// Format: ,"fieldName": { ... }
insertText := fmt.Sprintf(`,"%s": %s`, fieldName, newValueStr)
commands = append(commands, utils.ReplaceCommand{
From: startPos,
To: startPos,
With: insertText,
})
jsonLogger.Debug("Added addition command: From=%d, To=%d, With=%q", startPos, startPos, insertText)
}
// Apply value changes (in reverse order to avoid position shifting)
sort.Slice(valueChanges, func(i, j int) bool {
// Get positions for comparison
resultI := gjson.Get(content, valueChanges[i])
resultJ := gjson.Get(content, valueChanges[j])
return resultI.Index > resultJ.Index // Descending order
})
for _, path := range valueChanges {
newValue := changes[path]
jsonLogger.Debug("Processing value change: path=%s, value=%v", path, newValue)
// Get the current value and its position in the original JSON
result := gjson.Get(content, path)
if !result.Exists() {
jsonLogger.Debug("Path %s does not exist, skipping", path)
continue // Skip if path doesn't exist
}
// Get the exact byte positions of this value
startPos := result.Index
endPos := startPos + len(result.Raw)
jsonLogger.Debug("Found value at pos %d-%d: %q", startPos, endPos, result.Raw)
// Convert the new value to JSON string
newValueStr := convertValueToJSONString(newValue)
jsonLogger.Debug("Converting to: %q", newValueStr)
// Create a replacement command for this specific value
commands = append(commands, utils.ReplaceCommand{
From: int(startPos),
To: int(endPos),
With: newValueStr,
})
jsonLogger.Debug("Added command: From=%d, To=%d, With=%q", int(startPos), int(endPos), newValueStr)
}
return commands, nil
}
// extractIndexFromRemovalPath extracts the array index from a removal path like "Rows.0.Inputs.1@remove"
func extractIndexFromRemovalPath(path string) int {
parts := strings.Split(strings.TrimSuffix(path, "@remove"), ".")
if len(parts) > 0 {
lastPart := parts[len(parts)-1]
if index, err := strconv.Atoi(lastPart); err == nil {
return index
} }
} }
return -1
return "", fmt.Errorf("no indentation detected")
} }
// getArrayPathFromElementPath converts "Rows.0.Inputs.1" to "Rows.0.Inputs" // / Selects from the root node
func getArrayPathFromElementPath(elementPath string) string { // // Selects nodes in the document from the current node that match the selection no matter where they are
parts := strings.Split(elementPath, ".") // . Selects the current node
if len(parts) > 0 { // @ Selects attributes
return strings.Join(parts[:len(parts)-1], ".")
} // /bookstore/* Selects all the child element nodes of the bookstore element
return "" // //* Selects all elements in the document
// /bookstore/book[1] Selects the first book element that is the child of the bookstore element.
// /bookstore/book[last()] Selects the last book element that is the child of the bookstore element
// /bookstore/book[last()-1] Selects the last but one book element that is the child of the bookstore element
// /bookstore/book[position()<3] Selects the first two book elements that are children of the bookstore element
// //title[@lang] Selects all the title elements that have an attribute named lang
// //title[@lang='en'] Selects all the title elements that have a "lang" attribute with a value of "en"
// /bookstore/book[price>35.00] Selects all the book elements of the bookstore element that have a price element with a value greater than 35.00
// /bookstore/book[price>35.00]/title Selects all the title elements of the book elements of the bookstore element that have a price element with a value greater than 35.00
// updateJSONValue updates a value in the JSON structure based on its JSONPath
func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
return nil
} }
// getParentPath extracts the parent path from a full path like "Rows.0.Inputs.1" // ToLua converts JSON values to Lua variables
func getParentPath(fullPath string) string { func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
parts := strings.Split(fullPath, ".") table, err := ToLuaTable(L, data)
if len(parts) > 0 {
return strings.Join(parts[:len(parts)-1], ".")
}
return ""
}
// getFieldName extracts the field name from a full path like "Rows.0.Inputs.1"
func getFieldName(fullPath string) string {
parts := strings.Split(fullPath, ".")
if len(parts) > 0 {
return parts[len(parts)-1]
}
return ""
}
// convertValueToJSONString converts a Go interface{} to a JSON string representation
func convertValueToJSONString(value interface{}) string {
switch v := value.(type) {
case string:
return `"` + strings.ReplaceAll(v, `"`, `\"`) + `"`
case float64:
if v == float64(int64(v)) {
return strconv.FormatInt(int64(v), 10)
}
return strconv.FormatFloat(v, 'f', -1, 64)
case bool:
return strconv.FormatBool(v)
case nil:
return "null"
case map[string]interface{}:
// Handle maps specially to avoid double-escaping of keys
var pairs []string
for key, val := range v {
// The key might already have escaped quotes from Lua, so we need to be careful
// If the key already contains escaped quotes, we need to unescape them first
keyStr := key
if strings.Contains(key, `\"`) {
// Key already has escaped quotes, use it as-is
keyStr = `"` + key + `"`
} else {
// Normal key, escape quotes
keyStr = `"` + strings.ReplaceAll(key, `"`, `\"`) + `"`
}
valStr := convertValueToJSONString(val)
pairs = append(pairs, keyStr+":"+valStr)
}
return "{" + strings.Join(pairs, ",") + "}"
default:
// For other complex types (arrays), we need to use json.Marshal
jsonBytes, err := json.Marshal(v)
if err != nil { if err != nil {
return "null" // Fallback to null if marshaling fails return err
}
return string(jsonBytes)
} }
L.SetGlobal("v", table)
return nil
} }
// findArrayElementRemovalRange finds the exact byte range to remove for an array element // FromLua retrieves values from Lua
func findArrayElementRemovalRange(content, arrayPath string, elementIndex int) (int, int) { func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Get the array using gjson luaValue := L.GetGlobal("v")
arrayResult := gjson.Get(content, arrayPath) return FromLuaTable(L, luaValue.(*lua.LTable))
if !arrayResult.Exists() || !arrayResult.IsArray() {
return -1, -1
}
// Get all array elements
elements := arrayResult.Array()
if elementIndex >= len(elements) {
return -1, -1
}
// Get the target element
elementResult := elements[elementIndex]
startPos := int(elementResult.Index)
endPos := int(elementResult.Index + len(elementResult.Raw))
// Handle comma removal properly
if elementIndex == 0 && len(elements) > 1 {
// First element but not the only one - remove comma after
for i := endPos; i < len(content) && i < endPos+50; i++ {
if content[i] == ',' {
endPos = i + 1
break
}
}
} else if elementIndex == len(elements)-1 && len(elements) > 1 {
// Last element and not the only one - remove comma before
prevElementEnd := int(elements[elementIndex-1].Index + len(elements[elementIndex-1].Raw))
for i := prevElementEnd; i < startPos && i < len(content); i++ {
if content[i] == ',' {
startPos = i
break
}
}
}
// If it's the only element, don't remove any commas
return startPos, endPos
}
// findDeepChanges recursively finds all paths that need to be changed
func findDeepChanges(basePath string, original, modified interface{}) map[string]interface{} {
changes := make(map[string]interface{})
switch orig := original.(type) {
case map[string]interface{}:
if mod, ok := modified.(map[string]interface{}); ok {
// Check for new keys added in modified data
for key, modValue := range mod {
var currentPath string
if basePath == "" {
currentPath = key
} else {
currentPath = basePath + "." + key
}
if origValue, exists := orig[key]; exists {
// Key exists in both, check if value changed
switch modValue.(type) {
case map[string]interface{}, []interface{}:
// Recursively check nested structures
nestedChanges := findDeepChanges(currentPath, origValue, modValue)
for nestedPath, nestedValue := range nestedChanges {
changes[nestedPath] = nestedValue
}
default:
// Primitive value - check if changed
if !deepEqual(origValue, modValue) {
changes[currentPath] = modValue
}
}
} else {
// New key added - mark for addition
changes[currentPath+"@add"] = modValue
}
}
}
case []interface{}:
if mod, ok := modified.([]interface{}); ok {
// Handle array changes by detecting specific element operations
if len(orig) != len(mod) {
// Array length changed - detect if it's element removal
if len(orig) > len(mod) {
// Element(s) removed - find which ones by comparing content
removedIndices := findRemovedArrayElements(orig, mod)
for _, removedIndex := range removedIndices {
var currentPath string
if basePath == "" {
currentPath = fmt.Sprintf("%d@remove", removedIndex)
} else {
currentPath = fmt.Sprintf("%s.%d@remove", basePath, removedIndex)
}
changes[currentPath] = nil // Mark for removal
}
} else {
// Elements added - more complex, skip for now
}
} else {
// Same length - check individual elements for value changes
for i, modValue := range mod {
var currentPath string
if basePath == "" {
currentPath = strconv.Itoa(i)
} else {
currentPath = basePath + "." + strconv.Itoa(i)
}
if i < len(orig) {
// Index exists in both, check if value changed
switch modValue.(type) {
case map[string]interface{}, []interface{}:
// Recursively check nested structures
nestedChanges := findDeepChanges(currentPath, orig[i], modValue)
for nestedPath, nestedValue := range nestedChanges {
changes[nestedPath] = nestedValue
}
default:
// Primitive value - check if changed
if !deepEqual(orig[i], modValue) {
changes[currentPath] = modValue
}
}
}
}
}
}
default:
// For primitive types, compare directly
if !deepEqual(original, modified) {
if basePath == "" {
changes[""] = modified
} else {
changes[basePath] = modified
}
}
}
return changes
}
// findRemovedArrayElements compares two arrays and returns indices of removed elements
func findRemovedArrayElements(original, modified []interface{}) []int {
var removedIndices []int
// Simple approach: find elements in original that don't exist in modified
for i, origElement := range original {
found := false
for _, modElement := range modified {
if deepEqual(origElement, modElement) {
found = true
break
}
}
if !found {
removedIndices = append(removedIndices, i)
}
}
return removedIndices
}
// deepEqual performs deep comparison of two values
func deepEqual(a, b interface{}) bool {
if a == nil && b == nil {
return true
}
if a == nil || b == nil {
return false
}
switch av := a.(type) {
case map[string]interface{}:
if bv, ok := b.(map[string]interface{}); ok {
if len(av) != len(bv) {
return false
}
for k, v := range av {
if !deepEqual(v, bv[k]) {
return false
}
}
return true
}
return false
case []interface{}:
if bv, ok := b.([]interface{}); ok {
if len(av) != len(bv) {
return false
}
for i, v := range av {
if !deepEqual(v, bv[i]) {
return false
}
}
return true
}
return false
default:
return a == b
}
}
// ToLuaTable converts a Go interface{} to a Lua table recursively
func ToLuaTable(L *lua.LState, data interface{}) (*lua.LTable, error) {
toLuaTableLogger := jsonLogger.WithPrefix("ToLuaTable")
toLuaTableLogger.Debug("Converting Go interface to Lua table")
toLuaTableLogger.Trace("Input data type: %T", data)
switch v := data.(type) {
case map[string]interface{}:
toLuaTableLogger.Debug("Converting map to Lua table")
table := L.CreateTable(0, len(v))
for key, value := range v {
luaValue, err := ToLuaValue(L, value)
if err != nil {
toLuaTableLogger.Error("Failed to convert map value for key %q: %v", key, err)
return nil, err
}
table.RawSetString(key, luaValue)
}
return table, nil
case []interface{}:
toLuaTableLogger.Debug("Converting slice to Lua table")
table := L.CreateTable(len(v), 0)
for i, value := range v {
luaValue, err := ToLuaValue(L, value)
if err != nil {
toLuaTableLogger.Error("Failed to convert slice value at index %d: %v", i, err)
return nil, err
}
table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
}
return table, nil
case string:
toLuaTableLogger.Debug("Converting string to Lua string")
return nil, fmt.Errorf("expected table or array, got string")
case float64:
toLuaTableLogger.Debug("Converting float64 to Lua number")
return nil, fmt.Errorf("expected table or array, got number")
case bool:
toLuaTableLogger.Debug("Converting bool to Lua boolean")
return nil, fmt.Errorf("expected table or array, got boolean")
case nil:
toLuaTableLogger.Debug("Converting nil to Lua nil")
return nil, fmt.Errorf("expected table or array, got nil")
default:
toLuaTableLogger.Error("Unsupported type for Lua table conversion: %T", v)
return nil, fmt.Errorf("unsupported type for Lua table conversion: %T", v)
}
}
// ToLuaValue converts a Go interface{} to a Lua value
func ToLuaValue(L *lua.LState, data interface{}) (lua.LValue, error) {
toLuaValueLogger := jsonLogger.WithPrefix("ToLuaValue")
toLuaValueLogger.Debug("Converting Go interface to Lua value")
toLuaValueLogger.Trace("Input data type: %T", data)
switch v := data.(type) {
case map[string]interface{}:
toLuaValueLogger.Debug("Converting map to Lua table")
table := L.CreateTable(0, len(v))
for key, value := range v {
luaValue, err := ToLuaValue(L, value)
if err != nil {
toLuaValueLogger.Error("Failed to convert map value for key %q: %v", key, err)
return lua.LNil, err
}
table.RawSetString(key, luaValue)
}
return table, nil
case []interface{}:
toLuaValueLogger.Debug("Converting slice to Lua table")
table := L.CreateTable(len(v), 0)
for i, value := range v {
luaValue, err := ToLuaValue(L, value)
if err != nil {
toLuaValueLogger.Error("Failed to convert slice value at index %d: %v", i, err)
return lua.LNil, err
}
table.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
}
return table, nil
case string:
toLuaValueLogger.Debug("Converting string to Lua string")
return lua.LString(v), nil
case float64:
toLuaValueLogger.Debug("Converting float64 to Lua number")
return lua.LNumber(v), nil
case bool:
toLuaValueLogger.Debug("Converting bool to Lua boolean")
return lua.LBool(v), nil
case nil:
toLuaValueLogger.Debug("Converting nil to Lua nil")
return lua.LNil, nil
default:
toLuaValueLogger.Error("Unsupported type for Lua value conversion: %T", v)
return lua.LNil, fmt.Errorf("unsupported type for Lua value conversion: %T", v)
}
} }

File diff suppressed because it is too large Load Diff

View File

@@ -0,0 +1,495 @@
package jsonpath
import (
"fmt"
"strconv"
)
// JSONStep represents a single step in a JSONPath query
type JSONStep struct {
Type StepType
Key string // For Child/RecursiveDescent
Index int // For Index (use -1 for wildcard "*")
}
// JSONNode represents a value in the JSON data with its path
type JSONNode struct {
Value interface{} // The value found at the path
Path string // The exact JSONPath where the value was found
}
// StepType defines the types of steps in a JSONPath
type StepType int
const (
RootStep StepType = iota // $ - The root element
ChildStep // .key - Direct child access
RecursiveDescentStep // ..key - Recursive search for key
WildcardStep // .* - All children of an object
IndexStep // [n] - Array index access (or [*] for all elements)
)
// TraversalMode determines how the traversal behaves
type TraversalMode int
const (
CollectMode TraversalMode = iota // Just collect matched nodes
ModifyFirstMode // Modify first matching node
ModifyAllMode // Modify all matching nodes
)
// ParseJSONPath parses a JSONPath string into a sequence of steps
func ParseJSONPath(path string) ([]JSONStep, error) {
if len(path) == 0 || path[0] != '$' {
return nil, fmt.Errorf("path must start with $; received: %q", path)
}
steps := []JSONStep{}
i := 0
for i < len(path) {
switch path[i] {
case '$':
steps = append(steps, JSONStep{Type: RootStep})
i++
case '.':
i++
if i < len(path) && path[i] == '.' {
// Recursive descent
i++
key, nextPos := readKey(path, i)
steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
i = nextPos
} else {
// Child step or wildcard
key, nextPos := readKey(path, i)
if key == "*" {
steps = append(steps, JSONStep{Type: WildcardStep})
} else {
steps = append(steps, JSONStep{Type: ChildStep, Key: key})
}
i = nextPos
}
case '[':
// Index step
i++
indexStr, nextPos := readIndex(path, i)
if indexStr == "*" {
steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
} else {
index, err := strconv.Atoi(indexStr)
if err != nil {
return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
}
steps = append(steps, JSONStep{Type: IndexStep, Index: index})
}
i = nextPos + 1 // Skip closing ]
default:
return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
}
}
return steps, nil
}
// readKey extracts a key name from the path
func readKey(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == '.' || path[i] == '[' {
break
}
}
return path[start:i], i
}
// readIndex extracts an array index or wildcard from the path
func readIndex(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == ']' {
break
}
}
return path[start:i], i
}
// Get retrieves values with their paths from data at the specified JSONPath
// Each returned JSONNode contains both the value and its exact path in the data structure
func Get(data interface{}, path string) ([]JSONNode, error) {
steps, err := ParseJSONPath(path)
if err != nil {
return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
results := []JSONNode{}
err = traverseWithPaths(data, steps, &results, "$")
if err != nil {
return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
}
return results, nil
}
// Set updates the value at the specified JSONPath in the original data structure.
// It only modifies the first matching node.
func Set(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
if len(steps) <= 1 {
return fmt.Errorf("cannot set root node; the provided path %q is invalid", path)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// SetAll updates all matching values at the specified JSONPath.
func SetAll(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
if len(steps) <= 1 {
return fmt.Errorf("cannot set root node; the provided path %q is invalid", path)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// setWithPath modifies values while tracking paths
func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
if node == nil || *success && mode == ModifyFirstMode {
return nil
}
// Skip root step
actualSteps := steps
if len(steps) > 0 && steps[0].Type == RootStep {
if len(steps) == 1 {
return fmt.Errorf("cannot set root node; the provided path %q is invalid", currentPath)
}
actualSteps = steps[1:]
}
// Process the first step
if len(actualSteps) == 0 {
return fmt.Errorf("cannot set root node; no steps provided for path %q", currentPath)
}
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
childPath := currentPath + "." + step.Key
if isLastStep {
// We've reached the target, set the value
m[step.Key] = value
*success = true
return nil
}
// Create intermediate nodes if necessary
child, exists := m[step.Key]
if !exists {
// Create missing intermediate node
if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
child = []interface{}{}
} else {
child = map[string]interface{}{}
}
m[step.Key] = child
}
err := setWithPath(child, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
arr[i] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
arr[step.Index] = value
*success = true
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
}
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
m[step.Key] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(val, remainingSteps, success, value, directPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
// Skip keys we've already processed directly
if step.Key != "*" && k == step.Key {
continue
}
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
m[k] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(v, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
return nil
}
// traverseWithPaths tracks both nodes and their paths during traversal
func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
if len(steps) == 0 || node == nil {
return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
}
// Skip root step
actualSteps := steps
if steps[0].Type == RootStep {
if len(steps) == 1 {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
return nil
}
actualSteps = steps[1:]
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
child, exists := m[step.Key]
if !exists {
return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
}
childPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: child, Path: childPath})
} else {
err := traverseWithPaths(child, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node is not an array; actual type: %T", node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
} else {
return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: val, Path: directPath})
} else {
err := traverseWithPaths(val, remainingSteps, results, directPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
}
}
}
}
// For wildcard, collect this node
if step.Key == "*" && isLastStep {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
*results = append(*results, JSONNode{Value: v, Path: childPath})
} else {
err := traverseWithPaths(v, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
}
return nil
}

View File

@@ -0,0 +1,577 @@
package jsonpath
import (
"reflect"
"testing"
)
func TestGetWithPathsBasic(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
error bool
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
{
name: "nonexistent path",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
},
path: "$.user.email",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
if !tt.error {
t.Errorf("GetWithPaths() returned error: %v", err)
}
return
}
// For nonexistent path, we expect empty slice
if tt.name == "nonexistent path" {
if len(result) > 0 {
t.Errorf("GetWithPaths() returned %v, expected empty result", result)
}
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For wildcard results, we need to check containment rather than exact order
if tt.name == "wildcard" || tt.name == "recursive descent" {
// For each expected item, check if it exists in the results by both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
found = true
break
}
}
if !found {
t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
}
}
} else {
// Otherwise check exact equality of both values and paths
for i, expected := range tt.expected {
if !reflect.DeepEqual(result[i].Value, expected.Value) {
t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
}
if result[i].Path != expected.Path {
t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := Set(data, "$.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("nested property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
}
err := Set(data, "$.user.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
user, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user["name"] != "Jane" {
t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
}
})
t.Run("array element", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
}
err := Set(data, "$.users[0].name", "Bob")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user0["name"] != "Bob" {
t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
}
})
t.Run("complex value", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
}
newProfile := map[string]interface{}{
"email": "john.doe@example.com",
"phone": "123-456-7890",
}
err := Set(data, "$.user.profile", newProfile)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
profile, ok := userMap["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Profile is not a map")
}
if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
t.Errorf("Set() failed: expected profile to be updated with new values")
}
})
t.Run("create new property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if email, exists := userMap["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
}
})
t.Run("create nested properties", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.contact.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
contact, ok := userMap["contact"].(map[string]interface{})
if !ok {
t.Fatalf("Contact is not a map")
}
if email, exists := contact["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
}
})
t.Run("create array and element", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
// This should create an empty addresses array, but won't be able to set index 0
// since the array is empty
err := Set(data, "$.user.addresses[0].street", "123 Main St")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
})
t.Run("multiple targets (should only update first)", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := Set(data, "$.users[*].active", false)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User0 is not a map")
}
user1, ok := users[1].(map[string]interface{})
if !ok {
t.Fatalf("User1 is not a map")
}
// Only the first one should be changed
if active, exists := user0["active"]; !exists || active != false {
t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
}
// The second one should remain unchanged
if active, exists := user1["active"]; !exists || active != true {
t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
}
})
t.Run("setting on root should fail", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
}
err := Set(data, "$", "Jane")
if err == nil {
t.Errorf("Set() returned no error, expected error for setting on root")
return
}
// Data should be unchanged
if data["name"] != "John" {
t.Errorf("Data was modified when setting on root")
}
})
}
func TestSetAll(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := SetAll(data, "$.name", "Jane")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("all array elements", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := SetAll(data, "$.users[*].active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
// Both elements should be updated
for i, user := range users {
userMap, ok := user.(map[string]interface{})
if !ok {
t.Fatalf("User%d is not a map", i)
}
if active, exists := userMap["active"]; !exists || active != false {
t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
}
}
})
t.Run("recursive descent", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
"admin": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
}
err := SetAll(data, "$..active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Check user profile
userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access user.profile")
}
if active, exists := userProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
}
// Check admin profile
adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access admin.profile")
}
if active, exists := adminProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
}
})
}
func TestGetWithPathsExtended(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
t.Errorf("GetWithPaths() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// Check if value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Check if path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -0,0 +1,318 @@
package jsonpath
import (
"reflect"
"testing"
)
var testData = map[string]interface{}{
"store": map[string]interface{}{
"book": []interface{}{
map[string]interface{}{
"title": "The Fellowship of the Ring",
"price": 22.99,
},
map[string]interface{}{
"title": "The Two Towers",
"price": 23.45,
},
},
"bicycle": map[string]interface{}{
"color": "red",
"price": 199.95,
},
},
}
func TestParser(t *testing.T) {
tests := []struct {
path string
steps []JSONStep
wantErr bool
}{
{
path: "$.store.bicycle.color",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "bicycle"},
{Type: ChildStep, Key: "color"},
},
},
{
path: "$..price",
steps: []JSONStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Key: "price"},
},
},
{
path: "$.store.book[*].title",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: -1}, // Wildcard
{Type: ChildStep, Key: "title"},
},
},
{
path: "$.store.book[0]",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: 0},
},
},
{
path: "invalid.path",
wantErr: true,
},
{
path: "$.store.book[abc]",
wantErr: true,
},
}
for _, tt := range tests {
t.Run(tt.path, func(t *testing.T) {
steps, err := ParseJSONPath(tt.path)
if (err != nil) != tt.wantErr {
t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
}
if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
}
})
}
}
func TestEvaluator(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
error bool
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
{
name: "wildcard_recursive",
path: "$..*",
expected: []JSONNode{
// These will be compared by value only, paths will be validated separately
{Value: testData["store"].(map[string]interface{})["book"]},
{Value: testData["store"].(map[string]interface{})["bicycle"]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
{Value: "The Fellowship of the Ring"},
{Value: 22.99},
{Value: "The Two Towers"},
{Value: 23.45},
{Value: "red"},
{Value: 199.95},
},
},
{
name: "invalid_index",
path: "$.store.book[5]",
expected: []JSONNode{},
error: true,
},
{
name: "nonexistent_property",
path: "$.store.nonexistent",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Use GetWithPaths directly
result, err := Get(testData, tt.path)
if err != nil {
if !tt.error {
t.Errorf("Get() returned error: %v", err)
}
return
}
// Special handling for wildcard recursive test
if tt.name == "wildcard_recursive" {
// Skip length check for wildcard recursive since it might vary
// Just verify that each expected item is in the results
// Validate values match and paths are filled in
for _, e := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, e.Value) {
found = true
break
}
}
if !found {
t.Errorf("Expected value %v not found in results", e.Value)
}
}
return
}
if len(result) != len(tt.expected) {
t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
}
// Validate both values and paths
for i, e := range tt.expected {
if i < len(result) {
if !reflect.DeepEqual(result[i].Value, e.Value) {
t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
}
if result[i].Path != e.Path {
t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
}
}
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("empty_data", func(t *testing.T) {
result, err := Get(nil, "$.a.b")
if err == nil {
t.Errorf("Expected error for empty data")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("empty_path", func(t *testing.T) {
_, err := ParseJSONPath("")
if err == nil {
t.Error("Expected error for empty path")
}
})
t.Run("numeric_keys", func(t *testing.T) {
data := map[string]interface{}{
"42": "answer",
}
result, err := Get(data, "$.42")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) == 0 || result[0].Value != "answer" {
t.Errorf("Expected 'answer', got %v", result)
}
})
}
func TestGetWithPaths(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(testData, tt.path)
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// First verify the value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Then verify the path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -1,523 +0,0 @@
-- Load the helper script
dofile("luahelper.lua")
-- Test helper function
local function assert(condition, message)
if not condition then error("ASSERTION FAILED: " .. (message or "unknown error")) end
end
local function test(name, fn)
local ok, err = pcall(fn)
if ok then
print("PASS: " .. name)
else
print("FAIL: " .. name .. " - " .. tostring(err))
end
end
-- Test fromCSV option validation
test("fromCSV invalid option", function()
local csv = "a,b,c\n1,2,3"
local rows, err = fromCSV(csv, { invalidOption = true })
assert(rows ~= nil and #rows == 0, "Should return empty table on error")
assert(err ~= nil, "Should return error message")
assert(string.find(err, "unknown option"), "Error should mention unknown option")
end)
-- Test toCSV error handling
test("toCSV invalid delimiter", function()
local rows = { { "a", "b", "c" } }
local csv, err = toCSV(rows, { delimiter = 123 })
-- toCSV converts delimiter to string, so 123 becomes "123"
assert(csv == "a123b123c", "Should convert delimiter to string")
assert(err == nil, "Should not return error")
end)
-- Test fromCSV basic parsing
test("fromCSV basic", function()
local csv = "a,b,c\n1,2,3\n4,5,6"
local rows, err = fromCSV(csv)
if err then error("fromCSV error: " .. err) end
assert(#rows == 3, "Should have 3 rows")
assert(rows[1][1] == "a", "First row first field should be 'a'")
assert(rows[2][2] == "2", "Second row second field should be '2'")
end)
-- Test fromCSV with headers
test("fromCSV with headers", function()
local csv = "foo,bar,baz\n1,2,3\n4,5,6"
local rows, err = fromCSV(csv, { hasheader = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 data rows")
assert(rows[1][1] == "1", "First row first field should be '1'")
assert(rows[1].foo == "1", "First row foo should be '1'")
assert(rows[1].bar == "2", "First row bar should be '2'")
assert(rows[1].baz == "3", "First row baz should be '3'")
end)
-- Test fromCSV with custom delimiter
test("fromCSV with tab delimiter", function()
local csv = "a\tb\tc\n1\t2\t3"
local rows, err = fromCSV(csv, { delimiter = "\t" })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows")
assert(rows[1][1] == "a", "First row first field should be 'a'")
assert(rows[2][2] == "2", "Second row second field should be '2'")
end)
-- Test fromCSV with quoted fields
test("fromCSV with quoted fields", function()
local csv = '"hello,world","test"\n"foo","bar"'
local rows, err = fromCSV(csv)
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows")
assert(rows[1][1] == "hello,world", "Quoted field with comma should be preserved")
assert(rows[1][2] == "test", "Second field should be 'test'")
end)
-- Test toCSV basic
test("toCSV basic", function()
local rows = { { "a", "b", "c" }, { "1", "2", "3" } }
local csv, err = toCSV(rows)
if err then error("toCSV error: " .. err) end
assert(csv == "a,b,c\n1,2,3", "CSV output should match expected")
end)
-- Test toCSV with custom delimiter
test("toCSV with tab delimiter", function()
local rows = { { "a", "b", "c" }, { "1", "2", "3" } }
local csv, err = toCSV(rows, { delimiter = "\t" })
if err then error("toCSV error: " .. err) end
assert(csv == "a\tb\tc\n1\t2\t3", "TSV output should match expected")
end)
-- Test toCSV with fields needing quoting
test("toCSV with quoted fields", function()
local rows = { { "hello,world", "test" }, { "foo", "bar" } }
local csv, err = toCSV(rows)
if err then error("toCSV error: " .. err) end
assert(csv == '"hello,world",test\nfoo,bar', "Fields with commas should be quoted")
end)
-- Test round trip
test("fromCSV toCSV round trip", function()
local original = "a,b,c\n1,2,3\n4,5,6"
local rows, err = fromCSV(original)
if err then error("fromCSV error: " .. err) end
local csv, err = toCSV(rows)
if err then error("toCSV error: " .. err) end
assert(csv == original, "Round trip should preserve original")
end)
-- Test round trip with headers
test("fromCSV toCSV round trip with headers", function()
local original = "foo,bar,baz\n1,2,3\n4,5,6"
local rows, err = fromCSV(original, { hasheader = true })
if err then error("fromCSV error: " .. err) end
local csv, err = toCSV(rows)
if err then error("toCSV error: " .. err) end
local expected = "1,2,3\n4,5,6"
assert(csv == expected, "Round trip with headers should preserve data rows")
end)
-- Test fromCSV with comments
test("fromCSV with comments", function()
local csv = "# This is a comment\nfoo,bar,baz\n1,2,3\n# Another comment\n4,5,6"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 3, "Should have 3 rows (comments filtered, header + 2 data rows)")
assert(rows[1][1] == "foo", "First row should be header row")
assert(rows[2][1] == "1", "Second row first field should be '1'")
assert(rows[3][1] == "4", "Third row first field should be '4'")
end)
-- Test fromCSV with comments and headers
test("fromCSV with comments and headers", function()
local csv = "#mercenary_profiles\nId,Name,Value\n1,Test,100\n# End of data\n2,Test2,200"
local rows, err = fromCSV(csv, { hasheader = true, hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 data rows")
assert(rows[1].Id == "1", "First row Id should be '1'")
assert(rows[1].Name == "Test", "First row Name should be 'Test'")
assert(rows[1].Value == "100", "First row Value should be '100'")
assert(rows[2].Id == "2", "Second row Id should be '2'")
end)
-- Test fromCSV with comments disabled
test("fromCSV without comments", function()
local csv = "# This should not be filtered\nfoo,bar\n1,2"
local rows, err = fromCSV(csv, { hascomments = false })
if err then error("fromCSV error: " .. err) end
assert(#rows == 3, "Should have 3 rows (including comment)")
assert(rows[1][1] == "# This should not be filtered", "Comment line should be preserved")
end)
-- Test fromCSV with comment at start
test("fromCSV comment at start", function()
local csv = "# Header comment\nId,Name\n1,Test"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows (comment filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with comment with leading whitespace
test("fromCSV comment with whitespace", function()
local csv = " # Comment with spaces\nId,Name\n1,Test"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows (comment with spaces filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with comment with tabs
test("fromCSV comment with tabs", function()
local csv = "\t# Comment with tab\nId,Name\n1,Test"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows (comment with tab filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with multiple consecutive comments
test("fromCSV multiple consecutive comments", function()
local csv = "# First comment\n# Second comment\n# Third comment\nId,Name\n1,Test"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows (all comments filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with comment in middle of data
test("fromCSV comment in middle", function()
local csv = "Id,Name\n1,Test\n# Middle comment\n2,Test2"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 3, "Should have 3 rows (comment filtered)")
assert(rows[1][1] == "Id", "First row should be header")
assert(rows[2][1] == "1", "Second row should be first data")
assert(rows[3][1] == "2", "Third row should be second data")
end)
-- Test fromCSV with comment at end
test("fromCSV comment at end", function()
local csv = "Id,Name\n1,Test\n# End comment"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows (end comment filtered)")
assert(rows[1][1] == "Id", "First row should be header")
assert(rows[2][1] == "1", "Second row should be data")
end)
-- Test fromCSV with empty comment line
test("fromCSV empty comment", function()
local csv = "#\nId,Name\n1,Test"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows (empty comment filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with comment and headers
test("fromCSV comment with headers enabled", function()
local csv = "#mercenary_profiles\nId,Name,Value\n1,Test,100\n2,Test2,200"
local rows, err = fromCSV(csv, { hasheader = true, hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 data rows")
assert(rows[1].Id == "1", "First row Id should be '1'")
assert(rows[1].Name == "Test", "First row Name should be 'Test'")
assert(rows[2].Id == "2", "Second row Id should be '2'")
end)
-- Test fromCSV with comment and TSV delimiter
test("fromCSV comment with tab delimiter", function()
local csv = "# Comment\nId\tName\n1\tTest"
local rows, err = fromCSV(csv, { delimiter = "\t", hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 rows")
assert(rows[1][1] == "Id", "First row should be header")
assert(rows[2][1] == "1", "Second row first field should be '1'")
end)
-- Test fromCSV with comment and headers and TSV
test("fromCSV comment with headers and TSV", function()
local csv = "#mercenary_profiles\nId\tName\tValue\n1\tTest\t100"
local rows, err = fromCSV(csv, { delimiter = "\t", hasheader = true, hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 1, "Should have 1 data row")
assert(rows[1].Id == "1", "Row Id should be '1'")
assert(rows[1].Name == "Test", "Row Name should be 'Test'")
assert(rows[1].Value == "100", "Row Value should be '100'")
end)
-- Test fromCSV with data field starting with # (not a comment)
test("fromCSV data field starting with hash", function()
local csv = "Id,Name\n1,#NotAComment\n2,Test"
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 3, "Should have 3 rows (data with # not filtered)")
assert(rows[1][1] == "Id", "First row should be header")
assert(rows[2][2] == "#NotAComment", "Second row should have #NotAComment as data")
end)
-- Test fromCSV with quoted field starting with #
test("fromCSV quoted field with hash", function()
local csv = 'Id,Name\n1,"#NotAComment"\n2,Test'
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 3, "Should have 3 rows (quoted # not filtered)")
assert(rows[2][2] == "#NotAComment", "Quoted field with # should be preserved")
end)
-- Test fromCSV with comment after quoted field
test("fromCSV comment after quoted field", function()
local csv = 'Id,Name\n1,"Test"\n# This is a comment\n2,Test2'
local rows, err = fromCSV(csv, { hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 3, "Should have 3 rows (comment filtered)")
assert(rows[2][2] == "Test", "Quoted field should be preserved")
assert(rows[3][1] == "2", "Third row should be second data row")
end)
-- Math function tests
test("min function", function()
assert(min(5, 3) == 3, "min(5, 3) should be 3")
assert(min(-1, 0) == -1, "min(-1, 0) should be -1")
assert(min(10, 10) == 10, "min(10, 10) should be 10")
end)
test("max function", function()
assert(max(5, 3) == 5, "max(5, 3) should be 5")
assert(max(-1, 0) == 0, "max(-1, 0) should be 0")
assert(max(10, 10) == 10, "max(10, 10) should be 10")
end)
test("round function", function()
assert(round(3.14159) == 3, "round(3.14159) should be 3")
assert(round(3.14159, 2) == 3.14, "round(3.14159, 2) should be 3.14")
assert(round(3.5) == 4, "round(3.5) should be 4")
assert(round(3.4) == 3, "round(3.4) should be 3")
assert(round(123.456, 1) == 123.5, "round(123.456, 1) should be 123.5")
end)
test("floor function", function()
assert(floor(3.7) == 3, "floor(3.7) should be 3")
assert(floor(-3.7) == -4, "floor(-3.7) should be -4")
assert(floor(5) == 5, "floor(5) should be 5")
end)
test("ceil function", function()
assert(ceil(3.2) == 4, "ceil(3.2) should be 4")
assert(ceil(-3.2) == -3, "ceil(-3.2) should be -3")
assert(ceil(5) == 5, "ceil(5) should be 5")
end)
-- String function tests
test("upper function", function()
assert(upper("hello") == "HELLO", "upper('hello') should be 'HELLO'")
assert(upper("Hello World") == "HELLO WORLD", "upper('Hello World') should be 'HELLO WORLD'")
assert(upper("123abc") == "123ABC", "upper('123abc') should be '123ABC'")
end)
test("lower function", function()
assert(lower("HELLO") == "hello", "lower('HELLO') should be 'hello'")
assert(lower("Hello World") == "hello world", "lower('Hello World') should be 'hello world'")
assert(lower("123ABC") == "123abc", "lower('123ABC') should be '123abc'")
end)
test("format function", function()
assert(format("Hello %s", "World") == "Hello World", "format should work")
assert(format("Number: %d", 42) == "Number: 42", "format with number should work")
assert(format("%.2f", 3.14159) == "3.14", "format with float should work")
end)
test("trim function", function()
assert(trim(" hello ") == "hello", "trim should remove leading and trailing spaces")
assert(trim(" hello world ") == "hello world", "trim should preserve internal spaces")
assert(trim("hello") == "hello", "trim should not affect strings without spaces")
assert(trim(" ") == "", "trim should handle all spaces")
end)
test("strsplit function", function()
local result = strsplit("a,b,c", ",")
assert(#result == 3, "strsplit should return 3 elements")
assert(result[1] == "a", "First element should be 'a'")
assert(result[2] == "b", "Second element should be 'b'")
assert(result[3] == "c", "Third element should be 'c'")
end)
test("strsplit with default separator", function()
local result = strsplit("a b c")
assert(#result == 3, "strsplit with default should return 3 elements")
assert(result[1] == "a", "First element should be 'a'")
assert(result[2] == "b", "Second element should be 'b'")
assert(result[3] == "c", "Third element should be 'c'")
end)
test("strsplit with custom separator", function()
local result = strsplit("a|b|c", "|")
assert(#result == 3, "strsplit with pipe should return 3 elements")
assert(result[1] == "a", "First element should be 'a'")
assert(result[2] == "b", "Second element should be 'b'")
assert(result[3] == "c", "Third element should be 'c'")
end)
-- Conversion function tests
test("num function", function()
assert(num("123") == 123, "num('123') should be 123")
assert(num("45.67") == 45.67, "num('45.67') should be 45.67")
assert(num("invalid") == 0, "num('invalid') should be 0")
assert(num("") == 0, "num('') should be 0")
end)
test("str function", function()
assert(str(123) == "123", "str(123) should be '123'")
assert(str(45.67) == "45.67", "str(45.67) should be '45.67'")
assert(str(0) == "0", "str(0) should be '0'")
end)
test("is_number function", function()
assert(is_number("123") == true, "is_number('123') should be true")
assert(is_number("45.67") == true, "is_number('45.67') should be true")
assert(is_number("invalid") == false, "is_number('invalid') should be false")
assert(is_number("") == false, "is_number('') should be false")
assert(is_number("123abc") == false, "is_number('123abc') should be false")
end)
-- Table function tests
test("isArray function", function()
assert(isArray({ 1, 2, 3 }) == true, "isArray should return true for sequential array")
assert(isArray({ "a", "b", "c" }) == true, "isArray should return true for string array")
assert(isArray({}) == true, "isArray should return true for empty array")
assert(isArray({ a = 1, b = 2 }) == false, "isArray should return false for map")
assert(isArray({ 1, 2, [4] = 4 }) == false, "isArray should return false for sparse array")
assert(
isArray({ [1] = 1, [2] = 2, [3] = 3 }) == true,
"isArray should return true for 1-indexed array"
)
assert(
isArray({ [0] = 1, [1] = 2 }) == false,
"isArray should return false for 0-indexed array"
)
assert(
isArray({ [1] = 1, [2] = 2, [4] = 4 }) == false,
"isArray should return false for non-sequential array"
)
assert(isArray("not a table") == false, "isArray should return false for non-table")
assert(isArray(123) == false, "isArray should return false for number")
end)
test("fromCSV assigns header keys correctly", function()
local teststr = [[
#mercenary_profiles
Id ModifyStartCost ModifyStep ModifyLevelLimit Health ResistSheet WoundSlots MeleeDamage MeleeAccuracy RangeAccuracy ReceiveAmputationChance ReceiveWoundChanceMult AttackWoundChanceMult Dodge Los StarvationLimit PainThresholdLimit PainThresholdRegen TalentPerkId ActorId SkinIndex HairType HairColorHex VoiceBank Immunity CreatureClass
john_hawkwood_boss 20 0.1 140 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 8 16 crit 1.60 critchance 0.05 0.5 0.5 0.03 0.5 1.2 0.3 8 2200 16 2 talent_the_man_who_sold_the_world human_male 0 hair1 #633D08 player Human
francis_reid_daly 20 0.1 130 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.05 0.5 0.4 0.04 0.9 1 0.3 8 2000 10 1 talent_weapon_durability human_male 0 player Human
]]
local rows, err = fromCSV(teststr, { delimiter = "\t", hasheader = true, hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 data rows")
-- Test first row
assert(rows[1].Id == "john_hawkwood_boss", "First row Id should be 'john_hawkwood_boss'")
assert(rows[1].ModifyStartCost == "20", "First row ModifyStartCost should be '20'")
assert(rows[1].ModifyStep == "0.1", "First row ModifyStep should be '0.1'")
assert(rows[1].Health == "140", "First row Health should be '140'")
assert(rows[1].ActorId == "human_male", "First row ActorId should be 'human_male'")
assert(rows[1].HairColorHex == "#633D08", "First row HairColorHex should be '#633D08'")
-- Test second row
assert(rows[2].Id == "francis_reid_daly", "Second row Id should be 'francis_reid_daly'")
assert(rows[2].ModifyStartCost == "20", "Second row ModifyStartCost should be '20'")
assert(rows[2].ModifyStep == "0.1", "Second row ModifyStep should be '0.1'")
assert(rows[2].Health == "130", "Second row Health should be '130'")
assert(rows[2].ActorId == "human_male", "Second row ActorId should be 'human_male'")
-- Test that numeric indices still work
assert(rows[1][1] == "john_hawkwood_boss", "First row first field by index should work")
assert(rows[1][2] == "20", "First row second field by index should work")
end)
test("fromCSV debug header assignment", function()
local csv = "Id Name Value\n1 Test 100\n2 Test2 200"
local rows, err = fromCSV(csv, { delimiter = "\t", hasheader = true })
if err then error("fromCSV error: " .. err) end
assert(rows[1].Id == "1", "Id should be '1'")
assert(rows[1].Name == "Test", "Name should be 'Test'")
assert(rows[1].Value == "100", "Value should be '100'")
end)
test("fromCSV real world mercenary file format", function()
local csv = [[#mercenary_profiles
Id ModifyStartCost ModifyStep ModifyLevelLimit Health ResistSheet WoundSlots MeleeDamage MeleeAccuracy RangeAccuracy ReceiveAmputationChance ReceiveWoundChanceMult AttackWoundChanceMult Dodge Los StarvationLimit PainThresholdLimit PainThresholdRegen TalentPerkId ActorId SkinIndex HairType HairColorHex VoiceBank Immunity CreatureClass
john_hawkwood_boss 20 0.1 140 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 8 16 crit 1.60 critchance 0.05 0.5 0.5 0.03 0.5 1.2 0.3 8 2200 16 2 talent_the_man_who_sold_the_world human_male 0 hair1 #633D08 player Human
francis_reid_daly 20 0.1 130 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.05 0.5 0.4 0.04 0.9 1 0.3 8 2000 10 1 talent_weapon_durability human_male 0 player Human
]]
local rows, err = fromCSV(csv, { delimiter = "\t", hasheader = true, hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 2, "Should have 2 data rows")
assert(rows[1].Id == "john_hawkwood_boss", "First row Id should be 'john_hawkwood_boss'")
assert(rows[1].ModifyStartCost == "20", "First row ModifyStartCost should be '20'")
assert(rows[2].Id == "francis_reid_daly", "Second row Id should be 'francis_reid_daly'")
end)
test("full CSV parser complex", function()
local original = [[
#mercenary_profiles
Id ModifyStartCost ModifyStep ModifyLevelLimit Health ResistSheet WoundSlots MeleeDamage MeleeAccuracy RangeAccuracy ReceiveAmputationChance ReceiveWoundChanceMult AttackWoundChanceMult Dodge Los StarvationLimit PainThresholdLimit PainThresholdRegen TalentPerkId ActorId SkinIndex HairType HairColorHex VoiceBank Immunity CreatureClass
john_hawkwood_boss 20 0.1 140 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 8 16 crit 1.60 critchance 0.05 0.5 0.5 0.03 0.5 1.2 0.3 8 2200 16 2 talent_the_man_who_sold_the_world human_male 0 hair1 #633D08 player Human
francis_reid_daly 20 0.1 130 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.05 0.5 0.4 0.04 0.9 1 0.3 8 2000 10 1 talent_weapon_durability human_male 0 player Human
victoria_boudicca 20 0.1 90 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.1 0.4 0.45 0.05 1 1.2 0.3 8 1800 8 1 talent_weapon_distance human_female 0 hair1 #633D08 player Human
persival_fawcett 20 0.1 150 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 6 12 crit 1.70 critchance 0.05 0.5 0.35 0.05 0.6 1 0.25 8 2100 16 1 talent_all_resists human_male 1 hair1 #633D08 player Human
Isabella_capet 20 0.1 100 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.15 0.55 0.3 0.03 0.8 1.4 0.35 7 1700 14 2 talent_ignore_infection human_female 1 hair3 #FF3100 player Human
maximilian_rohr 20 0.1 120 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 8 16 crit 1.75 critchance 0.05 0.45 0.45 0.06 0.9 1 0.2 8 2000 14 1 talent_ignore_pain human_male 0 hair2 #FFC400 player Human
priya_marlon 20 0.1 110 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.15 0.45 0.35 0.05 1 1.1 0.3 7 2200 12 1 talent_all_consumables_stack human_female 0 hair2 #FFC400 player Human
jacques_kennet 20 0.1 120 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.05 0.45 0.35 0.04 0.9 1.2 0.3 8 2300 10 1 talent_reload_time human_male 0 hair1 #908E87 player Human
mirza_aishatu 20 0.1 110 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.05 0.55 0.45 0.03 1 1.1 0.25 9 2000 10 1 talent_starving_slower human_female 1 hair2 #633D08 player Human
kenzie_yukio 20 0.1 100 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.1 0.6 0.4 0.04 1 1 0.4 7 1600 12 1 talent_weight_dodge_affect human_male 0 hair2 #633D08 player Human
marika_wulfnod 20 0.1 100 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 6 12 crit 1.60 critchance 0.05 0.5 0.5 0.04 1 1 0.3 9 1900 12 1 talent_belt_slots human_female 0 hair1 #FFC400 player Human
auberon_lukas 20 0.1 120 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 4 8 crit 1.60 critchance 0.15 0.45 0.45 0.05 0.8 1 0.2 9 1900 8 2 talent_weapon_slot human_male 0 hair2 #633D08 player Human
niko_medich 20 0.1 120 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.05 0.4 0.45 0.04 1 1.3 0.25 8 2000 10 1 talent_pistol_acc human_male 0 hair1 #908E87 player Human
#end
#mercenary_classes
Id ModifyStartCost ModifyStep PerkIds
scouts_of_hades 30 0.1 cqc_specialist_basic military_training_basic gear_maintenance_basic blind_fury_basic fire_transfer_basic assault_reflex_basic
ecclipse_blades 30 0.1 berserkgang_basic athletics_basic reaction_training_basic cold_weapon_wielding_basic cannibalism_basic carnage_basic
tifton_elite 30 0.1 heavy_weaponary_basic grenadier_basic selfhealing_basic stationary_defense_basic spray_and_pray_basic shock_awe_basic
tunnel_rats 30 0.1 cautious_basic handmade_shotgun_ammo_basic marauder_basic dirty_shot_basic vicious_symbiosis_basic covermaster_basic
phoenix_brigade 30 0.1 shielding_basic battle_physicist_basic reinforced_battery_basic revealing_flame_basic cauterize_basic scholar_basic
]]
-- Parse with headers and comments
local rows, err = fromCSV(original, { delimiter = "\t", hasheader = true, hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows > 0, "Should have parsed rows")
-- Convert back to CSV with headers
local csv, err = toCSV(rows, { delimiter = "\t", hasheader = true })
if err then error("toCSV error: " .. err) end
-- Parse again
local rows2, err = fromCSV(csv, { delimiter = "\t", hasheader = true, hascomments = false })
if err then error("fromCSV error: " .. err) end
-- Verify identical - same number of rows
assert(#rows2 == #rows, "Round trip should have same number of rows")
-- Verify first row data is identical
assert(rows2[1].Id == rows[1].Id, "Round trip first row Id should match")
assert(
rows2[1].ModifyStartCost == rows[1].ModifyStartCost,
"Round trip first row ModifyStartCost should match"
)
assert(rows2[1].Health == rows[1].Health, "Round trip first row Health should match")
-- Verify headers are preserved
assert(rows2[1].Headers ~= nil, "Round trip rows should have Headers field")
assert(#rows2[1].Headers == #rows[1].Headers, "Headers should have same number of elements")
assert(rows2[1].Headers[1] == rows[1].Headers[1], "First header should match")
end)
print("\nAll tests completed!")

View File

@@ -1,331 +0,0 @@
-- Custom Lua helpers for math operations
function min(a, b) return math.min(a, b) end
function max(a, b) return math.max(a, b) end
function round(x, n)
if n == nil then n = 0 end
return math.floor(x * 10 ^ n + 0.5) / 10 ^ n
end
function floor(x) return math.floor(x) end
function ceil(x) return math.ceil(x) end
function upper(s) return string.upper(s) end
function lower(s) return string.lower(s) end
function format(s, ...) return string.format(s, ...) end
function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
-- String split helper
function strsplit(inputstr, sep)
if sep == nil then sep = "%s" end
local t = {}
for str in string.gmatch(inputstr, "([^" .. sep .. "]+)") do
table.insert(t, str)
end
return t
end
---@param table table
---@param depth number?
function dump(table, depth)
if depth == nil then depth = 0 end
if depth > 200 then
print("Error: Depth > 200 in dump()")
return
end
for k, v in pairs(table) do
if type(v) == "table" then
print(string.rep(" ", depth) .. k .. ":")
dump(v, depth + 1)
else
print(string.rep(" ", depth) .. k .. ": ", v)
end
end
end
--- @class ParserOptions
--- @field delimiter string? The field delimiter (default: ",").
--- @field hasheader boolean? If true, first non-comment row is treated as headers (default: false).
--- @field hascomments boolean? If true, lines starting with '#' are skipped (default: false).
--- @type ParserOptions
parserDefaultOptions = { delimiter = ",", hasheader = false, hascomments = false }
--- Validates options against a set of valid option keys.
--- @param options ParserOptions? The options table to validate
--- @return boolean #True if options are valid
--- @return string? #Error message if invalid, nil if valid
function areOptionsValid(options)
if options == nil then return true, nil end
if type(options) ~= "table" then return false, "options must be a table" end
-- Build valid options list from validOptions table
local validOptionsStr = ""
for k, _ in pairs(parserDefaultOptions) do
validOptionsStr = validOptionsStr .. k .. ", "
end
for k, _ in pairs(options) do
if parserDefaultOptions[k] == nil then
return false,
"unknown option: " .. tostring(k) .. " (valid options: " .. validOptionsStr .. ")"
end
end
return true, nil
end
--- Parses CSV text into rows and fields using a minimal RFC 4180 state machine.
---
--- Requirements/assumptions:
--- - Input is a single string containing the entire CSV content.
--- - Field separators are specified by delimiter option (default: comma).
--- - Newlines between rows may be "\n" or "\r\n". "\r\n" is treated as one line break.
--- - Fields may be quoted with double quotes (").
--- - Inside quoted fields, doubled quotes ("") represent a literal quote character.
--- - No backslash escaping is supported (not part of RFC 4180).
--- - Newlines inside quoted fields are preserved as part of the field.
--- - Leading/trailing spaces are preserved; no trimming is performed.
--- - Empty fields and empty rows are preserved.
--- - The final row is emitted even if the text does not end with a newline.
--- - Lines starting with '#' (after optional leading whitespace) are treated as comments and skipped if hascomments is true.
---
--- @param csv string The CSV text to parse.
--- @param options ParserOptions? Options for the parser
--- @return table #A table (array) of rows; each row is a table with numeric indices and optionally header-named keys.
--- @return string? #Error message if parsing fails.
function fromCSV(csv, options)
if options == nil then options = {} end
-- Validate options
local isValid, err = areOptionsValid(options)
if not isValid then return {}, err end
local delimiter = options.delimiter or parserDefaultOptions.delimiter
local hasheader = options.hasheader or parserDefaultOptions.hasheader
local hascomments = options.hascomments or parserDefaultOptions.hascomments
local allRows = {}
local fields = {}
local field = {}
local STATE_DEFAULT = 1
local STATE_IN_QUOTES = 2
local STATE_QUOTE_IN_QUOTES = 3
local state = STATE_DEFAULT
local i = 1
local len = #csv
while i <= len do
local c = csv:sub(i, i)
if state == STATE_DEFAULT then
if c == '"' then
state = STATE_IN_QUOTES
i = i + 1
elseif c == delimiter then
table.insert(fields, table.concat(field))
field = {}
i = i + 1
elseif c == "\r" or c == "\n" then
table.insert(fields, table.concat(field))
field = {}
local shouldAdd = true
if hascomments and #fields > 0 then
local firstField = fields[1]
local trimmed = trim(firstField)
if string.sub(trimmed, 1, 1) == "#" then shouldAdd = false end
end
if shouldAdd then table.insert(allRows, fields) end
fields = {}
if c == "\r" and i < len and csv:sub(i + 1, i + 1) == "\n" then
i = i + 2
else
i = i + 1
end
else
table.insert(field, c)
i = i + 1
end
elseif state == STATE_IN_QUOTES then
if c == '"' then
state = STATE_QUOTE_IN_QUOTES
i = i + 1
else
table.insert(field, c)
i = i + 1
end
else -- STATE_QUOTE_IN_QUOTES
if c == '"' then
table.insert(field, '"')
state = STATE_IN_QUOTES
i = i + 1
elseif c == delimiter then
table.insert(fields, table.concat(field))
field = {}
state = STATE_DEFAULT
i = i + 1
elseif c == "\r" or c == "\n" then
table.insert(fields, table.concat(field))
field = {}
local shouldAdd = true
if hascomments and #fields > 0 then
local firstField = fields[1]
local trimmed = string.gsub(firstField, "^%s*(.-)%s*$", "%1")
if string.sub(trimmed, 1, 1) == "#" then shouldAdd = false end
end
if shouldAdd then table.insert(allRows, fields) end
fields = {}
state = STATE_DEFAULT
if c == "\r" and i < len and csv:sub(i + 1, i + 1) == "\n" then
i = i + 2
else
i = i + 1
end
else
state = STATE_DEFAULT
-- Don't increment i, reprocess character in DEFAULT state
end
end
end
if #field > 0 or #fields > 0 then
table.insert(fields, table.concat(field))
local shouldAdd = true
if hascomments and #fields > 0 then
local firstField = fields[1]
local trimmed = string.gsub(firstField, "^%s*(.-)%s*$", "%1")
if string.sub(trimmed, 1, 1) == "#" then shouldAdd = false end
end
if shouldAdd then table.insert(allRows, fields) end
end
if hasheader and #allRows > 0 then
local headers = allRows[1]
local rows = {}
for ii = 2, #allRows do
local row = {}
local dataRow = allRows[ii]
for j = 1, #dataRow do
row[j] = dataRow[j]
if headers[j] ~= nil and headers[j] ~= "" then
local headerName = trim(headers[j])
row[headerName] = dataRow[j]
end
end
row.Headers = headers
table.insert(rows, row)
end
return rows, nil
end
return allRows, nil
end
--- Converts a table of rows back to CSV text format (RFC 4180 compliant).
---
--- Requirements:
--- - Input is a table (array) of rows, where each row is a table (array) of field values.
--- - Field values are converted to strings using tostring().
--- - Fields are quoted if they contain the delimiter, newlines, or double quotes.
--- - Double quotes inside quoted fields are doubled ("").
--- - Fields are joined with the specified delimiter; rows are joined with newlines.
--- - If includeHeaders is true and rows have a Headers field, headers are included as the first row.
---
--- @param rows table Array of rows, where each row is an array of field values.
--- @param options ParserOptions? Options for the parser
--- @return string? #CSV-formatted text, error string?
--- @return string? #Error message if conversion fails.
function toCSV(rows, options)
if options == nil then options = {} end
-- Validate options
local isValid, err = areOptionsValid(options)
if not isValid then return nil, err end
local delimiter = options.delimiter or parserDefaultOptions.delimiter
local includeHeaders = options.hasheader or parserDefaultOptions.hasheader
local rowStrings = {}
-- Include headers row if requested and available
if includeHeaders and #rows > 0 and rows[1].Headers ~= nil then
local headerStrings = {}
for _, header in ipairs(rows[1].Headers) do
local headerStr = tostring(header)
local needsQuoting = false
if
headerStr:find(delimiter)
or headerStr:find("\n")
or headerStr:find("\r")
or headerStr:find('"')
then
needsQuoting = true
end
if needsQuoting then
headerStr = headerStr:gsub('"', '""')
headerStr = '"' .. headerStr .. '"'
end
table.insert(headerStrings, headerStr)
end
table.insert(rowStrings, table.concat(headerStrings, delimiter))
end
for _, row in ipairs(rows) do
local fieldStrings = {}
for _, field in ipairs(row) do
local fieldStr = tostring(field)
local needsQuoting = false
if
fieldStr:find(delimiter)
or fieldStr:find("\n")
or fieldStr:find("\r")
or fieldStr:find('"')
then
needsQuoting = true
end
if needsQuoting then
fieldStr = fieldStr:gsub('"', '""')
fieldStr = '"' .. fieldStr .. '"'
end
table.insert(fieldStrings, fieldStr)
end
table.insert(rowStrings, table.concat(fieldStrings, delimiter))
end
return table.concat(rowStrings, "\n"), nil
end
-- String to number conversion helper
function num(str) return tonumber(str) or 0 end
-- Number to string conversion
function str(num) return tostring(num) end
-- Check if string is numeric
function is_number(str) return tonumber(str) ~= nil end
function isArray(t)
if type(t) ~= "table" then return false end
local max = 0
local count = 0
for k, _ in pairs(t) do
if type(k) ~= "number" or k < 1 or math.floor(k) ~= k then return false end
max = math.max(max, k)
count = count + 1
end
return max == count
end
modified = false

View File

@@ -1,186 +1,164 @@
package processor package processor
import ( import (
_ "embed"
"fmt" "fmt"
"io" "reflect"
"net/http"
"regexp"
"strings" "strings"
"cook/utils"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua" lua "github.com/yuin/gopher-lua"
) )
//go:embed luahelper.lua // Processor defines the interface for all file processors
var helperScript string type Processor interface {
// Process handles processing a file with the given pattern and Lua expression
Process(filename string, pattern string, luaExpr string) (int, int, error)
// processorLogger is a scoped logger for the processor package. // ProcessContent handles processing a string content directly with the given pattern and Lua expression
var processorLogger = logger.Default.WithPrefix("processor") // Returns the modified content, modification count, match count, and any error
ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
// Maybe we make this an interface again for the shits and giggles // ToLua converts processor-specific data to Lua variables
// We will see, it could easily be... ToLua(L *lua.LState, data interface{}) error
var globalVariables = map[string]interface{}{} // FromLua retrieves modified data from Lua
FromLua(L *lua.LState) (interface{}, error)
func SetVariables(vars map[string]interface{}) {
for k, v := range vars {
globalVariables[k] = v
} }
// ModificationRecord tracks a single value modification
type ModificationRecord struct {
File string
OldValue string
NewValue string
Operation string
Context string
} }
func NewLuaState() (*lua.LState, error) { func NewLuaState() (*lua.LState, error) {
newLStateLogger := processorLogger.WithPrefix("NewLuaState")
newLStateLogger.Debug("Creating new Lua state")
L := lua.NewState() L := lua.NewState()
// defer L.Close() // defer L.Close()
// Load math library // Load math library
newLStateLogger.Debug("Loading Lua math library")
L.Push(L.GetGlobal("require")) L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math")) L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil { if err := L.PCall(1, 1, nil); err != nil {
newLStateLogger.Error("Failed to load Lua math library: %v", err)
return nil, fmt.Errorf("error loading Lua math library: %v", err) return nil, fmt.Errorf("error loading Lua math library: %v", err)
} }
newLStateLogger.Debug("Lua math library loaded")
// Initialize helper functions // Initialize helper functions
newLStateLogger.Debug("Initializing Lua helper functions")
if err := InitLuaHelpers(L); err != nil { if err := InitLuaHelpers(L); err != nil {
newLStateLogger.Error("Failed to initialize Lua helper functions: %v", err)
return nil, err return nil, err
} }
newLStateLogger.Debug("Lua helper functions initialized")
// Inject global variables
if len(globalVariables) > 0 {
newLStateLogger.Debug("Injecting %d global variables into Lua state", len(globalVariables))
for k, v := range globalVariables {
switch val := v.(type) {
case int:
L.SetGlobal(k, lua.LNumber(float64(val)))
case int64:
L.SetGlobal(k, lua.LNumber(float64(val)))
case float32:
L.SetGlobal(k, lua.LNumber(float64(val)))
case float64:
L.SetGlobal(k, lua.LNumber(val))
case string:
L.SetGlobal(k, lua.LString(val))
case bool:
if val {
L.SetGlobal(k, lua.LTrue)
} else {
L.SetGlobal(k, lua.LFalse)
}
default:
// Fallback to string representation
L.SetGlobal(k, lua.LString(fmt.Sprintf("%v", val)))
}
}
}
newLStateLogger.Debug("New Lua state created successfully")
return L, nil return L, nil
} }
// FromLua converts a Lua table to a struct or map recursively // ToLuaTable converts a struct or map to a Lua table recursively
func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) { func ToLuaTable(L *lua.LState, data interface{}) (*lua.LTable, error) {
fromLuaLogger := processorLogger.WithPrefix("FromLua").WithField("luaType", luaValue.Type().String()) luaTable := L.NewTable()
fromLuaLogger.Debug("Converting Lua value to Go interface")
switch v := luaValue.(type) { switch v := data.(type) {
case *lua.LTable: case map[string]interface{}:
fromLuaLogger.Debug("Processing Lua table") for key, value := range v {
isArray, err := IsLuaTableArray(L, v) luaValue, err := ToLuaTable(L, value)
if err != nil { if err != nil {
fromLuaLogger.Error("Failed to determine if Lua table is array: %v", err)
return nil, err return nil, err
} }
fromLuaLogger.Debug("Lua table is array: %t", isArray) luaTable.RawSetString(key, luaValue)
if isArray {
fromLuaLogger.Debug("Converting Lua table to Go array")
result := make([]interface{}, 0)
v.ForEach(func(key lua.LValue, value lua.LValue) {
converted, _ := FromLua(L, value)
result = append(result, converted)
})
fromLuaLogger.Trace("Converted Go array: %v", result)
return result, nil
} else {
fromLuaLogger.Debug("Converting Lua table to Go map")
result := make(map[string]interface{})
v.ForEach(func(key lua.LValue, value lua.LValue) {
converted, _ := FromLua(L, value)
result[key.String()] = converted
})
fromLuaLogger.Trace("Converted Go map: %v", result)
return result, nil
} }
case lua.LString: case struct{}:
fromLuaLogger.Debug("Converting Lua string to Go string") val := reflect.ValueOf(v)
fromLuaLogger.Trace("Lua string: %q", string(v)) for i := 0; i < val.NumField(); i++ {
return string(v), nil field := val.Type().Field(i)
case lua.LBool: luaValue, err := ToLuaTable(L, val.Field(i).Interface())
fromLuaLogger.Debug("Converting Lua boolean to Go boolean")
fromLuaLogger.Trace("Lua boolean: %t", bool(v))
return bool(v), nil
case lua.LNumber:
fromLuaLogger.Debug("Converting Lua number to Go float64")
fromLuaLogger.Trace("Lua number: %f", float64(v))
return float64(v), nil
default:
fromLuaLogger.Debug("Unsupported Lua type, returning nil")
return nil, nil
}
}
func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
isLuaTableArrayLogger := processorLogger.WithPrefix("IsLuaTableArray")
isLuaTableArrayLogger.Debug("Checking if Lua table is an array")
isLuaTableArrayLogger.Trace("Lua table input: %v", v)
L.SetGlobal("table_to_check", v)
// Use our predefined helper function from InitLuaHelpers
err := L.DoString(`is_array = isArray(table_to_check)`)
if err != nil { if err != nil {
isLuaTableArrayLogger.Error("Error determining if table is an array: %v", err) return nil, err
return false, fmt.Errorf("error determining if table is array: %w", err) }
luaTable.RawSetString(field.Name, luaValue)
}
case string:
luaTable.RawSetString("v", lua.LString(v))
case bool:
luaTable.RawSetString("v", lua.LBool(v))
case float64:
luaTable.RawSetString("v", lua.LNumber(v))
default:
return nil, fmt.Errorf("unsupported data type: %T", data)
}
return luaTable, nil
} }
// Check the result of our Lua function // FromLuaTable converts a Lua table to a struct or map recursively
isArray := L.GetGlobal("is_array") func FromLuaTable(L *lua.LState, luaTable *lua.LTable) (map[string]interface{}, error) {
// LVIsFalse returns true if a given LValue is a nil or false otherwise false. result := make(map[string]interface{})
result := !lua.LVIsFalse(isArray)
isLuaTableArrayLogger.Debug("Lua table is array: %t", result) luaTable.ForEach(func(key lua.LValue, value lua.LValue) {
isLuaTableArrayLogger.Trace("isArray result Lua value: %v", isArray) switch v := value.(type) {
case *lua.LTable:
nestedMap, err := FromLuaTable(L, v)
if err != nil {
return
}
result[key.String()] = nestedMap
case lua.LString:
result[key.String()] = string(v)
case lua.LBool:
result[key.String()] = bool(v)
case lua.LNumber:
result[key.String()] = float64(v)
default:
result[key.String()] = nil
}
})
return result, nil return result, nil
} }
// InitLuaHelpers initializes common Lua helper functions // InitLuaHelpers initializes common Lua helper functions
func InitLuaHelpers(L *lua.LState) error { func InitLuaHelpers(L *lua.LState) error {
initLuaHelpersLogger := processorLogger.WithPrefix("InitLuaHelpers") helperScript := `
initLuaHelpersLogger.Debug("Loading Lua helper functions") -- Custom Lua helpers for math operations
function min(a, b) return math.min(a, b) end
function max(a, b) return math.max(a, b) end
function round(x) return math.floor(x + 0.5) end
function floor(x) return math.floor(x) end
function ceil(x) return math.ceil(x) end
function upper(s) return string.upper(s) end
function lower(s) return string.lower(s) end
-- String to number conversion helper
function num(str)
return tonumber(str) or 0
end
-- Number to string conversion
function str(num)
return tostring(num)
end
-- Check if string is numeric
function is_number(str)
return tonumber(str) ~= nil
end
`
if err := L.DoString(helperScript); err != nil { if err := L.DoString(helperScript); err != nil {
initLuaHelpersLogger.Error("Failed to load Lua helper functions: %v", err)
return fmt.Errorf("error loading helper functions: %v", err) return fmt.Errorf("error loading helper functions: %v", err)
} }
initLuaHelpersLogger.Debug("Lua helper functions loaded")
initLuaHelpersLogger.Debug("Setting up Lua print function to Go")
L.SetGlobal("print", L.NewFunction(printToGo))
L.SetGlobal("fetch", L.NewFunction(fetch))
L.SetGlobal("re", L.NewFunction(EvalRegex))
initLuaHelpersLogger.Debug("Lua print and fetch functions bound to Go")
return nil return nil
} }
func PrependLuaAssignment(luaExpr string) string { // Helper utility functions
prependLuaAssignmentLogger := processorLogger.WithPrefix("PrependLuaAssignment").WithField("originalLuaExpr", luaExpr)
prependLuaAssignmentLogger.Debug("Prepending Lua assignment if necessary") // LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string {
s = strings.ReplaceAll(s, "\n", "\\n")
if len(s) <= maxLen {
return s
}
return s[:maxLen-3] + "..."
}
// BuildLuaScript prepares a Lua expression from shorthand notation
func BuildLuaScript(luaExpr string) string {
// Auto-prepend v1 for expressions starting with operators // Auto-prepend v1 for expressions starting with operators
if strings.HasPrefix(luaExpr, "*") || if strings.HasPrefix(luaExpr, "*") ||
strings.HasPrefix(luaExpr, "/") || strings.HasPrefix(luaExpr, "/") ||
@@ -189,303 +167,31 @@ func PrependLuaAssignment(luaExpr string) string {
strings.HasPrefix(luaExpr, "^") || strings.HasPrefix(luaExpr, "^") ||
strings.HasPrefix(luaExpr, "%") { strings.HasPrefix(luaExpr, "%") {
luaExpr = "v1 = v1" + luaExpr luaExpr = "v1 = v1" + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1 = v1' due to operator prefix")
} else if strings.HasPrefix(luaExpr, "=") { } else if strings.HasPrefix(luaExpr, "=") {
// Handle direct assignment with = operator // Handle direct assignment with = operator
luaExpr = "v1 " + luaExpr luaExpr = "v1 " + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1' due to direct assignment operator")
} }
// Add assignment if needed // Add assignment if needed
if !strings.Contains(luaExpr, "=") { if !strings.Contains(luaExpr, "=") {
luaExpr = "v1 = " + luaExpr luaExpr = "v1 = " + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1 =' as no assignment was found")
} }
prependLuaAssignmentLogger.Trace("Final Lua expression after prepending: %q", luaExpr)
return luaExpr return luaExpr
} }
// BuildLuaScript prepares a Lua expression from shorthand notation // Max returns the maximum of two integers
func BuildLuaScript(luaExpr string) string { func Max(a, b int) int {
buildLuaScriptLogger := processorLogger.WithPrefix("BuildLuaScript").WithField("inputLuaExpr", luaExpr) if a > b {
buildLuaScriptLogger.Debug("Building full Lua script from expression") return a
}
// Perform $var substitutions from globalVariables return b
luaExpr = replaceVariables(luaExpr)
luaExpr = PrependLuaAssignment(luaExpr)
fullScript := fmt.Sprintf(`
function run()
%s
end
local res = run()
modified = res == nil or res
`, luaExpr)
buildLuaScriptLogger.Trace("Generated full Lua script: %q", utils.LimitString(fullScript, 200))
return fullScript
} }
// BuildJSONLuaScript prepares a Lua expression for JSON mode // Min returns the minimum of two integers
func BuildJSONLuaScript(luaExpr string) string { func Min(a, b int) int {
buildJsonLuaScriptLogger := processorLogger.WithPrefix("BuildJSONLuaScript").WithField("inputLuaExpr", luaExpr) if a < b {
buildJsonLuaScriptLogger.Debug("Building full Lua script for JSON mode from expression") return a
// Perform $var substitutions from globalVariables
luaExpr = replaceVariables(luaExpr)
fullScript := fmt.Sprintf(`
function run()
%s
end
local res = run()
modified = res == nil or res
`, luaExpr)
buildJsonLuaScriptLogger.Trace("Generated full JSON Lua script: %q", utils.LimitString(fullScript, 200))
return fullScript
} }
return b
func replaceVariables(expr string) string {
// $varName -> literal value
varNameRe := regexp.MustCompile(`\$(\w+)`)
return varNameRe.ReplaceAllStringFunc(expr, func(m string) string {
name := varNameRe.FindStringSubmatch(m)[1]
if v, ok := globalVariables[name]; ok {
switch val := v.(type) {
case int, int64, float32, float64:
return fmt.Sprintf("%v", val)
case bool:
if val {
return "true"
} else {
return "false"
}
case string:
// Quote strings for Lua literal
return fmt.Sprintf("%q", val)
default:
return fmt.Sprintf("%q", fmt.Sprintf("%v", val))
}
}
return m
})
}
func printToGo(L *lua.LState) int {
printToGoLogger := processorLogger.WithPrefix("printToGo")
printToGoLogger.Debug("Lua print function called, redirecting to Go logger")
top := L.GetTop()
args := make([]interface{}, top)
for i := 1; i <= top; i++ {
args[i-1] = L.Get(i)
}
// Format the message with proper spacing between arguments
var parts []string
for _, arg := range args {
parts = append(parts, fmt.Sprintf("%v", arg))
}
message := strings.Join(parts, " ")
printToGoLogger.Trace("Lua print message: %q", message)
// Use the LUA log level with a script tag
logger.Lua("%s", message)
printToGoLogger.Debug("Message logged from Lua")
return 0
}
func fetch(L *lua.LState) int {
fetchLogger := processorLogger.WithPrefix("fetch")
fetchLogger.Debug("Lua fetch function called")
// Get URL from first argument
url := L.ToString(1)
if url == "" {
fetchLogger.Error("Fetch failed: URL is required")
L.Push(lua.LNil)
L.Push(lua.LString("URL is required"))
return 2
}
fetchLogger.Debug("Fetching URL: %q", url)
// Get options from second argument if provided
var method = "GET"
var headers = make(map[string]string)
var body = ""
if L.GetTop() > 1 {
options := L.ToTable(2)
if options != nil {
fetchLogger.Debug("Processing fetch options")
// Get method
if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
method = methodVal.String()
fetchLogger.Trace("Method from options: %q", method)
}
// Get headers
if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
if headersTable, ok := headersVal.(*lua.LTable); ok {
fetchLogger.Trace("Processing headers table")
headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
headers[key.String()] = value.String()
fetchLogger.Trace("Header: %q = %q", key.String(), value.String())
})
}
fetchLogger.Trace("All headers: %v", headers)
}
// Get body
if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
body = bodyVal.String()
fetchLogger.Trace("Body from options: %q", utils.LimitString(body, 100))
}
}
}
fetchLogger.Debug("Fetch request details: Method=%q, URL=%q, BodyLength=%d, Headers=%v", method, url, len(body), headers)
// Create HTTP request
req, err := http.NewRequest(method, url, strings.NewReader(body))
if err != nil {
fetchLogger.Error("Error creating HTTP request: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
return 2
}
// Set headers
for key, value := range headers {
req.Header.Set(key, value)
}
fetchLogger.Debug("HTTP request created and headers set")
fetchLogger.Trace("HTTP Request: %+v", req)
// Make request
client := &http.Client{}
resp, err := client.Do(req)
if err != nil {
fetchLogger.Error("Error making HTTP request: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
return 2
}
defer func() {
fetchLogger.Debug("Closing HTTP response body")
resp.Body.Close()
}()
fetchLogger.Debug("HTTP request executed. Status Code: %d", resp.StatusCode)
// Read response body
bodyBytes, err := io.ReadAll(resp.Body)
if err != nil {
fetchLogger.Error("Error reading response body: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
return 2
}
fetchLogger.Trace("Response body length: %d", len(bodyBytes))
// Create response table
responseTable := L.NewTable()
responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
responseTable.RawSetString("statusText", lua.LString(resp.Status))
responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
fetchLogger.Debug("Created Lua response table")
// Set headers in response
headersTable := L.NewTable()
for key, values := range resp.Header {
headersTable.RawSetString(key, lua.LString(values[0]))
fetchLogger.Trace("Response header: %q = %q", key, values[0])
}
responseTable.RawSetString("headers", headersTable)
fetchLogger.Trace("Full response table: %v", responseTable)
L.Push(responseTable)
fetchLogger.Debug("Pushed response table to Lua stack")
return 1
}
func EvalRegex(L *lua.LState) int {
evalRegexLogger := processorLogger.WithPrefix("evalRegex")
evalRegexLogger.Debug("Lua evalRegex function called")
pattern := L.ToString(1)
input := L.ToString(2)
evalRegexLogger.Debug("Pattern: %q, Input: %q", pattern, input)
re := regexp.MustCompile(pattern)
matches := re.FindStringSubmatch(input)
evalRegexLogger.Debug("Go regex matches: %v (count: %d)", matches, len(matches))
evalRegexLogger.Debug("Matches is nil: %t", matches == nil)
if len(matches) > 0 {
matchesTable := L.NewTable()
for i, match := range matches {
matchesTable.RawSetInt(i+1, lua.LString(match))
evalRegexLogger.Debug("Set table[%d] = %q", i+1, match)
}
L.Push(matchesTable)
} else {
L.Push(lua.LNil)
}
evalRegexLogger.Debug("Pushed matches table to Lua stack")
return 1
}
// GetLuaFunctionsHelp returns a comprehensive help string for all available Lua functions
func GetLuaFunctionsHelp() string {
return `Lua Functions Available in Global Environment:
MATH FUNCTIONS:
min(a, b) - Returns the minimum of two numbers
max(a, b) - Returns the maximum of two numbers
round(x, n) - Rounds x to n decimal places (default 0)
floor(x) - Returns the floor of x
ceil(x) - Returns the ceiling of x
STRING FUNCTIONS:
upper(s) - Converts string to uppercase
lower(s) - Converts string to lowercase
format(s, ...) - Formats string using Lua string.format
trim(s) - Removes leading/trailing whitespace
strsplit(inputstr, sep) - Splits string by separator (default: whitespace)
fromCSV(csv, delimiter, hasHeaders) - Parses CSV text into rows of fields (delimiter defaults to ",", hasHeaders defaults to false)
toCSV(rows, delimiter) - Converts table of rows to CSV text format (delimiter defaults to ",")
num(str) - Converts string to number (returns 0 if invalid)
str(num) - Converts number to string
is_number(str) - Returns true if string is numeric
TABLE FUNCTIONS:
dump(table, depth) - Prints table structure recursively
isArray(t) - Returns true if table is a sequential array
HTTP FUNCTIONS:
fetch(url, options) - Makes HTTP request, returns response table
options: {method="GET", headers={}, body=""}
returns: {status, statusText, ok, body, headers}
REGEX FUNCTIONS:
re(pattern, input) - Applies regex pattern to input string
returns: table with matches (index 0 = full match, 1+ = groups)
UTILITY FUNCTIONS:
print(...) - Prints arguments to Go logger
EXAMPLES:
round(3.14159, 2) -> 3.14
strsplit("a,b,c", ",") -> {"a", "b", "c"}
upper("hello") -> "HELLO"
min(5, 3) -> 3
num("123") -> 123
is_number("abc") -> false
fetch("https://api.example.com/data")
re("(\\w+)@(\\w+)", "user@domain.com") -> {"user@domain.com", "user", "domain.com"}`
} }

View File

@@ -1,147 +0,0 @@
package processor_test
import (
"testing"
"github.com/stretchr/testify/assert"
lua "github.com/yuin/gopher-lua"
"cook/processor"
)
// Happy Path: Function correctly returns all regex capture groups as Lua table when given valid pattern and input.
func TestEvalRegex_CaptureGroupsReturned(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `(\w+)-(\d+)`
input := "test-42"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
result := processor.EvalRegex(L)
assert.Equal(t, 1, result, "Expected return value to be 1 (one value pushed to Lua stack)")
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
expected := []string{"test-42", "test", "42"}
for i, v := range expected {
val := tbl.RawGetInt(i + 1)
assert.Equal(t, lua.LString(v), val, "Expected index %d to be %q", i+1, v)
}
}
// Happy Path: Function returns nil when regex pattern does not match input string.
func TestEvalRegex_NoMatchReturnsNil(t *testing.T) {
L := lua.NewState()
defer L.Close()
L.Push(lua.LString(`(foo)(bar)`))
L.Push(lua.LString("no-match-here"))
result := processor.EvalRegex(L)
assert.Equal(t, 1, result, "Expected return value to be 1 (one value pushed to Lua stack)")
out := L.Get(-1)
// Should be nil when no matches found
assert.Equal(t, lua.LNil, out, "Expected nil when no matches found")
}
// Happy Path: Function handles patterns with no capture groups by returning the full match in the Lua table.
func TestEvalRegex_NoCaptureGroups(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `foo\d+`
input := "foo123"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
result := processor.EvalRegex(L)
assert.Equal(t, 1, result, "Expected return value to be 1 (one value pushed to Lua stack)")
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
fullMatch := tbl.RawGetInt(1)
assert.Equal(t, lua.LString("foo123"), fullMatch)
// There should be only the full match (index 1)
count := 0
tbl.ForEach(func(k, v lua.LValue) {
count++
})
assert.Equal(t, 1, count)
}
// Edge Case: Function handles invalid regex pattern by letting regexp.MustCompile panic (which is expected behavior)
func TestEvalRegex_InvalidPattern(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `([a-z` // invalid regex
L.Push(lua.LString(pattern))
L.Push(lua.LString("someinput"))
// This should panic due to invalid regex pattern
assert.Panics(t, func() {
processor.EvalRegex(L)
}, "Expected panic for invalid regex pattern")
}
// Edge Case: Function returns nil when input string is empty and pattern doesn't match.
func TestEvalRegex_EmptyInputString(t *testing.T) {
L := lua.NewState()
defer L.Close()
L.Push(lua.LString(`(foo)`))
L.Push(lua.LString(""))
result := processor.EvalRegex(L)
assert.Equal(t, 1, result, "Expected return value to be 1 (one value pushed to Lua stack)")
out := L.Get(-1)
// Should be nil when no matches found
assert.Equal(t, lua.LNil, out, "Expected nil when input is empty and pattern doesn't match")
}
// Edge Case: Function handles nil or missing arguments gracefully without causing a runtime panic.
func TestEvalRegex_MissingArguments(t *testing.T) {
L := lua.NewState()
defer L.Close()
defer func() {
if r := recover(); r != nil {
t.Errorf("Did not expect panic when arguments are missing, got: %v", r)
}
}()
// No arguments pushed at all
processor.EvalRegex(L)
// Should just not match anything or produce empty table, but must not panic
}
func TestEvalComplexRegex(t *testing.T) {
// Test complex regex pattern with multiple capture groups
L := lua.NewState()
defer L.Close()
pattern := `^((Bulk_)?(Pistol|Rifle).*?Round.*?)$`
input := "Pistol_Round"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
processor.EvalRegex(L)
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
// Pattern should match: ["Pistol_Round", "Pistol_Round", "", "Pistol"]
// This creates 4 elements in the matches array, not 1
expectedCount := 4
actualCount := 0
tbl.ForEach(func(k, v lua.LValue) {
actualCount++
})
assert.Equal(t, expectedCount, actualCount, "Expected %d matches for pattern %q with input %q", expectedCount, pattern, input)
}

View File

@@ -1,108 +1,134 @@
package processor package processor
import ( import (
"cook/utils"
"fmt" "fmt"
"os"
"path/filepath"
"regexp" "regexp"
"strconv" "strconv"
"strings" "strings"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua" lua "github.com/yuin/gopher-lua"
) )
// regexLogger is a scoped logger for the processor/regex package. // RegexProcessor implements the Processor interface using regex patterns
var regexLogger = logger.Default.WithPrefix("processor/regex") type RegexProcessor struct{}
type CaptureGroup struct { // Process implements the Processor interface for RegexProcessor
Name string func (p *RegexProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
Value string // Read file content
Updated string fullPath := filepath.Join(".", filename)
Range [2]int content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
captures, ok := data.([]string)
if !ok {
return fmt.Errorf("expected []string for captures, got %T", data)
}
// Set variables for each capture group, starting from v1/s1 for the first capture
for i := 0; i < len(captures); i++ {
// Set string version (always available as s1, s2, etc.)
L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
// Try to convert to number and set v1, v2, etc.
if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
}
}
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Get the modified values after Lua execution
modifications := make(map[int]string)
// Check for modifications to v1-v12 and s1-s12
for i := 0; i < 12; i++ {
// Check both v and s variables to see if any were modified
vVarName := fmt.Sprintf("v%d", i+1)
sVarName := fmt.Sprintf("s%d", i+1)
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
// If our value is a number then it's very likely we want it to be a number
// And not a string
// If we do want it to be a string we will cast it into a string in lua
// wait that wouldn't work... Casting v to a string would not load it here
if vLuaVal.Type() == lua.LTNumber {
modifications[i] = vLuaVal.String()
continue
}
if sLuaVal.Type() == lua.LTString {
modifications[i] = sLuaVal.String()
continue
}
}
return modifications, nil
} }
// ProcessContent applies regex replacement with Lua processing // ProcessContent applies regex replacement with Lua processing
// The filename here exists ONLY so we can pass it to the lua environment func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// It's not used for anything else // Handle special pattern modifications
func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) { if !strings.HasPrefix(pattern, "(?s)") {
processRegexLogger := regexLogger.WithPrefix("ProcessRegex").WithField("commandName", command.Name).WithField("file", filename) pattern = "(?s)" + pattern
processRegexLogger.Debug("Starting regex processing for file") }
processRegexLogger.Trace("Initial file content length: %d", len(content))
processRegexLogger.Trace("Command details: %+v", command)
var commands []utils.ReplaceCommand
// Start timing the regex processing
startTime := time.Now()
// We don't HAVE to do this multiple times for a pattern
// But it's quick enough for us to not care
pattern := resolveRegexPlaceholders(command.Regex)
processRegexLogger.Debug("Resolved regex placeholders. Pattern: %s", pattern)
// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
// But it's a compromise that allows us to use | in yaml
// Otherwise we would have to escape every god damn pair of quotation marks
// And a bunch of other shit
pattern = strings.TrimSpace(pattern)
processRegexLogger.Debug("Trimmed regex pattern: %s", pattern)
patternCompileStart := time.Now()
compiledPattern, err := regexp.Compile(pattern) compiledPattern, err := regexp.Compile(pattern)
if err != nil { if err != nil {
processRegexLogger.Error("Error compiling pattern %q: %v", pattern, err) return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
return commands, fmt.Errorf("error compiling pattern: %v", err)
} }
processRegexLogger.Debug("Compiled pattern successfully in %v. Pattern: %s", time.Since(patternCompileStart), pattern)
// Same here, it's just string concatenation, it won't kill us previous := luaExpr
// More important is that we don't fuck up the command luaExpr = BuildLuaScript(luaExpr)
// But we shouldn't be able to since it's passed by value fmt.Printf("Changing Lua expression from: %s to: %s\n", previous, luaExpr)
previousLuaExpr := command.Lua
luaExpr := BuildLuaScript(command.Lua) L, err := NewLuaState()
processRegexLogger.Debug("Transformed Lua expression: %q → %q", previousLuaExpr, luaExpr) if err != nil {
processRegexLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200)) return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
// Initialize Lua environment
modificationCount := 0
// Process all regex matches // Process all regex matches
matchFindStart := time.Now() result := content
indices := compiledPattern.FindAllStringSubmatchIndex(content, -1) indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
matchFindDuration := time.Since(matchFindStart)
processRegexLogger.Debug("Found %d matches in content of length %d (search took %v)",
len(indices), len(content), matchFindDuration)
processRegexLogger.Trace("Match indices: %v", indices)
// Log pattern complexity metrics
patternComplexity := estimatePatternComplexity(pattern)
processRegexLogger.Debug("Pattern complexity estimate: %d", patternComplexity)
if len(indices) == 0 {
processRegexLogger.Warning("No matches found for regex: %s", pattern)
processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
// We walk backwards because we're replacing something with something else that might be longer // We walk backwards because we're replacing something with something else that might be longer
// And in the case it is longer than the original all indicces past that change will be fucked up // And in the case it is longer than the original all indicces past that change will be fucked up
// By going backwards we fuck up all the indices to the end of the file that we don't care about // By going backwards we fuck up all the indices to the end of the file that we don't care about
// Because there either aren't any (last match) or they're already modified (subsequent matches) // Because there either aren't any (last match) or they're already modified (subsequent matches)
for i, matchIndices := range indices { for i := len(indices) - 1; i >= 0; i-- {
matchLogger := processRegexLogger.WithField("matchNum", i+1) matchIndices := indices[i]
matchLogger.Debug("Processing match %d of %d", i+1, len(indices))
matchLogger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
L, err := NewLuaState()
if err != nil {
matchLogger.Error("Error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
}
L.SetGlobal("file", lua.LString(filename))
// Hmm... Maybe we don't want to defer this..
// Maybe we want to close them every iteration
// We'll leave it as is for now
defer L.Close()
matchLogger.Trace("Lua state created successfully for match %d", i+1)
// Why we're doing this whole song and dance of indices is to properly handle empty matches // Why we're doing this whole song and dance of indices is to properly handle empty matches
// Plus it's a little cleaner to surgically replace our matches // Plus it's a little cleaner to surgically replace our matches
// If we were to use string.replace and encountered an empty match there'd be nothing to replace // If we were to use string.replace and encountered an empty match there'd be nothing to replace
@@ -110,393 +136,61 @@ func ProcessRegex(content string, command utils.ModifyCommand, filename string)
// So when we're cutting open the array we say 0:7 + modified + 7:end // So when we're cutting open the array we say 0:7 + modified + 7:end
// As if concatenating in the middle of the array // As if concatenating in the middle of the array
// Plus it supports lookarounds // Plus it supports lookarounds
matchContent := content[matchIndices[0]:matchIndices[1]] match := content[matchIndices[0]:matchIndices[1]]
matchPreview := utils.LimitString(matchContent, 50)
matchLogger.Trace("Matched content: %q (length: %d)", matchPreview, len(matchContent))
groups := matchIndices[2:] groups := matchIndices[2:]
if len(groups) <= 0 { if len(groups) <= 0 {
matchLogger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern) fmt.Println("No capture groups for lua to chew on")
continue continue
} }
if len(groups)%2 == 1 { if len(groups)%2 == 1 {
matchLogger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups) fmt.Println("Odd number of indices of groups, what the fuck?")
continue continue
} }
// Count how many valid groups we have captures := make([]string, 0, len(groups)/2)
validGroups := 0
for j := 0; j < len(groups); j += 2 { for j := 0; j < len(groups); j += 2 {
if groups[j] != -1 && groups[j+1] != -1 { captures = append(captures, content[groups[j]:groups[j+1]])
validGroups++
} }
}
matchLogger.Debug("Found %d valid capture groups in match", validGroups)
for _, index := range groups { if err := p.ToLua(L, captures); err != nil {
if index == -1 { fmt.Println("Error setting Lua variables:", err)
matchLogger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
continue continue
} }
}
// We have to use array to preserve order
// Very important for the reconstruction step
// Because we must overwrite the values in reverse order
// See comments a few dozen lines above for more details
captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
groupNames := compiledPattern.SubexpNames()[1:]
for i, name := range groupNames {
start := groups[i*2]
end := groups[i*2+1]
if start == -1 || end == -1 {
matchLogger.Debug("Skipping empty or unmatched capture group #%d (name: %q)", i+1, name)
continue
}
value := content[start:end]
captureGroups = append(captureGroups, &CaptureGroup{
Name: name,
Value: value,
Range: [2]int{start, end},
})
// Include name info in log if available
if name != "" {
matchLogger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
} else {
matchLogger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
}
}
// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
if !command.NoDedup {
matchLogger.Debug("Deduplicating capture groups as specified in command settings")
captureGroups = deduplicateGroups(captureGroups)
matchLogger.Trace("Capture groups after deduplication: %v", captureGroups)
} else {
matchLogger.Debug("Skipping deduplication of capture groups (NoDedup is true)")
}
if err := toLua(L, captureGroups); err != nil {
matchLogger.Error("Failed to set Lua variables for capture groups: %v", err)
continue
}
matchLogger.Debug("Set %d capture groups as Lua variables", len(captureGroups))
matchLogger.Trace("Lua globals set for capture groups")
if err := L.DoString(luaExpr); err != nil { if err := L.DoString(luaExpr); err != nil {
matchLogger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v", fmt.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
err, utils.LimitString(luaExpr, 200), captureGroups)
continue continue
} }
matchLogger.Debug("Lua script executed successfully")
// Get modifications from Lua // Get modifications from Lua
updatedCaptureGroups, err := fromLua(L, captureGroups) modResult, err := p.FromLua(L)
if err != nil { if err != nil {
matchLogger.Error("Failed to retrieve modifications from Lua: %v", err) fmt.Println("Error getting modifications:", err)
continue continue
} }
matchLogger.Debug("Retrieved updated values from Lua")
matchLogger.Trace("Updated capture groups from Lua: %v", updatedCaptureGroups) // Apply modifications to the matched text
modsMap, ok := modResult.(map[int]string)
replacement := "" if !ok || len(modsMap) == 0 {
replacementVar := L.GetGlobal("replacement") fmt.Println("No modifications to apply")
if replacementVar.Type() != lua.LTNil {
replacement = replacementVar.String()
matchLogger.Debug("Using global replacement variable from Lua: %q", replacement)
}
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
matchLogger.Debug("Skipping match - no modifications indicated by Lua script")
continue continue
} }
if replacement == "" {
// Apply the modifications to the original match // Apply the modifications to the original match
replacement = matchContent replacement := match
for i := len(modsMap) - 1; i >= 0; i-- {
// Count groups that were actually modified newVal := modsMap[i]
modifiedGroupsCount := 0
for _, capture := range updatedCaptureGroups {
if capture.Value != capture.Updated {
modifiedGroupsCount++
}
}
matchLogger.Info("%d of %d capture groups identified for modification", modifiedGroupsCount, len(updatedCaptureGroups))
for _, capture := range updatedCaptureGroups {
if capture.Value == capture.Updated {
matchLogger.Debug("Capture group unchanged: %s", utils.LimitString(capture.Value, 50))
continue
}
// Log what changed with context
matchLogger.Debug("Capture group %q scheduled for modification: %q → %q",
capture.Name, utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
// Indices of the group are relative to content // Indices of the group are relative to content
// To relate them to match we have to subtract the match start index // To relate them to match we have to subtract the match start index
// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:] groupStart := groups[i*2] - matchIndices[0]
commands = append(commands, utils.ReplaceCommand{ groupEnd := groups[i*2+1] - matchIndices[0]
From: capture.Range[0], replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
To: capture.Range[1],
With: capture.Updated,
})
matchLogger.Trace("Added replacement command: %+v", commands[len(commands)-1])
}
} else {
matchLogger.Debug("Using full replacement string from Lua: %q", utils.LimitString(replacement, 50))
commands = append(commands, utils.ReplaceCommand{
From: matchIndices[0],
To: matchIndices[1],
With: replacement,
})
matchLogger.Trace("Added full replacement command: %+v", commands[len(commands)-1])
}
} }
processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime)) modificationCount++
processRegexLogger.Debug("Generated %d total modifications", len(commands)) result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
return commands, nil
} }
func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup { return result, modificationCount, len(indices), nil
deduplicateGroupsLogger := regexLogger.WithPrefix("deduplicateGroups")
deduplicateGroupsLogger.Debug("Starting deduplication of capture groups")
deduplicateGroupsLogger.Trace("Input capture groups: %v", captureGroups)
// Preserve input order and drop any group that overlaps with an already accepted group
accepted := make([]*CaptureGroup, 0, len(captureGroups))
for _, group := range captureGroups {
groupLogger := deduplicateGroupsLogger.WithField("groupName", group.Name).WithField("groupRange", group.Range)
groupLogger.Debug("Processing capture group")
overlaps := false
for _, kept := range accepted {
// Overlap if start < keptEnd and end > keptStart (adjacent is allowed)
if group.Range[0] < kept.Range[1] && group.Range[1] > kept.Range[0] {
overlaps = true
break
}
}
if overlaps {
groupLogger.Warning("Overlapping capture group detected and skipped.")
continue
}
groupLogger.Debug("Capture group does not overlap with previously accepted groups. Adding.")
accepted = append(accepted, group)
}
deduplicateGroupsLogger.Debug("Finished deduplication. Original %d groups, %d deduplicated.", len(captureGroups), len(accepted))
deduplicateGroupsLogger.Trace("Deduplicated groups: %v", accepted)
return accepted
}
// The order of these replaces is important
// This one handles !num-s inside of named capture groups
// If it were not here our !num in a named capture group would
// Expand to another capture group in the capture group
// We really only want one (our named) capture group
func resolveRegexPlaceholders(pattern string) string {
resolveLogger := regexLogger.WithPrefix("resolveRegexPlaceholders").WithField("originalPattern", utils.LimitString(pattern, 100))
resolveLogger.Debug("Resolving regex placeholders in pattern")
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
resolveLogger.Debug("Prepended '(?s)' to pattern for single-line mode")
}
namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
funcLogger := resolveLogger.WithPrefix("namedGroupNumReplace").WithField("match", utils.LimitString(match, 50))
funcLogger.Debug("Processing named group !num placeholder")
parts := namedGroupNum.FindStringSubmatch(match)
if len(parts) != 3 {
funcLogger.Warning("Unexpected number of submatches for namedGroupNum: %d. Returning original match.", len(parts))
return match
}
replacement := `-?\d*\.?\d+`
funcLogger.Trace("Replacing !num in named group with: %q", replacement)
return parts[1] + replacement
})
resolveLogger.Debug("Handled named group !num placeholders")
pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
resolveLogger.Debug("Replaced !num with numeric capture group")
pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
resolveLogger.Debug("Replaced !any with non-greedy wildcard")
pattern = strings.ReplaceAll(pattern, "\n", "\r?\n")
resolveLogger.Debug("Added optional carriage return support for Windows line endings")
repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
// !rep(pattern, count) repeats the pattern n times
// Inserting !any between each repetition
pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
funcLogger := resolveLogger.WithPrefix("repPatternReplace").WithField("match", utils.LimitString(match, 50))
funcLogger.Debug("Processing !rep placeholder")
parts := repPattern.FindStringSubmatch(match)
if len(parts) != 3 {
funcLogger.Warning("Unexpected number of submatches for repPattern: %d. Returning original match.", len(parts))
return match
}
repeatedPattern := parts[1]
countStr := parts[2]
repetitions, err := strconv.Atoi(countStr)
if err != nil {
funcLogger.Error("Failed to parse repetition count %q: %v. Returning original match.", countStr, err)
return match
}
var finalReplacement string
if repetitions > 0 {
finalReplacement = strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
} else {
finalReplacement = ""
}
funcLogger.Trace("Replaced !rep with %d repetitions of %q: %q", repetitions, utils.LimitString(repeatedPattern, 30), utils.LimitString(finalReplacement, 100))
return finalReplacement
})
resolveLogger.Debug("Handled !rep placeholders")
resolveLogger.Debug("Finished resolving regex placeholders")
resolveLogger.Trace("Final resolved pattern: %q", utils.LimitString(pattern, 100))
return pattern
}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func toLua(L *lua.LState, data interface{}) error {
toLuaLogger := regexLogger.WithPrefix("toLua")
toLuaLogger.Debug("Setting capture groups as Lua variables")
captureGroups, ok := data.([]*CaptureGroup)
if !ok {
toLuaLogger.Error("Invalid data type for toLua. Expected []*CaptureGroup, got %T", data)
return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
}
toLuaLogger.Trace("Input capture groups: %v", captureGroups)
groupindex := 0
for _, capture := range captureGroups {
groupLogger := toLuaLogger.WithField("captureGroup", capture.Name).WithField("value", utils.LimitString(capture.Value, 50))
groupLogger.Debug("Processing capture group for Lua")
if capture.Name == "" {
// We don't want to change the name of the capture group
// Even if it's empty
tempName := fmt.Sprintf("%d", groupindex+1)
groupindex++
groupLogger.Debug("Unnamed capture group, assigning temporary name: %q", tempName)
L.SetGlobal("s"+tempName, lua.LString(capture.Value))
groupLogger.Trace("Set Lua global s%s = %q", tempName, capture.Value)
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal("v"+tempName, lua.LNumber(val))
groupLogger.Trace("Set Lua global v%s = %f", tempName, val)
} else {
groupLogger.Trace("Value %q is not numeric, skipping v%s assignment", capture.Value, tempName)
}
} else {
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal(capture.Name, lua.LNumber(val))
groupLogger.Trace("Set Lua global %s = %f (numeric)", capture.Name, val)
} else {
L.SetGlobal(capture.Name, lua.LString(capture.Value))
groupLogger.Trace("Set Lua global %s = %q (string)", capture.Name, capture.Value)
}
}
}
toLuaLogger.Debug("Finished setting capture groups as Lua variables")
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
fromLuaLogger := regexLogger.WithPrefix("fromLua")
fromLuaLogger.Debug("Retrieving modifications from Lua for capture groups")
fromLuaLogger.Trace("Initial capture groups: %v", captureGroups)
captureIndex := 0
for _, capture := range captureGroups {
groupLogger := fromLuaLogger.WithField("originalCaptureName", capture.Name).WithField("originalValue", utils.LimitString(capture.Value, 50))
groupLogger.Debug("Processing capture group to retrieve updated value")
if capture.Name == "" {
// This case means it was an unnamed capture group originally.
// We need to reconstruct the original temporary name to fetch its updated value.
// The name will be set to an integer if it was empty, then incremented.
// So, we use the captureIndex to get the correct 'vX' and 'sX' variables.
tempName := fmt.Sprintf("%d", captureIndex+1)
groupLogger.Debug("Retrieving updated value for unnamed group (temp name: %q)", tempName)
vVarName := fmt.Sprintf("v%s", tempName)
sVarName := fmt.Sprintf("s%s", tempName)
captureIndex++
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
groupLogger.Trace("Lua values for unnamed group: v=%v, s=%v", vLuaVal, sLuaVal)
if sLuaVal.Type() == lua.LTString {
capture.Updated = sLuaVal.String()
groupLogger.Trace("Updated value from s%s (string): %q", tempName, capture.Updated)
}
// Numbers have priority
if vLuaVal.Type() == lua.LTNumber {
capture.Updated = vLuaVal.String()
groupLogger.Trace("Updated value from v%s (numeric): %q", tempName, capture.Updated)
}
} else {
// Easy shit, directly use the named capture group
updatedValue := L.GetGlobal(capture.Name)
if updatedValue.Type() != lua.LTNil {
capture.Updated = updatedValue.String()
groupLogger.Trace("Updated value for named group %q: %q", capture.Name, capture.Updated)
} else {
groupLogger.Debug("Named capture group %q not found in Lua globals or is nil. Keeping original value.", capture.Name)
capture.Updated = capture.Value // Keep original if not found or nil
}
}
groupLogger.Debug("Finished processing capture group. Original: %q, Updated: %q", utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
}
fromLuaLogger.Debug("Finished retrieving modifications from Lua")
fromLuaLogger.Trace("Final updated capture groups: %v", captureGroups)
return captureGroups, nil
}
// estimatePatternComplexity gives a rough estimate of regex pattern complexity
// This can help identify potentially problematic patterns
func estimatePatternComplexity(pattern string) int {
estimateComplexityLogger := regexLogger.WithPrefix("estimatePatternComplexity").WithField("pattern", utils.LimitString(pattern, 100))
estimateComplexityLogger.Debug("Estimating regex pattern complexity")
complexity := len(pattern)
// Add complexity for potentially expensive operations
complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
complexity += strings.Count(pattern, "[^") * 3 // Negated character class
complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
complexity += strings.Count(pattern, "(") * 2 // Capture groups
complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
complexity += strings.Count(pattern, "{") * 2 // Counted repetition
estimateComplexityLogger.Debug("Estimated pattern complexity: %d", complexity)
return complexity
} }

File diff suppressed because it is too large Load Diff

View File

@@ -1,847 +0,0 @@
package processor
import (
"cook/utils"
"testing"
"github.com/google/go-cmp/cmp"
)
func TestSurgicalJSONEditing(t *testing.T) {
tests := []struct {
name string
content string
luaCode string
expected string
}{
{
name: "Modify single field",
content: `{
"name": "test",
"value": 42,
"description": "original"
}`,
luaCode: `
data.value = 84
modified = true
`,
expected: `{
"name": "test",
"value": 84,
"description": "original"
}`,
},
{
name: "Add new field",
content: `{
"name": "test",
"value": 42
}`,
luaCode: `
data.newField = "added"
modified = true
`,
expected: `{
"name": "test",
"value": 42
,"newField": "added"}`, // sjson.Set() adds new fields in compact format
},
{
name: "Modify nested field",
content: `{
"config": {
"settings": {
"enabled": false,
"timeout": 30
}
}
}`,
luaCode: `
data.config.settings.enabled = true
data.config.settings.timeout = 60
modified = true
`,
expected: `{
"config": {
"settings": {
"enabled": true,
"timeout": 60
}
}
}`,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
command := utils.ModifyCommand{
Name: "test",
Lua: tt.luaCode,
}
commands, err := ProcessJSON(tt.content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := tt.content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, tt.expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
// Check the actual result matches expected
if result != tt.expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", tt.expected, result)
}
})
}
}
func TestSurgicalJSONPreservesFormatting(t *testing.T) {
// Test that surgical editing preserves the original formatting structure
content := `{
"Defaults": {
"Behaviour": "None",
"Description": "",
"DisplayName": "",
"FlavorText": "",
"Icon": "None",
"MaxStack": 1,
"Override_Glow_Icon": "None",
"Weight": 0,
"bAllowZeroWeight": false
},
"RowStruct": "/Script/Icarus.ItemableData",
"Rows": [
{
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"MaxStack": 1000000,
"Name": "Item_Fiber",
"Weight": 10
}
]
}`
expected := `{
"Defaults": {
"Behaviour": "None",
"Description": "",
"DisplayName": "",
"FlavorText": "",
"Icon": "None",
"MaxStack": 1,
"Override_Glow_Icon": "None",
"Weight": 0,
"bAllowZeroWeight": false
},
"RowStruct": "/Script/Icarus.ItemableData",
"Rows": [
{
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"MaxStack": 1000000,
"Name": "Item_Fiber",
"Weight": 500
}
]
}`
command := utils.ModifyCommand{
Name: "test",
Lua: `
-- Modify the weight of the first item
data.Rows[1].Weight = 500
modified = true
`,
}
commands, err := ProcessJSON(content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
// Check that the result matches expected (preserves formatting and changes weight)
if result != expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
}
}
func TestSurgicalJSONPreservesFormatting2(t *testing.T) {
// Test that surgical editing preserves the original formatting structure
content := `
{
"RowStruct": "/Script/Icarus.ProcessorRecipe",
"Defaults": {
"bForceDisableRecipe": false,
"Requirement": {
"RowName": "None",
"DataTableName": "D_Talents"
},
"SessionRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"CharacterRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"RequiredMillijoules": 2500,
"RecipeSets": [],
"ResourceCostMultipliers": [],
"Inputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Container": {
"Value": "None"
},
"ResourceInputs": [],
"bSelectOutputItemRandomly": false,
"bContainsContainer": false,
"ItemIconOverride": {
"ItemStaticData": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"ItemDynamicData": [],
"ItemCustomStats": [],
"CustomProperties": {
"StaticWorldStats": [],
"StaticWorldHeldStats": [],
"Stats": [],
"Alterations": [],
"LivingItemSlots": []
},
"DatabaseGUID": "",
"ItemOwnerLookupId": -1,
"RuntimeTags": {
"GameplayTags": []
}
},
"Outputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemTemplate"
},
"Count": 1,
"DynamicProperties": []
}
],
"ResourceOutputs": [],
"Refundable": "Inherit",
"ExperienceMultiplier": 1,
"Audio": {
"RowName": "None",
"DataTableName": "D_CraftingAudioData"
}
},
"Rows": [
{
"Name": "Biofuel1",
"RecipeSets": [
{
"RowName": "Composter",
"DataTableName": "D_RecipeSets"
}
],
"Inputs": [
{
"Element": {
"RowName": "Raw_Meat",
"DataTableName": "D_ItemsStatic"
},
"Count": 2,
"DynamicProperties": []
},
{
"Element": {
"RowName": "Tree_Sap",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Outputs": [],
"Audio": {
"RowName": "Composter"
},
"ResourceOutputs": [
{
"Type": {
"Value": "Biofuel"
},
"RequiredUnits": 100
}
]
}
]
}
`
expected := `
{
"RowStruct": "/Script/Icarus.ProcessorRecipe",
"Defaults": {
"bForceDisableRecipe": false,
"Requirement": {
"RowName": "None",
"DataTableName": "D_Talents"
},
"SessionRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"CharacterRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"RequiredMillijoules": 2500,
"RecipeSets": [],
"ResourceCostMultipliers": [],
"Inputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Container": {
"Value": "None"
},
"ResourceInputs": [],
"bSelectOutputItemRandomly": false,
"bContainsContainer": false,
"ItemIconOverride": {
"ItemStaticData": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"ItemDynamicData": [],
"ItemCustomStats": [],
"CustomProperties": {
"StaticWorldStats": [],
"StaticWorldHeldStats": [],
"Stats": [],
"Alterations": [],
"LivingItemSlots": []
},
"DatabaseGUID": "",
"ItemOwnerLookupId": -1,
"RuntimeTags": {
"GameplayTags": []
}
},
"Outputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemTemplate"
},
"Count": 1,
"DynamicProperties": []
}
],
"ResourceOutputs": [],
"Refundable": "Inherit",
"ExperienceMultiplier": 1,
"Audio": {
"RowName": "None",
"DataTableName": "D_CraftingAudioData"
}
},
"Rows": [
{
"Name": "Biofuel1",
"RecipeSets": [
{
"RowName": "Composter",
"DataTableName": "D_RecipeSets"
}
],
"Inputs": [
{
"Element": {
"RowName": "Raw_Meat",
"DataTableName": "D_ItemsStatic"
},
"Count": 2,
"DynamicProperties": []
}
],
"Outputs": [],
"Audio": {
"RowName": "Composter"
},
"ResourceOutputs": [
{
"Type": {
"Value": "Biofuel"
},
"RequiredUnits": 100
}
]
}
]
}
`
command := utils.ModifyCommand{
Name: "test",
Lua: `
-- Define regex patterns for matching recipe names
local function matchesPattern(name, pattern)
local matches = re(pattern, name)
-- Check if matches table has any content (index 0 or 1 should exist if there's a match)
return matches and (matches[0] or matches[1])
end
-- Selection pattern for recipes that get multiplied
local selectionPattern = "(?-s)(Bulk_)?(Pistol|Rifle).*?Round.*?|(Carbon|Composite)_Paste.*|(Gold|Copper)_Wire|(Ironw|Copper)_Nail|(Platinum|Steel|Cold_Steel|Titanium)_Ingot|.*?Shotgun_Shell.*?|.*_Arrow|.*_Bolt|.*_Fertilizer_?\\d*|.*_Grenade|.*_Pill|.*_Tonic|Aluminum|Ammo_Casing|Animal_Fat|Carbon_Fiber|Composites|Concrete_Mix|Cured_Leather_?\\d?|Electronics|Epoxy_?\\d?|Glass\\d?|Gunpowder\\w*|Health_.*|Titanium_Plate|Organic_Resin|Platinum_Sheath|Refined_[a-zA-Z]+|Rope|Shotgun_Casing|Steel_Bloom\\d?|Tree_Sap\\w*"
-- Ingot pattern for recipes that get count set to 1
local ingotPattern = "(?-s)(Platinum|Steel|Cold_Steel|Titanium)_Ingot|Aluminum|Refined_[a-zA-Z]+|Glass\\d?"
local factor = 16
local bonus = 0.5
for _, row in ipairs(data.Rows) do
local recipeName = row.Name
-- Special case: Biofuel recipes - remove Tree_Sap input
if string.find(recipeName, "Biofuel") then
if row.Inputs then
for i = #row.Inputs, 1, -1 do
local input = row.Inputs[i]
if input.Element and input.Element.RowName and string.find(input.Element.RowName, "Tree_Sap") then
table.remove(row.Inputs, i)
print("Removing input 'Tree_Sap' from processor recipe '" .. recipeName .. "'")
end
end
end
end
-- Ingot recipes: set input and output counts to 1
if matchesPattern(recipeName, ingotPattern) then
if row.Inputs then
for _, input in ipairs(row.Inputs) do
input.Count = 1
end
end
if row.Outputs then
for _, output in ipairs(row.Outputs) do
output.Count = 1
end
end
end
-- Selected recipes: multiply inputs by factor, outputs by factor * (1 + bonus)
if matchesPattern(recipeName, selectionPattern) then
if row.Inputs then
for _, input in ipairs(row.Inputs) do
local oldCount = input.Count
input.Count = input.Count * factor
print("Recipe " .. recipeName .. " Input.Count: " .. oldCount .. " -> " .. input.Count)
end
end
if row.Outputs then
for _, output in ipairs(row.Outputs) do
local oldCount = output.Count
output.Count = math.floor(output.Count * factor * (1 + bonus))
print("Recipe " .. recipeName .. " Output.Count: " .. oldCount .. " -> " .. output.Count)
end
end
end
end
`,
}
commands, err := ProcessJSON(content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
// Check that the result matches expected (preserves formatting and changes weight)
if result != expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
}
}
func TestRetardedJSONEditing(t *testing.T) {
original := `{
"RowStruct": "/Script/Icarus.ItemableData",
"Defaults": {
"Behaviour": "None",
"DisplayName": "",
"Icon": "None",
"Override_Glow_Icon": "None",
"Description": "",
"FlavorText": "",
"Weight": 0,
"bAllowZeroWeight": false,
"MaxStack": 1
},
"Rows": [
{
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Weight": 10,
"MaxStack": 200,
"Name": "Item_Fiber"
}
]
}`
expected := `{
"RowStruct": "/Script/Icarus.ItemableData",
"Defaults": {
"Behaviour": "None",
"DisplayName": "",
"Icon": "None",
"Override_Glow_Icon": "None",
"Description": "",
"FlavorText": "",
"Weight": 0,
"bAllowZeroWeight": false,
"MaxStack": 1
},
"Rows": [
{
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Weight": 10,
"MaxStack": 1000000,
"Name": "Item_Fiber"
}
]
}`
command := utils.ModifyCommand{
Name: "test",
Lua: `
for _, row in ipairs(data.Rows) do
if row.MaxStack then
if string.find(row.Name, "Carrot") or string.find(row.Name, "Potato") then
row.MaxStack = 25
else
row.MaxStack = row.MaxStack * 10000
if row.MaxStack > 1000000 then
row.MaxStack = 1000000
end
end
end
end
`,
}
commands, err := ProcessJSON(original, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := original
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
// Check that the weight was changed
if result != expected {
t.Errorf("Expected:\n%s\nGot:\n%s", expected, result)
}
}
func TestRetardedJSONEditing2(t *testing.T) {
original := `
{
"Rows": [
{
"Name": "Deep_Mining_Drill_Biofuel",
"Meshable": {
"RowName": "Mesh_Deep_Mining_Drill_Biofuel"
},
"Itemable": {
"RowName": "Item_Deep_Mining_Drill_Biofuel"
},
"Interactable": {
"RowName": "Deployable"
},
"Focusable": {
"RowName": "Focusable_1H"
},
"Highlightable": {
"RowName": "Generic"
},
"Actionable": {
"RowName": "Deployable"
},
"Usable": {
"RowName": "Place"
},
"Deployable": {
"RowName": "Deep_Mining_Drill_Biofuel"
},
"Durable": {
"RowName": "Deployable_750"
},
"Inventory": {
"RowName": "Deep_Mining_Drill_Biofuel"
},
"Decayable": {
"RowName": "Decay_MetaItem"
},
"Generator": {
"RowName": "Deep_Mining_Biofuel_Drill"
},
"Resource": {
"RowName": "Simple_Internal_Flow_Only"
},
"Manual_Tags": {
"GameplayTags": [
{
"TagName": "Item.Machine"
}
]
},
"Generated_Tags": {
"GameplayTags": [
{
"TagName": "Item.Machine"
},
{
"TagName": "Traits.Meshable"
},
{
"TagName": "Traits.Itemable"
},
{
"TagName": "Traits.Interactable"
},
{
"TagName": "Traits.Highlightable"
},
{
"TagName": "Traits.Actionable"
},
{
"TagName": "Traits.Usable"
},
{
"TagName": "Traits.Deployable"
},
{
"TagName": "Traits.Durable"
},
{
"TagName": "Traits.Inventory"
}
],
"ParentTags": []
}
}
]
}
`
expected := `
{
"Rows": [
{
"Name": "Deep_Mining_Drill_Biofuel",
"Meshable": {
"RowName": "Mesh_Deep_Mining_Drill_Biofuel"
},
"Itemable": {
"RowName": "Item_Deep_Mining_Drill_Biofuel"
},
"Interactable": {
"RowName": "Deployable"
},
"Focusable": {
"RowName": "Focusable_1H"
},
"Highlightable": {
"RowName": "Generic"
},
"Actionable": {
"RowName": "Deployable"
},
"Usable": {
"RowName": "Place"
},
"Deployable": {
"RowName": "Deep_Mining_Drill_Biofuel"
},
"Durable": {
"RowName": "Deployable_750"
},
"Inventory": {
"RowName": "Deep_Mining_Drill_Biofuel"
},
"Decayable": {
"RowName": "Decay_MetaItem"
},
"Generator": {
"RowName": "Deep_Mining_Biofuel_Drill"
},
"Resource": {
"RowName": "Simple_Internal_Flow_Only"
},
"Manual_Tags": {
"GameplayTags": [
{
"TagName": "Item.Machine"
}
]
},
"Generated_Tags": {
"GameplayTags": [
{
"TagName": "Item.Machine"
},
{
"TagName": "Traits.Meshable"
},
{
"TagName": "Traits.Itemable"
},
{
"TagName": "Traits.Interactable"
},
{
"TagName": "Traits.Highlightable"
},
{
"TagName": "Traits.Actionable"
},
{
"TagName": "Traits.Usable"
},
{
"TagName": "Traits.Deployable"
},
{
"TagName": "Traits.Durable"
},
{
"TagName": "Traits.Inventory"
}
],
"ParentTags": []
}
,"AdditionalStats": {"(Value=\"BaseDeepMiningDrillSpeed_+%\")":4000}}
]
}
`
command := utils.ModifyCommand{
Name: "test",
Lua: `
for i, row in ipairs(data.Rows) do
-- Special case: Deep_Mining_Drill_Biofuel
if string.find(row.Name, "Deep_Mining_Drill_Biofuel") then
print("[DEBUG] Special case: Deep_Mining_Drill_Biofuel")
if not row.AdditionalStats then
print("[DEBUG] Creating AdditionalStats table for Deep_Mining_Drill_Biofuel")
row.AdditionalStats = {}
end
print("[DEBUG] Setting BaseDeepMiningDrillSpeed_+% to 4000")
row.AdditionalStats["(Value=\\\"BaseDeepMiningDrillSpeed_+%\\\")"] = 4000
end
end
`,
}
commands, err := ProcessJSON(original, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := original
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
if result != expected {
t.Errorf("Expected:\n%s\nGot:\n%s", expected, result)
}
}

View File

@@ -1,27 +0,0 @@
package processor
import (
"io"
"os"
logger "git.site.quack-lab.dev/dave/cylogger"
)
func init() {
// Only modify logger in test mode
// This checks if we're running under 'go test'
if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
// Initialize logger with ERROR level for tests
// to minimize noise in test output
logger.Init(logger.LevelError)
// Optionally redirect logger output to discard
// This prevents logger output from interfering with test output
disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
if disableTestLogs {
// Create a new logger that writes to nowhere
silentLogger := logger.New(io.Discard, "", 0)
logger.Default = silentLogger
}
}
}

217
processor/xml.go Normal file
View File

@@ -0,0 +1,217 @@
package processor
import (
"fmt"
"os"
"path/filepath"
"strings"
"github.com/antchfx/xmlquery"
lua "github.com/yuin/gopher-lua"
)
// XMLProcessor implements the Processor interface for XML documents
type XMLProcessor struct{}
// Process implements the Processor interface for XMLProcessor
func (p *XMLProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
// Read file content
fullPath := filepath.Join(".", filename)
content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ProcessContent implements the Processor interface for XMLProcessor
func (p *XMLProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse XML document
doc, err := xmlquery.Parse(strings.NewReader(content))
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
}
// Find nodes matching the XPath pattern
nodes, err := xmlquery.QueryAll(doc, pattern)
if err != nil {
return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
// Initialize Lua
L := lua.NewState()
defer L.Close()
// Load math library
L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil {
return content, 0, 0, fmt.Errorf("error loading Lua math library: %v", err)
}
// Load helper functions
if err := InitLuaHelpers(L); err != nil {
return content, 0, 0, err
}
// Apply modifications to each node
modCount := 0
for _, node := range nodes {
// Reset Lua state for each node
L.SetGlobal("v1", lua.LNil)
L.SetGlobal("s1", lua.LNil)
// Get the node value
var originalValue string
if node.Type == xmlquery.AttributeNode {
originalValue = node.InnerText()
} else if node.Type == xmlquery.TextNode {
originalValue = node.Data
} else {
originalValue = node.InnerText()
}
// Convert to Lua variables
err = p.ToLua(L, originalValue)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
}
// Execute Lua script
if err := L.DoString(luaExpr); err != nil {
return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
}
// Get modified value
result, err := p.FromLua(L)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
}
newValue, ok := result.(string)
if !ok {
return content, modCount, matchCount, fmt.Errorf("expected string result from Lua, got %T", result)
}
// Skip if no change
if newValue == originalValue {
continue
}
// Apply modification
if node.Type == xmlquery.AttributeNode {
// For attribute nodes, update the attribute value
node.Parent.Attr = append([]xmlquery.Attr{}, node.Parent.Attr...)
for i, attr := range node.Parent.Attr {
if attr.Name.Local == node.Data {
node.Parent.Attr[i].Value = newValue
break
}
}
} else if node.Type == xmlquery.TextNode {
// For text nodes, update the text content
node.Data = newValue
} else {
// For element nodes, replace inner text
// Simple approach: set the InnerText directly if there are no child elements
if node.FirstChild == nil || (node.FirstChild != nil && node.FirstChild.Type == xmlquery.TextNode && node.FirstChild.NextSibling == nil) {
if node.FirstChild != nil {
node.FirstChild.Data = newValue
} else {
// Create a new text node and add it as the first child
textNode := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: newValue,
}
node.FirstChild = textNode
}
} else {
// Complex case: node has mixed content or child elements
// Replace just the text content while preserving child elements
// This is a simplified approach - more complex XML may need more robust handling
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type == xmlquery.TextNode {
child.Data = newValue
break // Update only the first text node
}
}
}
}
modCount++
}
// Serialize the modified XML document to string
if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
// If we have an XML declaration, start with it
declaration := doc.FirstChild.OutputXML(true)
// Remove the firstChild (declaration) before serializing the rest of the document
doc.FirstChild = doc.FirstChild.NextSibling
return declaration + doc.OutputXML(true), modCount, matchCount, nil
}
return doc.OutputXML(true), modCount, matchCount, nil
}
// ToLua converts XML node values to Lua variables
func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
value, ok := data.(string)
if !ok {
return fmt.Errorf("expected string value, got %T", data)
}
// Set as string variable
L.SetGlobal("s1", lua.LString(value))
// Try to convert to number if possible
L.SetGlobal("v1", lua.LNumber(0)) // Default to 0
if err := L.DoString(fmt.Sprintf("v1 = tonumber(%q) or 0", value)); err != nil {
return fmt.Errorf("error converting value to number: %v", err)
}
return nil
}
// FromLua gets modified values from Lua
func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Check if string variable was modified
s1 := L.GetGlobal("s1")
if s1 != lua.LNil {
if s1Str, ok := s1.(lua.LString); ok {
return string(s1Str), nil
}
}
// Check if numeric variable was modified
v1 := L.GetGlobal("v1")
if v1 != lua.LNil {
if v1Num, ok := v1.(lua.LNumber); ok {
return fmt.Sprintf("%v", v1Num), nil
}
}
// Default return empty string
return "", nil
}

1532
processor/xml_test.go Normal file

File diff suppressed because it is too large Load Diff

View File

@@ -1,137 +0,0 @@
package regression
import (
"cook/processor"
"cook/utils"
"os"
"path/filepath"
"testing"
)
func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
command := utils.ModifyCommand{
Regex: regex,
Lua: lua,
LogLevel: "TRACE",
}
commands, err := processor.ProcessRegex(content, command, "test")
if err != nil {
return "", 0, 0, err
}
result, modifications := utils.ExecuteModifications(commands, content)
return result, modifications, len(commands), nil
}
func TestTalentsMechanicOutOfRange(t *testing.T) {
given := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
actual := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="30" color="gui.green"/>
<Replace tag="[duration]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="20"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
if matches != 4 {
t.Errorf("Expected 4 matches, got %d", matches)
}
if mods != 4 {
t.Errorf("Expected 4 modifications, got %d", mods)
}
if result != actual {
t.Errorf("expected %s, got %s", actual, result)
}
}
func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
cwd, err := os.Getwd()
if err != nil {
t.Fatalf("Error getting current working directory: %v", err)
}
given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
// We don't really care how many god damn matches there are as long as the result is correct
// if matches != 45 {
// t.Errorf("Expected 45 match, got %d", matches)
// }
//
// if mods != 45 {
// t.Errorf("Expected 45 modification, got %d", mods)
// }
if string(result) != string(expected) {
t.Errorf("expected %s, got %s", expected, result)
}
}

View File

@@ -1,49 +0,0 @@
#!/bin/bash
echo "Figuring out the tag..."
TAG=$(git describe --tags --exact-match 2>/dev/null || echo "")
if [ -z "$TAG" ]; then
# Get the latest tag
LATEST_TAG=$(git describe --tags $(git rev-list --tags --max-count=1))
# Increment the patch version
IFS='.' read -r -a VERSION_PARTS <<< "$LATEST_TAG"
VERSION_PARTS[2]=$((VERSION_PARTS[2]+1))
TAG="${VERSION_PARTS[0]}.${VERSION_PARTS[1]}.${VERSION_PARTS[2]}"
# Create a new tag
git tag $TAG
git push origin $TAG
fi
echo "Tag: $TAG"
echo "Building the thing..."
go build -o chef.exe .
go install .
echo "Creating a release..."
TOKEN="$GITEA_API_KEY"
GITEA="https://git.site.quack-lab.dev"
REPO="dave/BigChef"
# Create a release
RELEASE_RESPONSE=$(curl -s -X POST \
-H "Authorization: token $TOKEN" \
-H "Accept: application/json" \
-H "Content-Type: application/json" \
-d '{
"tag_name": "'"$TAG"'",
"name": "'"$TAG"'",
"draft": false,
"prerelease": false
}' \
$GITEA/api/v1/repos/$REPO/releases)
# Extract the release ID
echo $RELEASE_RESPONSE
RELEASE_ID=$(echo $RELEASE_RESPONSE | awk -F'"id":' '{print $2+0; exit}')
echo "Release ID: $RELEASE_ID"
echo "Uploading the things..."
curl -X POST \
-H "Authorization: token $TOKEN" \
-F "attachment=@chef.exe" \
"$GITEA/api/v1/repos/$REPO/releases/${RELEASE_ID}/assets?name=chef.exe"
rm chef.exe

1
test.xml Normal file
View File

@@ -0,0 +1 @@
<config><item><value>100</value></item></config>

12
test_complex.xml Normal file
View File

@@ -0,0 +1,12 @@
<config>
<item>
<value>75</value>
<multiplier>2</multiplier>
<divider>4</divider>
</item>
<item>
<value>150</value>
<multiplier>3</multiplier>
<divider>2</divider>
</item>
</config>

37
test_data.xml Normal file
View File

@@ -0,0 +1,37 @@
<?xml version="1.0" encoding="UTF-8"?>
<testdata>
<!-- Numeric values -->
<item>
<id>1</id>
<value>200</value>
<price>24.99</price>
<quantity>5</quantity>
</item>
<!-- Text values -->
<item>
<id>2</id>
<name>Test Product</name>
<description>This is a test product description</description>
<category>Test</category>
</item>
<!-- Mixed content -->
<item>
<id>3</id>
<name>Mixed Product</name>
<price>19.99</price>
<code>PRD-123</code>
<tags>sale,discount,new</tags>
</item>
<!-- Empty and special values -->
<item>
<id>4</id>
<value></value>
<specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
<multiline>Line 1
Line 2
Line 3</multiline>
</item>
</testdata>

View File

@@ -1,11 +0,0 @@
- name: SurgicalWeightTest
json: true
lua: |
-- This demonstrates surgical JSON editing
-- Only the Weight field of Item_Fiber will be modified
data.Rows[1].Weight = 999
modified = true
files:
- 'D_Itemable.json'
reset: false
loglevel: INFO

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -0,0 +1 @@
<config><item><value>100</value></item></config>

View File

@@ -1,511 +0,0 @@
package main
import (
"os"
"path/filepath"
"testing"
"cook/utils"
"github.com/stretchr/testify/assert"
)
func TestTOMLLoadBasic(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-basic-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create a simple TOML test file
tomlContent := `[[commands]]
name = "SimpleTest"
regex = "test = !num"
lua = "v1 * 2"
files = ["test.txt"]
[[commands]]
name = "AnotherTest"
regex = "value = (!num)"
lua = "v1 + 10"
files = ["*.txt"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 2, "Should load 2 commands from TOML")
// Verify first command
assert.Equal(t, "SimpleTest", commands[0].Name, "First command name should match")
assert.Equal(t, "test = !num", commands[0].Regex, "First command regex should match")
assert.Equal(t, "v1 * 2", commands[0].Lua, "First command Lua should match")
assert.Equal(t, []string{"test.txt"}, commands[0].Files, "First command files should match")
// Verify second command
assert.Equal(t, "AnotherTest", commands[1].Name, "Second command name should match")
assert.Equal(t, "value = (!num)", commands[1].Regex, "Second command regex should match")
assert.Equal(t, "v1 + 10", commands[1].Lua, "Second command Lua should match")
assert.Equal(t, []string{"*.txt"}, commands[1].Files, "Second command files should match")
}
func TestTOMLGlobalModifiers(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-global-modifiers-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create TOML content with global modifiers
tomlContent := `[[commands]]
modifiers = { multiplier = 3, prefix = "TEST_", enabled = true }
[[commands]]
name = "UseGlobalModifiers"
regex = "value = !num"
lua = "v1 * multiplier; s1 = prefix .. s1"
files = ["test.txt"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 2, "Should load 2 commands from TOML")
// Verify global modifiers command (first command should have only modifiers)
assert.Empty(t, commands[0].Name, "Global modifiers command should have no name")
assert.Empty(t, commands[0].Regex, "Global modifiers command should have no regex")
assert.Empty(t, commands[0].Lua, "Global modifiers command should have no lua")
assert.Empty(t, commands[0].Files, "Global modifiers command should have no files")
assert.Len(t, commands[0].Modifiers, 3, "Global modifiers command should have 3 modifiers")
assert.Equal(t, int64(3), commands[0].Modifiers["multiplier"], "Multiplier should be 3")
assert.Equal(t, "TEST_", commands[0].Modifiers["prefix"], "Prefix should be TEST_")
assert.Equal(t, true, commands[0].Modifiers["enabled"], "Enabled should be true")
// Verify regular command
assert.Equal(t, "UseGlobalModifiers", commands[1].Name, "Regular command name should match")
assert.Equal(t, "value = !num", commands[1].Regex, "Regular command regex should match")
}
func TestTOMLMultilineRegex(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-multiline-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create TOML content with multiline regex using literal strings
tomlContent := `[[commands]]
modifiers = { factor = 2.5 }
[[commands]]
name = "MultilineTest"
regex = '''
\[config\.settings\]
depth = !num
width = !num
height = !num'''
lua = "v1 * factor"
files = ["test.conf"]
isolate = true
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Create test file that matches the multiline pattern
testContent := `[config.settings]
depth = 10
width = 20
height = 30
`
testFile := filepath.Join(tmpDir, "test.conf")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 2, "Should load 2 commands from TOML")
// Verify the multiline regex command
multilineCmd := commands[1]
assert.Equal(t, "MultilineTest", multilineCmd.Name, "Command name should match")
assert.Contains(t, multilineCmd.Regex, "\\[config\\.settings\\]", "Regex should contain escaped brackets")
assert.Contains(t, multilineCmd.Regex, "depth = !num", "Regex should contain depth pattern")
assert.Contains(t, multilineCmd.Regex, "width = !num", "Regex should contain width pattern")
assert.Contains(t, multilineCmd.Regex, "height = !num", "Regex should contain height pattern")
assert.Contains(t, multilineCmd.Regex, "\n", "Regex should contain newlines")
assert.True(t, multilineCmd.Isolate, "Isolate should be true")
// Verify the regex preserves proper structure
expectedLines := []string{
"\\[config\\.settings\\]",
"depth = !num",
"width = !num",
"height = !num",
}
for _, line := range expectedLines {
assert.Contains(t, multilineCmd.Regex, line, "Regex should contain: "+line)
}
}
func TestTOMLComplexRegexPatterns(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-complex-regex-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create TOML content with complex regex patterns
tomlContent := `[[commands]]
name = "ComplexPatterns"
regexes = [
"\\[section\\.([^\\]]+)\\]",
"(?P<key>\\w+)\\s*=\\s*(?P<value>\\d+\\.\\d+)",
"network\\.(\\w+)\\.(enable|disable)"
]
lua = "if is_number(value) then value = num(value) * 1.1 end; return true"
files = ["*.conf", "*.ini"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 1, "Should load 1 command from TOML")
// Verify the complex regex command
cmd := commands[0]
assert.Equal(t, "ComplexPatterns", cmd.Name, "Command name should match")
assert.Len(t, cmd.Regexes, 3, "Should have 3 regex patterns")
// Verify each regex pattern
assert.Equal(t, `\[section\.([^\]]+)\]`, cmd.Regexes[0], "First regex should match section pattern")
assert.Equal(t, `(?P<key>\w+)\s*=\s*(?P<value>\d+\.\d+)`, cmd.Regexes[1], "Second regex should match key-value pattern")
assert.Equal(t, `network\.(\w+)\.(enable|disable)`, cmd.Regexes[2], "Third regex should match network pattern")
assert.Equal(t, []string{"*.conf", "*.ini"}, cmd.Files, "Files should match")
}
func TestTOMLJSONMode(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-json-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create TOML content with JSON mode commands
tomlContent := `[[commands]]
name = "JSONMultiply"
json = true
lua = "for i, item in ipairs(data.items) do data.items[i].value = item.value * 2 end; return true"
files = ["data.json"]
[[commands]]
name = "JSONObjectUpdate"
json = true
lua = "data.version = '2.0.0'; data.enabled = true; return true"
files = ["config.json"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 2, "Should load 2 commands from TOML")
// Verify first JSON command
cmd1 := commands[0]
assert.Equal(t, "JSONMultiply", cmd1.Name, "First command name should match")
assert.True(t, cmd1.JSON, "First command should have JSON mode enabled")
assert.Equal(t, "for i, item in ipairs(data.items) do data.items[i].value = item.value * 2 end; return true", cmd1.Lua, "First command Lua should match")
assert.Equal(t, []string{"data.json"}, cmd1.Files, "First command files should match")
// Verify second JSON command
cmd2 := commands[1]
assert.Equal(t, "JSONObjectUpdate", cmd2.Name, "Second command name should match")
assert.True(t, cmd2.JSON, "Second command should have JSON mode enabled")
assert.Equal(t, "data.version = '2.0.0'; data.enabled = true; return true", cmd2.Lua, "Second command Lua should match")
assert.Equal(t, []string{"config.json"}, cmd2.Files, "Second command files should match")
}
func TestTOMLEndToEndIntegration(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-integration-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create comprehensive TOML content
tomlContent := `[[commands]]
modifiers = { multiplier = 4, base_value = 100 }
[[commands]]
name = "IntegrationTest"
regex = '''
\[kinetics\.stressValues\.v2\.capacity\]
steam_engine = !num
water_wheel = !num
copper_valve_handle = !num'''
lua = "v1 * multiplier"
files = ["test.txt"]
isolate = true
[[commands]]
name = "SimplePattern"
regex = "enabled = (true|false)"
lua = "= false"
files = ["test.txt"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Create test file that matches the patterns
testContent := `[kinetics.stressValues.v2.capacity]
steam_engine = 256
water_wheel = 64
copper_valve_handle = 16
some_other_setting = enabled = true
`
testFile := filepath.Join(tmpDir, "test.txt")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test the complete workflow using the main function
commands, err := utils.LoadCommands([]string{"test.toml"})
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 3, "Should load 3 commands total (including global modifiers)")
// Associate files with commands
files := []string{"test.txt"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
assert.NoError(t, err, "Should associate files with commands")
// Verify associations
association := associations["test.txt"]
assert.Len(t, association.IsolateCommands, 1, "Should have 1 isolate command")
assert.Len(t, association.Commands, 1, "Should have 1 regular command")
assert.Equal(t, "IntegrationTest", association.IsolateCommands[0].Name, "Isolate command should match")
assert.Equal(t, "SimplePattern", association.Commands[0].Name, "Regular command should match")
t.Logf("TOML integration test completed successfully")
t.Logf("Loaded %d commands from TOML", len(commands))
t.Logf("Associated commands: %d isolate, %d regular",
len(association.IsolateCommands), len(association.Commands))
}
func TestTOMLErrorHandling(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-error-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test 1: Invalid TOML syntax
invalidTOML := `[[commands]]
name = "Invalid"
regex = "test = !num"
lua = "v1 * 2"
files = ["test.txt"
# Missing closing bracket
`
invalidFile := filepath.Join(tmpDir, "invalid.toml")
err = os.WriteFile(invalidFile, []byte(invalidTOML), 0644)
commands, err := utils.LoadCommandsFromTomlFiles("invalid.toml")
assert.Error(t, err, "Should return error for invalid TOML syntax")
assert.Nil(t, commands, "Should return nil commands for invalid TOML")
assert.Contains(t, err.Error(), "failed to unmarshal TOML file", "Error should mention TOML unmarshaling")
// Test 2: Non-existent file
commands, err = utils.LoadCommandsFromTomlFiles("nonexistent.toml")
assert.NoError(t, err, "Should handle non-existent file without error")
assert.Empty(t, commands, "Should return empty commands for non-existent file")
// Test 3: Empty TOML file creates an error (this is expected behavior)
emptyFile := filepath.Join(tmpDir, "empty.toml")
err = os.WriteFile(emptyFile, []byte(""), 0644)
commands, err = utils.LoadCommandsFromTomlFiles("empty.toml")
assert.Error(t, err, "Should return error for empty TOML file")
assert.Nil(t, commands, "Should return nil commands for empty TOML")
}
func TestYAMLToTOMLConversion(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "yaml-to-toml-conversion-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create a test YAML file
yamlContent := `- name: "ConversionTest"
regex: "value = !num"
lua: "v1 * 3"
files: ["test.txt"]
loglevel: DEBUG
- name: "AnotherTest"
regex: "enabled = (true|false)"
lua: "= false"
files: ["*.conf"]
- name: "GlobalModifiers"
modifiers:
multiplier: 2.5
prefix: "CONV_"
`
yamlFile := filepath.Join(tmpDir, "test.yml")
err = os.WriteFile(yamlFile, []byte(yamlContent), 0644)
assert.NoError(t, err, "Should write YAML test file")
// Test conversion
err = utils.ConvertYAMLToTOML("test.yml")
assert.NoError(t, err, "Should convert YAML to TOML without error")
// Check that TOML file was created
tomlFile := filepath.Join(tmpDir, "test.toml")
_, err = os.Stat(tomlFile)
assert.NoError(t, err, "TOML file should exist after conversion")
// Read and verify TOML content
tomlData, err := os.ReadFile(tomlFile)
assert.NoError(t, err, "Should read TOML file")
tomlContent := string(tomlData)
assert.Contains(t, tomlContent, `name = "ConversionTest"`, "TOML should contain first command name")
assert.Contains(t, tomlContent, `name = "AnotherTest"`, "TOML should contain second command name")
assert.Contains(t, tomlContent, `name = "GlobalModifiers"`, "TOML should contain global modifiers command")
assert.Contains(t, tomlContent, `multiplier = 2.5`, "TOML should contain multiplier")
assert.Contains(t, tomlContent, `prefix = "CONV_"`, "TOML should contain prefix")
// Test that converted TOML loads correctly
commands, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load converted TOML without error")
assert.Len(t, commands, 3, "Should load 3 commands from converted TOML")
// Find global modifiers command (it might not be first)
var globalCmd utils.ModifyCommand
foundGlobal := false
for _, cmd := range commands {
if cmd.Name == "GlobalModifiers" {
globalCmd = cmd
foundGlobal = true
break
}
}
assert.True(t, foundGlobal, "Should find global modifiers command")
assert.Equal(t, 2.5, globalCmd.Modifiers["multiplier"], "Should preserve multiplier value")
assert.Equal(t, "CONV_", globalCmd.Modifiers["prefix"], "Should preserve prefix value")
// Test skip functionality - run conversion again
err = utils.ConvertYAMLToTOML("test.yml")
assert.NoError(t, err, "Should handle existing TOML file without error")
// Verify original TOML file wasn't modified
originalTomlData, err := os.ReadFile(tomlFile)
assert.NoError(t, err, "Should read TOML file again")
assert.Equal(t, tomlData, originalTomlData, "TOML file content should be unchanged")
t.Logf("YAML to TOML conversion test completed successfully")
}

View File

@@ -1,162 +0,0 @@
package utils
import (
"errors"
"path/filepath"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
"gorm.io/driver/sqlite"
"gorm.io/gorm"
gormlogger "gorm.io/gorm/logger"
)
// dbLogger is a scoped logger for the utils/db package.
var dbLogger = logger.Default.WithPrefix("utils/db")
type DB interface {
DB() *gorm.DB
Raw(sql string, args ...any) *gorm.DB
SaveFile(filePath string, fileData []byte) error
GetFile(filePath string) ([]byte, error)
GetAllFiles() ([]FileSnapshot, error)
RemoveAllFiles() error
}
type FileSnapshot struct {
Date time.Time `gorm:"primaryKey"`
FilePath string `gorm:"primaryKey"`
FileData []byte `gorm:"type:blob"`
}
type DBWrapper struct {
db *gorm.DB
}
var globalDB *DBWrapper
func GetDB() (DB, error) {
getDBLogger := dbLogger.WithPrefix("GetDB")
getDBLogger.Debug("Attempting to get database connection")
var err error
dbFile := filepath.Join("data.sqlite")
getDBLogger.Debug("Opening database file: %q", dbFile)
getDBLogger.Trace("Database configuration: PrepareStmt=true, GORM logger=Silent")
db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
// SkipDefaultTransaction: true,
PrepareStmt: true,
Logger: gormlogger.Default.LogMode(gormlogger.Silent),
})
if err != nil {
getDBLogger.Error("Failed to open database file %q: %v", dbFile, err)
return nil, err
}
getDBLogger.Debug("Database opened successfully, running auto migration for FileSnapshot model")
if err := db.AutoMigrate(&FileSnapshot{}); err != nil {
getDBLogger.Error("Auto migration failed for FileSnapshot model: %v", err)
return nil, err
}
getDBLogger.Info("Database initialized and migrated successfully")
globalDB = &DBWrapper{db: db}
getDBLogger.Debug("Database wrapper initialized and cached globally")
return globalDB, nil
}
// Just a wrapper
func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
rawLogger := dbLogger.WithPrefix("Raw").WithField("sql", sql)
rawLogger.Debug("Executing raw SQL query with args: %v", args)
return db.db.Raw(sql, args...)
}
func (db *DBWrapper) DB() *gorm.DB {
dbLogger.WithPrefix("DB").Debug("Returning GORM DB instance")
return db.db
}
func (db *DBWrapper) FileExists(filePath string) (bool, error) {
fileExistsLogger := dbLogger.WithPrefix("FileExists").WithField("filePath", filePath)
fileExistsLogger.Debug("Checking if file exists in database")
var count int64
err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
if err != nil {
fileExistsLogger.Error("Error checking if file exists: %v", err)
return false, err
}
fileExistsLogger.Debug("File exists: %t", count > 0)
return count > 0, err
}
func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
saveFileLogger := dbLogger.WithPrefix("SaveFile").WithField("filePath", filePath).WithField("dataSize", len(fileData))
saveFileLogger.Debug("Attempting to save file to database")
saveFileLogger.Trace("File data length: %d", len(fileData))
exists, err := db.FileExists(filePath)
if err != nil {
saveFileLogger.Error("Error checking if file exists: %v", err)
return err
}
if exists {
saveFileLogger.Debug("File already exists in database, skipping save to avoid overwriting original snapshot")
return nil
}
saveFileLogger.Debug("Creating new file snapshot in database")
err = db.db.Create(&FileSnapshot{
Date: time.Now(),
FilePath: filePath,
FileData: fileData,
}).Error
if err != nil {
saveFileLogger.Error("Failed to create file snapshot: %v", err)
} else {
saveFileLogger.Info("File successfully saved to database")
}
return err
}
func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
getFileLogger := dbLogger.WithPrefix("GetFile").WithField("filePath", filePath)
getFileLogger.Debug("Getting file from database")
var fileSnapshot FileSnapshot
err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
if err != nil {
if errors.Is(err, gorm.ErrRecordNotFound) {
getFileLogger.Debug("File not found in database: %v", err)
} else {
getFileLogger.Warning("Failed to get file from database: %v", err)
}
return nil, err
}
getFileLogger.Debug("File found in database")
getFileLogger.Trace("Retrieved file data length: %d", len(fileSnapshot.FileData))
return fileSnapshot.FileData, nil
}
func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
getAllFilesLogger := dbLogger.WithPrefix("GetAllFiles")
getAllFilesLogger.Debug("Getting all files from database")
var fileSnapshots []FileSnapshot
err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
if err != nil {
getAllFilesLogger.Error("Failed to get all files from database: %v", err)
return nil, err
}
getAllFilesLogger.Debug("Found %d files in database", len(fileSnapshots))
getAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
return fileSnapshots, nil
}
func (db *DBWrapper) RemoveAllFiles() error {
removeAllFilesLogger := dbLogger.WithPrefix("RemoveAllFiles")
removeAllFilesLogger.Debug("Removing all files from database")
err := db.db.Exec("DELETE FROM file_snapshots").Error
if err != nil {
removeAllFilesLogger.Error("Failed to remove all files from database: %v", err)
} else {
removeAllFilesLogger.Debug("All files removed from database")
}
return err
}

View File

@@ -1,130 +0,0 @@
package utils
import (
"os"
"strconv"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// fileLogger is a scoped logger for the utils/file package.
var fileLogger = logger.Default.WithPrefix("utils/file")
func CleanPath(path string) string {
// Use the centralized ResolvePath function
return ResolvePath(path)
}
func ToAbs(path string) string {
// Use the centralized ResolvePath function
return ResolvePath(path)
}
// LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string {
limitStringLogger := fileLogger.WithPrefix("LimitString").WithField("originalLength", len(s)).WithField("maxLength", maxLen)
limitStringLogger.Debug("Limiting string length")
s = strings.ReplaceAll(s, "\n", "\\n")
if len(s) <= maxLen {
limitStringLogger.Trace("String length (%d) is within max length (%d), no truncation", len(s), maxLen)
return s
}
limited := s[:maxLen-3] + "..."
limitStringLogger.Trace("String truncated from %d to %d characters: %q", len(s), len(limited), limited)
return limited
}
// StrToFloat converts a string to a float64, returning 0 on error.
func StrToFloat(s string) float64 {
strToFloatLogger := fileLogger.WithPrefix("StrToFloat").WithField("inputString", s)
strToFloatLogger.Debug("Attempting to convert string to float")
f, err := strconv.ParseFloat(s, 64)
if err != nil {
strToFloatLogger.Warning("Failed to convert string %q to float, returning 0: %v", s, err)
return 0
}
strToFloatLogger.Trace("Successfully converted %q to float: %f", s, f)
return f
}
func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
resetWhereNecessaryLogger := fileLogger.WithPrefix("ResetWhereNecessary")
resetWhereNecessaryLogger.Debug("Starting reset where necessary operation")
resetWhereNecessaryLogger.Trace("File-command associations input: %v", associations)
dirtyFiles := make(map[string]struct{})
for _, association := range associations {
resetWhereNecessaryLogger.Debug("Processing association for file: %q", association.File)
for _, command := range association.Commands {
resetWhereNecessaryLogger.Debug("Checking command %q for reset requirement", command.Name)
resetWhereNecessaryLogger.Trace("Command details: %v", command)
if command.Reset {
resetWhereNecessaryLogger.Debug("Command %q requires reset for file %q, marking as dirty", command.Name, association.File)
dirtyFiles[association.File] = struct{}{}
}
}
for _, command := range association.IsolateCommands {
resetWhereNecessaryLogger.Debug("Checking isolate command %q for reset requirement", command.Name)
resetWhereNecessaryLogger.Trace("Isolate command details: %v", command)
if command.Reset {
resetWhereNecessaryLogger.Debug("Isolate command %q requires reset for file %q, marking as dirty", command.Name, association.File)
dirtyFiles[association.File] = struct{}{}
}
}
}
resetWhereNecessaryLogger.Debug("Identified %d files that need to be reset", len(dirtyFiles))
resetWhereNecessaryLogger.Trace("Dirty files identified: %v", dirtyFiles)
for file := range dirtyFiles {
resetWhereNecessaryLogger.Debug("Resetting file %q", file)
fileData, err := db.GetFile(file)
if err != nil {
resetWhereNecessaryLogger.Warning("Failed to get original content for file %q from database: %v", file, err)
// Seed the snapshot from current disk content if missing, then use it as fallback
currentData, readErr := os.ReadFile(file)
if readErr != nil {
resetWhereNecessaryLogger.Warning("Additionally failed to read current file content for %q: %v", file, readErr)
continue
}
// Best-effort attempt to save baseline; ignore errors to avoid blocking reset
if saveErr := db.SaveFile(file, currentData); saveErr != nil {
resetWhereNecessaryLogger.Warning("Failed to seed baseline snapshot for %q: %v", file, saveErr)
}
fileData = currentData
}
resetWhereNecessaryLogger.Trace("Retrieved original file data length for %q: %d", file, len(fileData))
resetWhereNecessaryLogger.Debug("Writing original content back to file %q", file)
err = os.WriteFile(file, fileData, 0644)
if err != nil {
resetWhereNecessaryLogger.Warning("Failed to write original content back to file %q: %v", file, err)
continue
}
resetWhereNecessaryLogger.Debug("Successfully reset file %q", file)
}
resetWhereNecessaryLogger.Debug("Finished reset where necessary operation")
return nil
}
func ResetAllFiles(db DB) error {
resetAllFilesLogger := fileLogger.WithPrefix("ResetAllFiles")
resetAllFilesLogger.Debug("Starting reset all files operation")
fileSnapshots, err := db.GetAllFiles()
if err != nil {
resetAllFilesLogger.Error("Failed to get all file snapshots from database: %v", err)
return err
}
resetAllFilesLogger.Debug("Found %d files in database to reset", len(fileSnapshots))
resetAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
for _, fileSnapshot := range fileSnapshots {
resetAllFilesLogger.Debug("Resetting file %q", fileSnapshot.FilePath)
err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
if err != nil {
resetAllFilesLogger.Warning("Failed to write file %q to disk: %v", fileSnapshot.FilePath, err)
continue
}
resetAllFilesLogger.Debug("File %q written to disk successfully", fileSnapshot.FilePath)
}
resetAllFilesLogger.Debug("Finished reset all files operation")
return nil
}

View File

@@ -1,575 +0,0 @@
package utils
import (
"fmt"
"os"
"path/filepath"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/bmatcuk/doublestar/v4"
"github.com/BurntSushi/toml"
"gopkg.in/yaml.v3"
)
// modifyCommandLogger is a scoped logger for the utils/modifycommand package.
var modifyCommandLogger = logger.Default.WithPrefix("utils/modifycommand")
type ModifyCommand struct {
Name string `yaml:"name,omitempty" toml:"name,omitempty"`
Regex string `yaml:"regex,omitempty" toml:"regex,omitempty"`
Regexes []string `yaml:"regexes,omitempty" toml:"regexes,omitempty"`
Lua string `yaml:"lua,omitempty" toml:"lua,omitempty"`
Files []string `yaml:"files,omitempty" toml:"files,omitempty"`
Reset bool `yaml:"reset,omitempty" toml:"reset,omitempty"`
LogLevel string `yaml:"loglevel,omitempty" toml:"loglevel,omitempty"`
Isolate bool `yaml:"isolate,omitempty" toml:"isolate,omitempty"`
NoDedup bool `yaml:"nodedup,omitempty" toml:"nodedup,omitempty"`
Disabled bool `yaml:"disable,omitempty" toml:"disable,omitempty"`
JSON bool `yaml:"json,omitempty" toml:"json,omitempty"`
Modifiers map[string]interface{} `yaml:"modifiers,omitempty" toml:"modifiers,omitempty"`
}
type CookFile []ModifyCommand
func (c *ModifyCommand) Validate() error {
validateLogger := modifyCommandLogger.WithPrefix("Validate").WithField("commandName", c.Name)
validateLogger.Debug("Validating command")
// For JSON mode, regex patterns are not required
if !c.JSON {
if c.Regex == "" && len(c.Regexes) == 0 {
validateLogger.Error("Validation failed: Regex pattern is required for non-JSON mode")
return fmt.Errorf("pattern is required for non-JSON mode")
}
}
if c.Lua == "" {
validateLogger.Error("Validation failed: Lua expression is required")
return fmt.Errorf("lua expression is required")
}
if len(c.Files) == 0 {
validateLogger.Error("Validation failed: At least one file is required")
return fmt.Errorf("at least one file is required")
}
if c.LogLevel == "" {
validateLogger.Debug("LogLevel not specified, defaulting to INFO")
c.LogLevel = "INFO"
}
validateLogger.Debug("Command validated successfully")
return nil
}
// Ehh.. Not much better... Guess this wasn't the big deal
var matchesMemoTable map[string]bool = make(map[string]bool)
func Matches(path string, glob string) (bool, error) {
matchesLogger := modifyCommandLogger.WithPrefix("Matches").WithField("path", path).WithField("glob", glob)
matchesLogger.Debug("Checking if path matches glob")
key := fmt.Sprintf("%s:%s", path, glob)
if matches, ok := matchesMemoTable[key]; ok {
matchesLogger.Debug("Found match in memo table: %t", matches)
return matches, nil
}
matches, err := doublestar.Match(glob, path)
if err != nil {
matchesLogger.Error("Failed to match glob: %v", err)
return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
}
matchesMemoTable[key] = matches
matchesLogger.Debug("Match result: %t, storing in memo table", matches)
return matches, nil
}
func SplitPattern(pattern string) (string, string) {
splitPatternLogger := modifyCommandLogger.WithPrefix("SplitPattern").WithField("pattern", pattern)
splitPatternLogger.Debug("Splitting pattern")
splitPatternLogger.Trace("Original pattern: %q", pattern)
// Resolve the pattern first to handle ~ expansion and make it absolute
resolvedPattern := ResolvePath(pattern)
splitPatternLogger.Trace("Resolved pattern: %q", resolvedPattern)
static, pattern := doublestar.SplitPattern(resolvedPattern)
// Ensure static part is properly resolved
if static == "" {
cwd, err := os.Getwd()
if err != nil {
splitPatternLogger.Error("Error getting current working directory: %v", err)
return "", ""
}
static = cwd
splitPatternLogger.Debug("Static part is empty, defaulting to current working directory: %q", static)
} else {
// Static part should already be resolved by ResolvePath
static = strings.ReplaceAll(static, "\\", "/")
}
splitPatternLogger.Trace("Final static path: %q, Remaining pattern: %q", static, pattern)
return static, pattern
}
type FileCommandAssociation struct {
File string
IsolateCommands []ModifyCommand
Commands []ModifyCommand
}
func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
associateFilesLogger := modifyCommandLogger.WithPrefix("AssociateFilesWithCommands")
associateFilesLogger.Debug("Associating files with commands")
associateFilesLogger.Trace("Input files: %v", files)
associateFilesLogger.Trace("Input commands: %v", commands)
associationCount := 0
fileCommands := make(map[string]FileCommandAssociation)
for _, file := range files {
// Use centralized path resolution internally but keep original file as key
resolvedFile := ResolvePath(file)
associateFilesLogger.Debug("Processing file: %q (resolved: %q)", file, resolvedFile)
fileCommands[file] = FileCommandAssociation{
File: resolvedFile,
IsolateCommands: []ModifyCommand{},
Commands: []ModifyCommand{},
}
for _, command := range commands {
associateFilesLogger.Debug("Checking command %q for file %q", command.Name, file)
for _, glob := range command.Files {
// SplitPattern now handles tilde expansion and path resolution
static, pattern := SplitPattern(glob)
associateFilesLogger.Trace("Glob parts for %q → static=%q pattern=%q", glob, static, pattern)
// Use resolved file for matching
absFile := resolvedFile
associateFilesLogger.Trace("Absolute file path resolved for matching: %q", absFile)
// Only match if the file is under the static root
if !(strings.HasPrefix(absFile, static+"/") || absFile == static) {
associateFilesLogger.Trace("Skipping glob %q for file %q because file is outside static root %q", glob, file, static)
continue
}
patternFile := strings.TrimPrefix(absFile, static+`/`)
associateFilesLogger.Trace("Pattern-relative path used for match: %q", patternFile)
matches, err := Matches(patternFile, pattern)
if err != nil {
associateFilesLogger.Warning("Failed to match glob %q with file %q: %v", glob, file, err)
continue
}
if matches {
associateFilesLogger.Debug("File %q matches glob %q. Associating with command %q", file, glob, command.Name)
association := fileCommands[file]
if command.Isolate {
associateFilesLogger.Debug("Command %q is an isolate command, adding to isolate list", command.Name)
association.IsolateCommands = append(association.IsolateCommands, command)
} else {
associateFilesLogger.Debug("Command %q is a regular command, adding to regular list", command.Name)
association.Commands = append(association.Commands, command)
}
fileCommands[file] = association
associationCount++
} else {
associateFilesLogger.Trace("File %q did not match glob %q (pattern=%q, rel=%q)", file, glob, pattern, patternFile)
}
}
}
currentFileCommands := fileCommands[file]
associateFilesLogger.Debug("Finished processing file %q. Found %d regular commands and %d isolate commands", file, len(currentFileCommands.Commands), len(currentFileCommands.IsolateCommands))
associateFilesLogger.Trace("Commands for file %q: %v", file, currentFileCommands.Commands)
associateFilesLogger.Trace("Isolate commands for file %q: %v", file, currentFileCommands.IsolateCommands)
}
associateFilesLogger.Info("Completed association. Found %d total associations for %d files and %d commands", associationCount, len(files), len(commands))
return fileCommands, nil
}
func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
aggregateGlobsLogger := modifyCommandLogger.WithPrefix("AggregateGlobs")
aggregateGlobsLogger.Debug("Aggregating glob patterns from commands")
aggregateGlobsLogger.Trace("Input commands for aggregation: %v", commands)
globs := make(map[string]struct{})
for _, command := range commands {
aggregateGlobsLogger.Debug("Processing command %q for glob patterns", command.Name)
for _, glob := range command.Files {
// Split the glob into static and pattern parts, then resolve ONLY the static part
static, pattern := SplitPattern(glob)
// Reconstruct the glob with resolved static part
resolvedGlob := static
if pattern != "" {
resolvedGlob += "/" + pattern
}
aggregateGlobsLogger.Trace("Adding glob: %q (resolved to %q) [static=%s, pattern=%s]", glob, resolvedGlob, static, pattern)
globs[resolvedGlob] = struct{}{}
}
}
aggregateGlobsLogger.Debug("Finished aggregating globs. Found %d unique glob patterns", len(globs))
aggregateGlobsLogger.Trace("Aggregated unique globs: %v", globs)
return globs
}
func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
expandGlobsLogger := modifyCommandLogger.WithPrefix("ExpandGLobs")
expandGlobsLogger.Debug("Expanding glob patterns to actual files")
expandGlobsLogger.Trace("Input patterns for expansion: %v", patterns)
var files []string
filesMap := make(map[string]bool)
cwd, err := os.Getwd()
if err != nil {
expandGlobsLogger.Error("Failed to get current working directory: %v", err)
return nil, fmt.Errorf("failed to get current working directory: %w", err)
}
expandGlobsLogger.Debug("Current working directory: %q", cwd)
for pattern := range patterns {
expandGlobsLogger.Debug("Processing glob pattern: %q", pattern)
static, pattern := SplitPattern(pattern)
matches, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
expandGlobsLogger.Warning("Error expanding glob %q in %q: %v", pattern, static, err)
continue
}
expandGlobsLogger.Debug("Found %d matches for pattern %q", len(matches), pattern)
expandGlobsLogger.Trace("Raw matches for pattern %q: %v", pattern, matches)
for _, m := range matches {
// Resolve the full path
fullPath := ResolvePath(filepath.Join(static, m))
info, err := os.Stat(fullPath)
if err != nil {
expandGlobsLogger.Warning("Error getting file info for %q: %v", fullPath, err)
continue
}
if !info.IsDir() && !filesMap[fullPath] {
expandGlobsLogger.Trace("Adding unique file to list: %q", fullPath)
filesMap[fullPath], files = true, append(files, fullPath)
}
}
}
if len(files) > 0 {
expandGlobsLogger.Debug("Finished expanding globs. Found %d unique files to process", len(files))
expandGlobsLogger.Trace("Unique files to process: %v", files)
} else {
expandGlobsLogger.Warning("No files found after expanding glob patterns.")
}
return files, nil
}
func LoadCommands(args []string) ([]ModifyCommand, error) {
loadCommandsLogger := modifyCommandLogger.WithPrefix("LoadCommands")
loadCommandsLogger.Debug("Loading commands from arguments (cook files or direct patterns)")
loadCommandsLogger.Trace("Input arguments: %v", args)
commands := []ModifyCommand{}
for _, arg := range args {
loadCommandsLogger.Debug("Processing argument for commands: %q", arg)
var newCommands []ModifyCommand
var err error
// Check file extension to determine format
if strings.HasSuffix(arg, ".toml") {
loadCommandsLogger.Debug("Loading TOML commands from %q", arg)
newCommands, err = LoadCommandsFromTomlFiles(arg)
if err != nil {
loadCommandsLogger.Error("Failed to load TOML commands from argument %q: %v", arg, err)
return nil, fmt.Errorf("failed to load commands from TOML files: %w", err)
}
} else {
// Default to YAML for .yml, .yaml, or any other extension
loadCommandsLogger.Debug("Loading YAML commands from %q", arg)
newCommands, err = LoadCommandsFromCookFiles(arg)
if err != nil {
loadCommandsLogger.Error("Failed to load YAML commands from argument %q: %v", arg, err)
return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
}
}
loadCommandsLogger.Debug("Successfully loaded %d commands from %q", len(newCommands), arg)
for _, cmd := range newCommands {
if cmd.Disabled {
loadCommandsLogger.Debug("Skipping disabled command: %q", cmd.Name)
continue
}
commands = append(commands, cmd)
loadCommandsLogger.Trace("Added command %q. Current total commands: %d", cmd.Name, len(commands))
}
}
loadCommandsLogger.Info("Finished loading commands. Total %d commands loaded", len(commands))
return commands, nil
}
func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
loadCookFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFiles").WithField("pattern", pattern)
loadCookFilesLogger.Debug("Loading commands from cook files based on pattern")
loadCookFilesLogger.Trace("Input pattern: %q", pattern)
static, pattern := SplitPattern(pattern)
commands := []ModifyCommand{}
cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
loadCookFilesLogger.Error("Failed to glob cook files for pattern %q: %v", pattern, err)
return nil, fmt.Errorf("failed to glob cook files: %w", err)
}
loadCookFilesLogger.Debug("Found %d cook files for pattern %q", len(cookFiles), pattern)
loadCookFilesLogger.Trace("Cook files found: %v", cookFiles)
for _, cookFile := range cookFiles {
// Use centralized path resolution
cookFile = ResolvePath(filepath.Join(static, cookFile))
loadCookFilesLogger.Debug("Loading commands from individual cook file: %q", cookFile)
cookFileData, err := os.ReadFile(cookFile)
if err != nil {
loadCookFilesLogger.Error("Failed to read cook file %q: %v", cookFile, err)
return nil, fmt.Errorf("failed to read cook file: %w", err)
}
loadCookFilesLogger.Trace("Read %d bytes from cook file %q", len(cookFileData), cookFile)
newCommands, err := LoadCommandsFromCookFile(cookFileData)
if err != nil {
loadCookFilesLogger.Error("Failed to load commands from cook file data for %q: %v", cookFile, err)
return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
}
commands = append(commands, newCommands...)
loadCookFilesLogger.Debug("Added %d commands from cook file %q. Total commands now: %d", len(newCommands), cookFile, len(commands))
}
loadCookFilesLogger.Debug("Finished loading commands from cook files. Total %d commands", len(commands))
return commands, nil
}
func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
loadCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFile")
loadCommandLogger.Debug("Unmarshaling commands from cook file data")
loadCommandLogger.Trace("Cook file data length: %d", len(cookFileData))
commands := []ModifyCommand{}
err := yaml.Unmarshal(cookFileData, &commands)
if err != nil {
loadCommandLogger.Error("Failed to unmarshal cook file data: %v", err)
return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
}
loadCommandLogger.Debug("Successfully unmarshaled %d commands", len(commands))
loadCommandLogger.Trace("Unmarshaled commands: %v", commands)
return commands, nil
}
// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
func CountGlobsBeforeDedup(commands []ModifyCommand) int {
countGlobsLogger := modifyCommandLogger.WithPrefix("CountGlobsBeforeDedup")
countGlobsLogger.Debug("Counting glob patterns before deduplication")
count := 0
for _, cmd := range commands {
countGlobsLogger.Trace("Processing command %q, adding %d globs", cmd.Name, len(cmd.Files))
count += len(cmd.Files)
}
countGlobsLogger.Debug("Total glob patterns before deduplication: %d", count)
return count
}
func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
filterCommandsLogger := modifyCommandLogger.WithPrefix("FilterCommands").WithField("filter", filter)
filterCommandsLogger.Debug("Filtering commands")
filterCommandsLogger.Trace("Input commands: %v", commands)
filteredCommands := []ModifyCommand{}
filters := strings.Split(filter, ",")
filterCommandsLogger.Trace("Split filters: %v", filters)
for _, cmd := range commands {
filterCommandsLogger.Debug("Checking command %q against filters", cmd.Name)
for _, f := range filters {
if strings.Contains(cmd.Name, f) {
filterCommandsLogger.Debug("Command %q matches filter %q, adding to filtered list", cmd.Name, f)
filteredCommands = append(filteredCommands, cmd)
break // Command matches, no need to check other filters
}
}
}
filterCommandsLogger.Debug("Finished filtering commands. Found %d filtered commands", len(filteredCommands))
filterCommandsLogger.Trace("Filtered commands: %v", filteredCommands)
return filteredCommands
}
func LoadCommandsFromTomlFiles(pattern string) ([]ModifyCommand, error) {
loadTomlFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromTomlFiles").WithField("pattern", pattern)
loadTomlFilesLogger.Debug("Loading commands from TOML files based on pattern")
loadTomlFilesLogger.Trace("Input pattern: %q", pattern)
static, pattern := SplitPattern(pattern)
commands := []ModifyCommand{}
tomlFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
loadTomlFilesLogger.Error("Failed to glob TOML files for pattern %q: %v", pattern, err)
return nil, fmt.Errorf("failed to glob TOML files: %w", err)
}
loadTomlFilesLogger.Debug("Found %d TOML files for pattern %q", len(tomlFiles), pattern)
loadTomlFilesLogger.Trace("TOML files found: %v", tomlFiles)
for _, tomlFile := range tomlFiles {
// Use centralized path resolution
tomlFile = ResolvePath(filepath.Join(static, tomlFile))
loadTomlFilesLogger.Debug("Loading commands from individual TOML file: %q", tomlFile)
tomlFileData, err := os.ReadFile(tomlFile)
if err != nil {
loadTomlFilesLogger.Error("Failed to read TOML file %q: %v", tomlFile, err)
return nil, fmt.Errorf("failed to read TOML file: %w", err)
}
loadTomlFilesLogger.Trace("Read %d bytes from TOML file %q", len(tomlFileData), tomlFile)
newCommands, err := LoadCommandsFromTomlFile(tomlFileData)
if err != nil {
loadTomlFilesLogger.Error("Failed to load commands from TOML file data for %q: %v", tomlFile, err)
return nil, fmt.Errorf("failed to load commands from TOML file: %w", err)
}
commands = append(commands, newCommands...)
loadTomlFilesLogger.Debug("Added %d commands from TOML file %q. Total commands now: %d", len(newCommands), tomlFile, len(commands))
}
loadTomlFilesLogger.Debug("Finished loading commands from TOML files. Total %d commands", len(commands))
return commands, nil
}
func LoadCommandsFromTomlFile(tomlFileData []byte) ([]ModifyCommand, error) {
loadTomlCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromTomlFile")
loadTomlCommandLogger.Debug("Unmarshaling commands from TOML file data")
loadTomlCommandLogger.Trace("TOML file data length: %d", len(tomlFileData))
// TOML structure for commands array
var tomlData struct {
Commands []ModifyCommand `toml:"commands"`
// Also support direct array without wrapper
DirectCommands []ModifyCommand `toml:"-"`
}
// First try to parse as wrapped structure
err := toml.Unmarshal(tomlFileData, &tomlData)
if err != nil {
loadTomlCommandLogger.Error("Failed to unmarshal TOML file data: %v", err)
return nil, fmt.Errorf("failed to unmarshal TOML file: %w", err)
}
var commands []ModifyCommand
// If we found commands in the wrapped structure, use those
if len(tomlData.Commands) > 0 {
commands = tomlData.Commands
loadTomlCommandLogger.Debug("Found %d commands in wrapped TOML structure", len(commands))
} else {
// Try to parse as direct array (similar to YAML format)
commands = []ModifyCommand{}
err = toml.Unmarshal(tomlFileData, &commands)
if err != nil {
loadTomlCommandLogger.Error("Failed to unmarshal TOML file data as direct array: %v", err)
return nil, fmt.Errorf("failed to unmarshal TOML file as direct array: %w", err)
}
loadTomlCommandLogger.Debug("Found %d commands in direct TOML array", len(commands))
}
loadTomlCommandLogger.Debug("Successfully unmarshaled %d commands", len(commands))
loadTomlCommandLogger.Trace("Unmarshaled commands: %v", commands)
return commands, nil
}
// ConvertYAMLToTOML converts YAML files to TOML format
func ConvertYAMLToTOML(yamlPattern string) error {
convertLogger := modifyCommandLogger.WithPrefix("ConvertYAMLToTOML").WithField("pattern", yamlPattern)
convertLogger.Debug("Starting YAML to TOML conversion")
// Load YAML commands
yamlCommands, err := LoadCommandsFromCookFiles(yamlPattern)
if err != nil {
convertLogger.Error("Failed to load YAML commands: %v", err)
return fmt.Errorf("failed to load YAML commands: %w", err)
}
if len(yamlCommands) == 0 {
convertLogger.Info("No YAML commands found for pattern: %s", yamlPattern)
return nil
}
convertLogger.Debug("Loaded %d commands from YAML", len(yamlCommands))
// Find all YAML files matching the pattern
static, pattern := SplitPattern(yamlPattern)
yamlFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
convertLogger.Error("Failed to glob YAML files: %v", err)
return fmt.Errorf("failed to glob YAML files: %w", err)
}
convertLogger.Debug("Found %d YAML files to convert", len(yamlFiles))
conversionCount := 0
skippedCount := 0
for _, yamlFile := range yamlFiles {
// Use centralized path resolution
yamlFilePath := ResolvePath(filepath.Join(static, yamlFile))
// Generate corresponding TOML file path
tomlFilePath := strings.TrimSuffix(yamlFilePath, filepath.Ext(yamlFilePath)) + ".toml"
convertLogger.Debug("Processing YAML file: %s -> %s", yamlFilePath, tomlFilePath)
// Check if TOML file already exists
if _, err := os.Stat(tomlFilePath); err == nil {
convertLogger.Info("Skipping conversion - TOML file already exists: %s", tomlFilePath)
skippedCount++
continue
}
// Read YAML file
yamlData, err := os.ReadFile(yamlFilePath)
if err != nil {
convertLogger.Error("Failed to read YAML file %s: %v", yamlFilePath, err)
continue
}
// Load YAML commands from this specific file
fileCommands, err := LoadCommandsFromCookFile(yamlData)
if err != nil {
convertLogger.Error("Failed to parse YAML file %s: %v", yamlFilePath, err)
continue
}
// Convert to TOML structure
tomlData, err := convertCommandsToTOML(fileCommands)
if err != nil {
convertLogger.Error("Failed to convert commands to TOML for %s: %v", yamlFilePath, err)
continue
}
// Write TOML file
err = os.WriteFile(tomlFilePath, tomlData, 0644)
if err != nil {
convertLogger.Error("Failed to write TOML file %s: %v", tomlFilePath, err)
continue
}
convertLogger.Info("Successfully converted %s to %s", yamlFilePath, tomlFilePath)
conversionCount++
}
convertLogger.Info("Conversion completed: %d files converted, %d files skipped", conversionCount, skippedCount)
return nil
}
// convertCommandsToTOML converts a slice of ModifyCommand to TOML format
func convertCommandsToTOML(commands []ModifyCommand) ([]byte, error) {
convertLogger := modifyCommandLogger.WithPrefix("convertCommandsToTOML")
convertLogger.Debug("Converting %d commands to TOML format", len(commands))
// Create TOML structure
tomlData := struct {
Commands []ModifyCommand `toml:"commands"`
}{
Commands: commands,
}
// Marshal to TOML
tomlBytes, err := toml.Marshal(tomlData)
if err != nil {
convertLogger.Error("Failed to marshal commands to TOML: %v", err)
return nil, fmt.Errorf("failed to marshal commands to TOML: %w", err)
}
convertLogger.Debug("Successfully converted %d commands to TOML (%d bytes)", len(commands), len(tomlBytes))
return tomlBytes, nil
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,104 +0,0 @@
package utils
import (
"os"
"path/filepath"
"runtime"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// pathLogger is a scoped logger for the utils/path package.
var pathLogger = logger.Default.WithPrefix("utils/path")
// ResolvePath resolves a file path by:
// 1. Expanding ~ to the user's home directory
// 2. Making the path absolute if it's relative
// 3. Normalizing path separators to forward slashes
// 4. Cleaning the path
func ResolvePath(path string) string {
resolvePathLogger := pathLogger.WithPrefix("ResolvePath").WithField("inputPath", path)
resolvePathLogger.Debug("Resolving path")
if path == "" {
resolvePathLogger.Warning("Empty path provided")
return ""
}
// Step 1: Expand ~ to home directory
originalPath := path
if strings.HasPrefix(path, "~") {
home := os.Getenv("HOME")
if home == "" {
// Fallback for Windows
if runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
}
if home != "" {
if path == "~" {
path = home
} else if strings.HasPrefix(path, "~/") {
path = filepath.Join(home, path[2:])
} else {
// Handle cases like ~username
// For now, just replace ~ with home directory
path = strings.Replace(path, "~", home, 1)
}
resolvePathLogger.Debug("Expanded tilde to home directory: home=%s, result=%s", home, path)
} else {
resolvePathLogger.Warning("Could not determine home directory for tilde expansion")
}
}
// Step 2: Make path absolute if it's not already
if !filepath.IsAbs(path) {
cwd, err := os.Getwd()
if err != nil {
resolvePathLogger.Error("Failed to get current working directory: %v", err)
return path // Return as-is if we can't get CWD
}
path = filepath.Join(cwd, path)
resolvePathLogger.Debug("Made relative path absolute: cwd=%s, result=%s", cwd, path)
}
// Step 3: Clean the path
path = filepath.Clean(path)
resolvePathLogger.Debug("Cleaned path: result=%s", path)
// Step 4: Normalize path separators to forward slashes for consistency
path = strings.ReplaceAll(path, "\\", "/")
resolvePathLogger.Debug("Final resolved path: original=%s, final=%s", originalPath, path)
return path
}
// ResolvePathForLogging is the same as ResolvePath but includes more detailed logging
// for debugging purposes
func ResolvePathForLogging(path string) string {
return ResolvePath(path)
}
// IsAbsolutePath checks if a path is absolute (including tilde expansion)
func IsAbsolutePath(path string) bool {
// Check for tilde expansion first
if strings.HasPrefix(path, "~") {
return true // Tilde paths become absolute after expansion
}
return filepath.IsAbs(path)
}
// GetRelativePath returns the relative path from base to target
func GetRelativePath(base, target string) (string, error) {
resolvedBase := ResolvePath(base)
resolvedTarget := ResolvePath(target)
relPath, err := filepath.Rel(resolvedBase, resolvedTarget)
if err != nil {
return "", err
}
// Normalize to forward slashes
return strings.ReplaceAll(relPath, "\\", "/"), nil
}

View File

@@ -1,432 +0,0 @@
package utils
import (
"os"
"path/filepath"
"runtime"
"strings"
"testing"
"github.com/stretchr/testify/assert"
)
func TestResolvePath(t *testing.T) {
// Save original working directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "path_test")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
tests := []struct {
name string
input string
expected string
setup func() // Optional setup function
}{
{
name: "Empty path",
input: "",
expected: "",
},
{
name: "Already absolute path",
input: func() string {
if runtime.GOOS == "windows" {
return "C:/absolute/path/file.txt"
}
return "/absolute/path/file.txt"
}(),
expected: func() string {
if runtime.GOOS == "windows" {
return "C:/absolute/path/file.txt"
}
return "/absolute/path/file.txt"
}(),
},
{
name: "Relative path",
input: "relative/file.txt",
expected: func() string {
abs, _ := filepath.Abs("relative/file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
name: "Tilde expansion - home only",
input: "~",
expected: func() string {
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
return strings.ReplaceAll(filepath.Clean(home), "\\", "/")
}(),
},
{
name: "Tilde expansion - with subpath",
input: "~/Documents/file.txt",
expected: func() string {
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
expected := filepath.Join(home, "Documents", "file.txt")
return strings.ReplaceAll(filepath.Clean(expected), "\\", "/")
}(),
},
{
name: "Path normalization - double slashes",
input: "path//to//file.txt",
expected: func() string {
abs, _ := filepath.Abs("path/to/file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
name: "Path normalization - . and ..",
input: "path/./to/../file.txt",
expected: func() string {
abs, _ := filepath.Abs("path/file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
name: "Windows backslash normalization",
input: "path\\to\\file.txt",
expected: func() string {
abs, _ := filepath.Abs("path/to/file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
name: "Mixed separators with tilde",
input: "~/Documents\\file.txt",
expected: func() string {
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
expected := filepath.Join(home, "Documents", "file.txt")
return strings.ReplaceAll(filepath.Clean(expected), "\\", "/")
}(),
},
{
name: "Relative path from current directory",
input: "./file.txt",
expected: func() string {
abs, _ := filepath.Abs("file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
if tt.setup != nil {
tt.setup()
}
result := ResolvePath(tt.input)
assert.Equal(t, tt.expected, result, "ResolvePath(%q) = %q, want %q", tt.input, result, tt.expected)
})
}
}
func TestResolvePathWithWorkingDirectoryChange(t *testing.T) {
// Save original working directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
// Create temporary directories
tmpDir, err := os.MkdirTemp("", "path_test")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
subDir := filepath.Join(tmpDir, "subdir")
err = os.MkdirAll(subDir, 0755)
assert.NoError(t, err)
// Change to subdirectory
err = os.Chdir(subDir)
assert.NoError(t, err)
// Test relative path resolution from new working directory
result := ResolvePath("../test.txt")
expected := filepath.Join(tmpDir, "test.txt")
expected = strings.ReplaceAll(filepath.Clean(expected), "\\", "/")
assert.Equal(t, expected, result)
}
func TestResolvePathComplexTilde(t *testing.T) {
// Test complex tilde patterns
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
if home == "" {
t.Skip("Cannot determine home directory for tilde expansion tests")
}
tests := []struct {
input string
expected string
}{
{
input: "~",
expected: strings.ReplaceAll(filepath.Clean(home), "\\", "/"),
},
{
input: "~/",
expected: strings.ReplaceAll(filepath.Clean(home), "\\", "/"),
},
{
input: "~~",
expected: func() string {
// ~~ should be treated as ~ followed by ~ (tilde expansion)
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
if home != "" {
// First ~ gets expanded, second ~ remains
return strings.ReplaceAll(filepath.Clean(home+"~"), "\\", "/")
}
abs, _ := filepath.Abs("~~")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
input: func() string {
if runtime.GOOS == "windows" {
return "C:/not/tilde/path"
}
return "/not/tilde/path"
}(),
expected: func() string {
if runtime.GOOS == "windows" {
return "C:/not/tilde/path"
}
return "/not/tilde/path"
}(),
},
}
for _, tt := range tests {
t.Run("Complex tilde: "+tt.input, func(t *testing.T) {
result := ResolvePath(tt.input)
assert.Equal(t, tt.expected, result)
})
}
}
func TestIsAbsolutePath(t *testing.T) {
tests := []struct {
name string
input string
expected bool
}{
{
name: "Empty path",
input: "",
expected: false,
},
{
name: "Absolute Unix path",
input: "/absolute/path",
expected: func() bool {
if runtime.GOOS == "windows" {
// On Windows, paths starting with / are not considered absolute
return false
}
return true
}(),
},
{
name: "Relative path",
input: "relative/path",
expected: false,
},
{
name: "Tilde expansion (becomes absolute)",
input: "~/path",
expected: true,
},
{
name: "Windows absolute path",
input: "C:\\Windows\\System32",
expected: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result := IsAbsolutePath(tt.input)
assert.Equal(t, tt.expected, result)
})
}
}
func TestGetRelativePath(t *testing.T) {
// Create temporary directories for testing
tmpDir, err := os.MkdirTemp("", "relative_path_test")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
baseDir := filepath.Join(tmpDir, "base")
targetDir := filepath.Join(tmpDir, "target")
subDir := filepath.Join(targetDir, "subdir")
err = os.MkdirAll(baseDir, 0755)
assert.NoError(t, err)
err = os.MkdirAll(subDir, 0755)
assert.NoError(t, err)
tests := []struct {
name string
base string
target string
expected string
wantErr bool
}{
{
name: "Target is subdirectory of base",
base: baseDir,
target: filepath.Join(baseDir, "subdir"),
expected: "subdir",
wantErr: false,
},
{
name: "Target is parent of base",
base: filepath.Join(baseDir, "subdir"),
target: baseDir,
expected: "..",
wantErr: false,
},
{
name: "Target is sibling directory",
base: baseDir,
target: targetDir,
expected: "../target",
wantErr: false,
},
{
name: "Same directory",
base: baseDir,
target: baseDir,
expected: ".",
wantErr: false,
},
{
name: "With tilde expansion",
base: baseDir,
target: filepath.Join(baseDir, "file.txt"),
expected: "file.txt",
wantErr: false,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := GetRelativePath(tt.base, tt.target)
if tt.wantErr {
assert.Error(t, err)
} else {
assert.NoError(t, err)
assert.Equal(t, tt.expected, result)
}
})
}
}
func TestResolvePathRegression(t *testing.T) {
// This test specifically addresses the original bug:
// "~ is NOT BEING FUCKING RESOLVED"
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
if home == "" {
t.Skip("Cannot determine home directory for regression test")
}
// Test the exact pattern from the bug report
testPath := "~/Seafile/activitywatch/sync.yml"
result := ResolvePath(testPath)
expected := filepath.Join(home, "Seafile", "activitywatch", "sync.yml")
expected = strings.ReplaceAll(filepath.Clean(expected), "\\", "/")
assert.Equal(t, expected, result, "Tilde expansion bug not fixed!")
assert.NotContains(t, result, "~", "Tilde still present in resolved path!")
// Convert both to forward slashes for comparison
homeForwardSlash := strings.ReplaceAll(home, "\\", "/")
assert.Contains(t, result, homeForwardSlash, "Home directory not found in resolved path!")
}
func TestResolvePathEdgeCases(t *testing.T) {
// Save original working directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
tests := []struct {
name string
input string
setup func()
shouldPanic bool
}{
{
name: "Just dot",
input: ".",
},
{
name: "Just double dot",
input: "..",
},
{
name: "Triple dot",
input: "...",
},
{
name: "Multiple leading dots",
input: "./.././../file.txt",
},
{
name: "Path with spaces",
input: "path with spaces/file.txt",
},
{
name: "Very long relative path",
input: strings.Repeat("../", 10) + "file.txt",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
if tt.setup != nil {
tt.setup()
}
if tt.shouldPanic {
assert.Panics(t, func() {
ResolvePath(tt.input)
})
} else {
// Should not panic
assert.NotPanics(t, func() {
ResolvePath(tt.input)
})
// Result should be a valid absolute path
result := ResolvePath(tt.input)
if tt.input != "" {
assert.True(t, filepath.IsAbs(result) || result == "", "Result should be absolute or empty")
}
}
})
}
}

View File

@@ -1,79 +0,0 @@
package utils
import (
"fmt"
"sort"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// replaceCommandLogger is a scoped logger for the utils/replacecommand package.
var replaceCommandLogger = logger.Default.WithPrefix("utils/replacecommand")
type ReplaceCommand struct {
From int
To int
With string
}
func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
executeModificationsLogger := replaceCommandLogger.WithPrefix("ExecuteModifications")
executeModificationsLogger.Debug("Executing a batch of text modifications")
executeModificationsLogger.Trace("Number of modifications: %d, Original file data length: %d", len(modifications), len(fileData))
var err error
sort.Slice(modifications, func(i, j int) bool {
return modifications[i].From > modifications[j].From
})
executeModificationsLogger.Debug("Modifications sorted in reverse order for safe replacement")
executeModificationsLogger.Trace("Sorted modifications: %v", modifications)
executed := 0
for idx, modification := range modifications {
executeModificationsLogger.Debug("Applying modification %d/%d", idx+1, len(modifications))
executeModificationsLogger.Trace("Current modification details: From=%d, To=%d, With=%q", modification.From, modification.To, modification.With)
fileData, err = modification.Execute(fileData)
if err != nil {
executeModificationsLogger.Error("Failed to execute replacement for modification %+v: %v", modification, err)
continue
}
executed++
executeModificationsLogger.Trace("File data length after modification: %d", len(fileData))
}
executeModificationsLogger.Info("Successfully applied %d text replacements", executed)
return fileData, executed
}
func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
executeLogger := replaceCommandLogger.WithPrefix("Execute").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With))
executeLogger.Debug("Attempting to execute single replacement")
err := m.Validate(len(fileDataStr))
if err != nil {
executeLogger.Error("Failed to validate modification: %v", err)
return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
}
executeLogger.Trace("Applying replacement: fileDataStr[:%d] + %q + fileDataStr[%d:]", m.From, m.With, m.To)
result := fileDataStr[:m.From] + m.With + fileDataStr[m.To:]
executeLogger.Trace("Replacement executed. Result length: %d", len(result))
return result, nil
}
func (m *ReplaceCommand) Validate(maxsize int) error {
validateLogger := replaceCommandLogger.WithPrefix("Validate").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With)).WithField("maxSize", maxsize)
validateLogger.Debug("Validating replacement command against max size")
if m.To < m.From {
validateLogger.Error("Validation failed: 'To' (%d) is less than 'From' (%d)", m.To, m.From)
return fmt.Errorf("command to is less than from: %v", m)
}
if m.From > maxsize || m.To > maxsize {
validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is greater than max size (%d)", m.From, m.To, maxsize)
return fmt.Errorf("command from or to is greater than replacement length: %v", m)
}
if m.From < 0 || m.To < 0 {
validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is less than 0", m.From, m.To)
return fmt.Errorf("command from or to is less than 0: %v", m)
}
validateLogger.Debug("Modification command validated successfully")
return nil
}

View File

@@ -1,504 +0,0 @@
package utils
import (
"testing"
"github.com/stretchr/testify/assert"
)
func TestReplaceCommandExecute(t *testing.T) {
tests := []struct {
name string
input string
command ReplaceCommand
expected string
shouldError bool
}{
{
name: "Simple replacement",
input: "This is a test string",
command: ReplaceCommand{From: 5, To: 7, With: "was"},
expected: "This was a test string",
shouldError: false,
},
{
name: "Replace at beginning",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 5, With: "Hi"},
expected: "Hi world",
shouldError: false,
},
{
name: "Replace at end",
input: "Hello world",
command: ReplaceCommand{From: 6, To: 11, With: "everyone"},
expected: "Hello everyone",
shouldError: false,
},
{
name: "Replace entire string",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
expected: "Goodbye!",
shouldError: false,
},
{
name: "Error: From > To",
input: "Test string",
command: ReplaceCommand{From: 7, To: 5, With: "fail"},
expected: "Test string",
shouldError: true,
},
{
name: "Error: From > string length",
input: "Test",
command: ReplaceCommand{From: 10, To: 12, With: "fail"},
expected: "Test",
shouldError: true,
},
{
name: "Error: To > string length",
input: "Test",
command: ReplaceCommand{From: 2, To: 10, With: "fail"},
expected: "Test",
shouldError: true,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
result, err := tc.command.Execute(tc.input)
if tc.shouldError {
if err == nil {
t.Errorf("Expected an error for command %+v but got none", tc.command)
}
} else {
if err != nil {
t.Errorf("Unexpected error: %v", err)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
}
})
}
}
func TestExecuteModifications(t *testing.T) {
tests := []struct {
name string
input string
modifications []ReplaceCommand
expected string
expectedCount int
}{
{
name: "Single modification",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
},
expected: "Hi world",
expectedCount: 1,
},
{
name: "Multiple modifications",
input: "This is a test string",
modifications: []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 8, To: 14, With: "sample"},
},
expected: "That is sample string",
expectedCount: 2,
},
{
name: "Overlapping modifications",
input: "ABCDEF",
modifications: []ReplaceCommand{
{From: 0, To: 3, With: "123"}, // ABC -> 123
{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
},
// The actual behavior with the current implementation
expected: "123yzF",
expectedCount: 2,
},
{
name: "Sequential modifications",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 5, To: 6, With: ""}, // Remove the space
{From: 6, To: 11, With: "everyone"},
},
expected: "Hieveryone",
expectedCount: 3,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
// Make a copy of the modifications to avoid modifying the test case
mods := make([]ReplaceCommand, len(tc.modifications))
copy(mods, tc.modifications)
result, count := ExecuteModifications(mods, tc.input)
if count != tc.expectedCount {
t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
})
}
}
func TestReverseOrderExecution(t *testing.T) {
// This test verifies the current behavior of modification application
input := "Original text with multiple sections"
// Modifications in specific positions
modifications := []ReplaceCommand{
{From: 0, To: 8, With: "Modified"}, // Original -> Modified
{From: 9, To: 13, With: "document"}, // text -> document
{From: 14, To: 22, With: "without"}, // with -> without
{From: 23, To: 31, With: "any"}, // multiple -> any
}
// The actual current behavior of our implementation
expected := "Modified document withouttanytions"
result, count := ExecuteModifications(modifications, input)
if count != 4 {
t.Errorf("Expected 4 modifications, got %d", count)
}
if result != expected {
t.Errorf("Expected %q, got %q", expected, result)
}
}
// Replace text in the middle of a string with new content
func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello replaced, how are you?", result)
}
// Replace with empty string (deletion)
func TestReplaceCommandExecute_DeletesText(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello , how are you?", result)
}
// Replace with longer string than original segment
func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "longerreplacement",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello longerreplacement, how are you?", result)
}
// From and To values are the same (zero-length replacement)
func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 5,
With: "inserted",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Helloinserted world", result)
}
// From value is greater than To value
func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 10,
To: 5,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// From or To values exceed string length
func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 50, // Exceeds the length of the fileContent
With: "replaced",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world", result)
}
// From or To values are negative
func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: -1,
To: 10,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// Modifications are applied in reverse order (from highest to lowest 'From' value)
func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 10, To: 14, With: "sample"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a sample string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// One or more modifications fail but others succeed
func TestExecuteModificationsWithPartialFailures(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
// Create a custom ReplaceCommand implementation that will fail
failingCommand := ReplaceCommand{
From: 15,
To: 10, // Invalid range (To < From) to cause failure
With: "will fail",
}
// Valid commands
validCommand1 := ReplaceCommand{
From: 0,
To: 4,
With: "That",
}
validCommand2 := ReplaceCommand{
From: 26,
To: 38,
With: "modifications",
}
modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a test string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
// Only 2 out of 3 modifications should succeed
if executed != 2 {
t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
}
}
// All valid modifications are executed and the modified string is returned
func TestExecuteModificationsAllValid(t *testing.T) {
// Setup test data
fileData := "Hello world, this is a test"
modifications := []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 18, To: 20, With: "was"},
{From: 21, To: 27, With: "an example"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "Hi world, this was an example"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// The count of successfully executed modifications is returned
func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
// Setup test data
fileData := "Initial text for testing"
modifications := []ReplaceCommand{
{From: 0, To: 7, With: "Final"},
{From: 12, To: 16, With: "example"},
{From: 17, To: 24, With: "process"},
}
// Execute the function
_, executed := ExecuteModifications(modifications, fileData)
// Verify the count of executed modifications
expectedExecuted := 3
if executed != expectedExecuted {
t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
}
}
// Empty modifications list returns the original string with zero executed count
func TestExecuteModificationsWithEmptyList(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
if result != fileData {
t.Errorf("Expected result to be %q, but got %q", fileData, result)
}
if executed != 0 {
t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
}
}
// Modifications with identical 'From' values
func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 10, To: 14, With: "sample"},
{From: 10, To: 14, With: "example"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
// Yes, it's mangled, yes, it's intentional
// Every subsequent command works with the modified contents of the previous command
// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
// So we prepend "example" and end up with "examplele"
// Whether sample or example goes first here is irrelevant to us
// But it just so happens that sample goes first, so we end up with "examplele"
expectedResult := "This is a examplele string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// Modifications that would affect each other if not sorted properly
func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
// Setup test data
fileData := "The quick brown fox jumps over the lazy dog"
modifications := []ReplaceCommand{
{From: 4, To: 9, With: "slow"},
{From: 10, To: 15, With: "red"},
{From: 16, To: 19, With: "cat"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "The slow red cat jumps over the lazy dog"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}