121 Commits

Author SHA1 Message Date
299e6d8bfe Fix glob matching when backslashes are used as separators 2025-07-30 14:41:38 +02:00
388822e90a Create example yml even when no args are provided
ie. invalid usage
2025-07-30 14:38:29 +02:00
91993b4548 Improve error handling in ResetAllFiles function by logging warnings for failed file writes instead of returning errors 2025-07-27 12:47:21 +02:00
bb69558aaa Fix issue where invalid isolate commands would prevent other isolate commands from running 2025-07-21 21:28:12 +02:00
052c670627 Add a simple trim to lua 2025-07-21 21:00:11 +02:00
67fd215d0e Don't stroke out when backup doesn't exist in db 2025-07-20 11:48:55 +02:00
9ecbbff6fa Implement special flags for dump and reset db 2025-07-20 11:47:45 +02:00
774ac0f0ca Implement proper "reset" that reads snapshots from database 2025-07-20 11:43:25 +02:00
b785d24a08 Implement saving snapshots to a database 2025-07-20 11:38:08 +02:00
22f991e72e Clean up shop a bit 2025-07-20 11:20:19 +02:00
5518b27663 Remove deprecated flags and rename filter to f 2025-07-20 11:12:58 +02:00
0b899dea2c Add Disabled flag to ModifyCommand 2025-07-19 11:08:51 +02:00
3424fea8ad Dump a basic "config" to example usage on failed command 2025-07-19 01:15:48 +02:00
ddc1d83d58 Fix file associations
It was fucked because we were removing the static path and then cramming
that into assications
2025-04-22 10:53:25 +02:00
4b0a85411d From cook FILE - F I L E - FILEEEEE
This is the 4th time I make the SAME fix
2025-04-22 10:46:03 +02:00
46e871b626 Fix flag collision with logger 2025-04-22 10:45:11 +02:00
258dcc88e7 Fix reference to utils 2025-04-18 12:48:24 +02:00
75bf449bed Remove logger and replace it with a library 2025-04-18 12:47:47 +02:00
58586395fb Add file util for later 2025-04-13 21:31:19 +02:00
c5a68af5e6 PROPERLY implement doublestar 2025-04-13 21:29:18 +02:00
b4c0284734 Add rimworld cook file 2025-04-09 09:47:53 +02:00
c5d1dad8de Rename project to "cook" and ditch loading fgrom args, now files exclusively 2025-04-09 09:47:53 +02:00
4ff2ee80ee And fix the god damn backslashes fuck windows 2025-04-01 11:29:57 +02:00
633eebfd2a Support ~ in globs 2025-04-01 11:29:02 +02:00
5a31703840 Implement per command logger 2025-03-29 17:29:21 +01:00
162d0c758d Fix some tests 2025-03-29 17:29:21 +01:00
14d64495b6 Add deduplicate flag 2025-03-29 17:29:21 +01:00
fe6e97e832 Don't deduplicate (yet) 2025-03-29 17:23:21 +01:00
35b3d8b099 Reduce some of the reads and writes
It's really not necessary
2025-03-28 23:39:11 +01:00
2e3e958e15 Fix some tests and add some logs 2025-03-28 23:31:44 +01:00
955afc4295 Refactor running commands to separate functions 2025-03-28 16:59:22 +01:00
2c487bc443 Implement "Isolate" commands
Commands that run alone one by one on reading and writing the file
This should be used on commands that will modify a large part of the
file (or generally large parts)
Since that can fuck up the indices of other commands when ran together
2025-03-28 16:56:39 +01:00
b77224176b Add file lua value 2025-03-28 16:47:21 +01:00
a2201053c5 Remove some random ass fmt printf 2025-03-28 13:24:12 +01:00
04cedf5ece Fix the concurrent map writes 2025-03-28 11:35:38 +01:00
ebb07854cc Memoize the match table 2025-03-28 11:31:27 +01:00
8a86ae2f40 Add filter flag 2025-03-28 11:20:44 +01:00
e8f16dda2b Housekeeping 2025-03-28 02:14:27 +01:00
513773f641 Again 2025-03-28 01:26:26 +01:00
22914fe243 Add a lil log 2025-03-28 01:24:23 +01:00
2d523dfe64 Rename pattern to regex 2025-03-28 01:08:48 +01:00
2629722f67 Minor fixes and tweaks 2025-03-28 01:03:27 +01:00
1f6c4e4976 Fix up the tests and some minor bugs 2025-03-28 00:51:26 +01:00
bfd08e754e Replace old tests with asserts 2025-03-28 00:40:53 +01:00
750010b71a Add more tests to regex 2025-03-28 00:28:51 +01:00
9064a53820 Add more tests (and fix some things) for replacecommand 2025-03-28 00:23:42 +01:00
294c04a11a Add more tests for modifycommand 2025-03-28 00:03:23 +01:00
ba7ac07001 Fix up the logs a little 2025-03-27 23:36:56 +01:00
5d10178bf9 Update old and add new tests 2025-03-27 23:33:57 +01:00
f91c2b4795 More cleaning up 2025-03-27 23:07:22 +01:00
057db23d09 Implement panic recovery :?? 2025-03-27 23:06:46 +01:00
bf72734b90 Clean up regex.go a little 2025-03-27 23:04:39 +01:00
cc30c2bdcb Cleanup 2025-03-27 22:56:42 +01:00
f453079c72 Fix up regex.go 2025-03-27 22:50:15 +01:00
e634fe28bd Clean up processor 2025-03-27 22:24:59 +01:00
4e4b7bbd19 Implement parallel file processing 2025-03-27 22:22:43 +01:00
89eed3f847 Refactor git shit to its own module 2025-03-27 22:20:22 +01:00
f008efd5e1 Refactor modify and replace to their own files 2025-03-27 22:18:12 +01:00
f6def1e5a5 Refactor entirety of replace command to main for now 2025-03-27 22:11:03 +01:00
867b188718 Work out file reading and writing 2025-03-27 22:02:36 +01:00
aac29a4074 Refactor more stuff around 2025-03-27 21:58:52 +01:00
8a40f463f7 Implement file command association 2025-03-27 21:54:46 +01:00
8d4db1da91 Clean up code add some log lines and tidy up expandglobs 2025-03-27 21:49:28 +01:00
d41e2afe17 Update 2025-03-27 21:43:36 +01:00
76457d22cf Partially rework reading args to modify command loading 2025-03-27 21:39:16 +01:00
912950d463 Remove the vestiges of xml and json 2025-03-27 21:31:45 +01:00
25326ea11b Remove xml and json
They are simply not as useful as regex at all
There is nothing they can do regex cannot
And they have one massive penalty: the encoding
Which often results in MASSIVE diffs
2025-03-27 21:28:20 +01:00
df212b7fcc Remove jsonpath and xpath 2025-03-27 21:27:47 +01:00
f4a963760a Add dumptable helper function 2025-03-27 20:07:59 +01:00
d236811cb9 Introduce a new logging level for lua values 2025-03-27 20:06:50 +01:00
da93770334 Add strsplit lua helper 2025-03-27 19:56:31 +01:00
d9f54a8354 Fix test again 2025-03-27 19:49:57 +01:00
dc8da8ab63 Fix overlapping capture groups 2025-03-27 19:43:06 +01:00
24262a7dca Remove old unused xml files 2025-03-27 19:31:54 +01:00
d77b13c363 Update regression test 2025-03-27 19:31:20 +01:00
a9c60a3698 Neatly align log columns 2025-03-27 19:26:14 +01:00
66bcf21d79 Add goroutine numbers to log lines 2025-03-27 19:19:39 +01:00
e847e5c3ce Make little better logging 2025-03-27 18:53:02 +01:00
9a70c9696e Fix logger 2025-03-27 18:46:28 +01:00
9cea103042 Implement a more better logging solution 2025-03-27 17:53:43 +01:00
81d8259dfc Comment out some xml tests for now
We're not working on it for now
2025-03-27 17:46:43 +01:00
5c5fbac63f Make doublestar a little cleaner 2025-03-27 17:21:13 +01:00
3e818e61c7 Add string.format shortcut to lua 2025-03-27 15:38:07 +01:00
001470ffe4 Fix up regression tests 2025-03-27 15:37:57 +01:00
d88a76c4e2 Fix logging of groups 2025-03-26 22:26:02 +01:00
d3a1f1bd96 Rework regex grouping to avoid changing the same area twice 2025-03-26 22:24:19 +01:00
07a5f3f1a4 Add replaceCommands to avoid index suicide 2025-03-26 21:55:34 +01:00
e2257e082a Add a regression test 2025-03-26 21:55:17 +01:00
b3fce4244d Fix regex for numbers to support negative numbers 2025-03-26 18:30:21 +01:00
bd443067b6 Add support for !num inside of named capture groups 2025-03-26 14:04:39 +01:00
a9b6f7f984 Implement printing from lua 2025-03-26 13:37:39 +01:00
10c39b02a0 Fix some regex tests 2025-03-26 13:13:53 +01:00
7f4392b10e Implement "replacement" variable that simply replaces the match 2025-03-26 13:00:52 +01:00
7e19cf4e2c Rework named captures to be array
To comply with the whole reverse replacing
2025-03-26 12:50:55 +01:00
c5fb20e96a Implement named capture groups 2025-03-26 12:28:28 +01:00
a8c2257f20 Add named capture group tests 2025-03-26 12:17:01 +01:00
b63b4d1352 Add some more shorthands for regex 2025-03-26 12:06:04 +01:00
6a3d44ccd0 Redo what claude removed 2025-03-26 11:42:00 +01:00
c22e6ff41f Code polish 2025-03-26 11:40:23 +01:00
068c64d714 Fix up file reseting 2025-03-26 11:10:43 +01:00
2c7a4f5d97 Add a lot more logs to regex
What the fuck is going on?
2025-03-26 03:30:08 +01:00
0d7d251e76 Implement git reset 2025-03-26 03:23:16 +01:00
0d8c447ff6 Add support for git ie. automatically resetting changes to ensure clean slate 2025-03-26 03:22:05 +01:00
bb14087598 Fix oopsie 2025-03-26 02:52:28 +01:00
66a522aa12 Try to include xml node children in lua table 2025-03-26 02:50:33 +01:00
1a4b4f76f2 Map the weird numeric escapes to textual ones 2025-03-26 02:34:21 +01:00
2bfd9f951e Fix up some more xml tests and other small bugs 2025-03-26 02:17:42 +01:00
e5092edf53 Implement parsing xml to and from lua
A lot more complex than json.........
2025-03-26 01:36:49 +01:00
e31c0e4e8f Implement xpath (by calling library) 2025-03-26 01:19:41 +01:00
73d93367a0 Refactor some things around a little 2025-03-25 23:16:03 +01:00
64f690f6b4 Fix usage to reflect recent flag changes 2025-03-25 23:02:32 +01:00
34477b2c34 Make readme and rework the flags a little 2025-03-25 22:55:01 +01:00
d5c08d86f5 Code polish 2025-03-25 19:22:44 +01:00
68127fe453 Add more json tests
To bring it in line with the xml ones
2025-03-25 19:22:07 +01:00
872f2dd46d Fix another changed test for json 2025-03-25 19:16:09 +01:00
4eed05c7c2 Fix some more minor bugs and tests 2025-03-25 19:14:21 +01:00
4640281fbf Enable root modifications
Though I can not see why you would want to.....
But there's no reason you would not be able to
2025-03-25 18:57:32 +01:00
aba10267d1 Fix more tests 2025-03-25 18:47:55 +01:00
fed140254b Fix some json tests 2025-03-25 18:32:51 +01:00
db92033642 Rework rounding and building lua script
To allow user script to specify what was modified where
2025-03-25 18:28:33 +01:00
1b0b198297 Add xpath tests 2025-03-25 17:56:48 +01:00
35 changed files with 6902 additions and 5680 deletions

2
.gitignore vendored
View File

@@ -1 +1,3 @@
*.exe
.qodo
*.sqlite

92
.vscode/launch.json vendored
View File

@@ -5,16 +5,98 @@
"version": "0.2.0",
"configurations": [
{
"name": "Launch Package",
"name": "Launch Package (Barotrauma)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"*.yml",
]
},
{
"name": "Launch Package (Payday 2)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
"args": [
"-loglevel",
"trace",
"*.yml",
]
},
{
"name": "Launch Package (Barotrauma cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"cookassistant.yml",
]
},
{
"name": "Launch Package (Quasimorph cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
"args": [
"cook.yml",
]
},
{
"name": "Launch Package (Rimworld cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
"args": [
"cookVehicles.yml",
]
},
{
"name": "Launch Package (Workspace)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"args": [
"-mode=json",
"$..name",
"v='pero'",
"test.json"
"tester.yml",
]
},
{
"name": "Launch Package (Avorion)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
"args": [
"*.yml",
]
},
{
"name": "Launch Package (Minecraft)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Minecraft",
"args": [
"cook_tacz.yml",
]
}
]

116
README.md Normal file
View File

@@ -0,0 +1,116 @@
# Big Chef
A Go-based tool for modifying XML, JSON, and text documents using XPath/JSONPath/Regex expressions and Lua transformations.
## Features
- **Multi-Format Processing**:
- XML (XPath)
- JSON (JSONPath)
- Text (Regex)
- **Node Value Modification**: Update text values in XML elements, JSON properties or text matches
- **Attribute Manipulation**: Modify XML attributes, JSON object keys or regex capture groups
- **Conditional Logic**: Apply transformations based on document content
- **Complex Operations**:
- Mathematical calculations
- String manipulations
- Date conversions
- Structural changes
- Whole ass Lua environment
- **Error Handling**: Comprehensive error detection for:
- Invalid XML/JSON
- Malformed XPath/JSONPath
- Lua syntax errors
## Usage Examples
### 1. Basic field modification
```xml
<!-- Input -->
<price>44.95</price>
<!-- Command -->
chef -xml "//price" "v=v*2" input.xml
<!-- Output -->
<price>89.9</price>
```
### 2. Supports glob patterns
```xml
chef -xml "//price" "v=v*2" data/**.xml
```
### 3. Attribute Update
```xml
<!-- Input -->
<item price="10.50"/>
<!-- Command -->
chef -xml "//item/@price" "v=v*2" input.xml
<!-- Output -->
<item price="21"/>
```
### 3. JSONPath Transformation
```json
// Input
{
"products": [
{"name": "Widget", "price": 19.99},
{"name": "Gadget", "price": 29.99}
]
}
// Command
chef -json "$.products[*].price" "v=v*0.75" input.json
// Output
{
"products": [
{"name": "Widget", "price": 14.99},
{"name": "Gadget", "price": 22.49}
]
}
```
### 4. Regex Text Replacement
Regex works slightly differently, up to 12 match groups are provided as v1..v12 and s1..s12 for numbers and strings respectively.
A special shorthand "!num" is also provided that simply expands to `(\d*\.?\d+)`.
```xml
<!-- Input -->
<description>Price: $15.00 Special Offer</description>
<!-- Command -->
chef "Price: $!num Special Offer" "v1 = v1 * 0.92" input.xml
<!-- Output -->
<description>Price: $13.80 Special Offer</description>
```
### 5. Conditional Transformation
```xml
<!-- Input -->
<item stock="5" price="10.00"/>
<!-- Command -->
chef -xml "//item" "if tonumber(v.stock) > 0 then v.price = v.price * 0.8 end" input.xml
<!-- Output -->
<item stock="5" price="8.00"/>
```
## Installation
```bash
go build -o chef main.go
```
```bash
# Process XML file
./chef -xml "//price" "v=v*1.2" input.xml
# Process JSON file
./chef -json "$.prices[*]" "v=v*0.9" input.json
```

View File

@@ -1,651 +0,0 @@
<?xml version="1.0" encoding="utf-8"?>
<Talents>
<Talent identifier="powerarmor">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.powerarmor">
<Replace tag="[bonusmovement]" value="25" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHasItem tags="deepdivinglarge" />
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
</Abilities>
</AbilityGroupInterval>
<AddedRecipe itemidentifier="exosuit"/>
</Talent>
<Talent identifier="foolhardy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="foolhardy" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="berserker">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="berserker" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="mudraptorwrestler">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.mudraptorwrestler">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattypeself">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData weapontype="NoWeapon,Melee" />
<AbilityConditionCharacter>
<Conditional group="eq mudraptor" />
</AbilityConditionCharacter>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="heavylifting">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.heavylifting">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHoldingItem tags="alienartifact,crate"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="iamthatguy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.iamthatguy">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.skillbonus">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
<Abilities>
<CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="heavywrench"/>
</Talent>
<Talent identifier="robotics">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.robotics"/>
<Description tag="talentdescription.roboticsreminder">
<Replace tag="[amount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="defensebotspawner"/>
<AddedRecipe itemidentifier="defensebotammobox"/>
</Talent>
<Talent identifier="ironstorm">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.ironstorm">
<Replace tag="[chance]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="scrapcannon"/>
</Talent>
<Talent identifier="residualwaste">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.residualwaste">
<Replace tag="[chance]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomChance="0.2"/>
<!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
<AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="massproduction">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.massproduction">
<Replace tag="[chance]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
<Conditions>
<AbilityConditionServerRandom randomChance="0.4" />
</Conditions>
<Abilities>
<CharacterAbilityRemoveRandomIngredient>
<AbilityConditionItem category="Material"/>
</CharacterAbilityRemoveRandomIngredient>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="toolmaintenance">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.toolmaintenance">
<Replace tag="[amount]" value="1" color="gui.green"/>
</Description>
<!-- Give once when unlocking the talent -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupEffect>
<!-- Give every 60 seconds for late comers -->
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="miner">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
<Description tag="talentdescription.miner">
<Replace tag="[probability]" value="320" color="gui.green"/>
</Description>
<Description tag="talentdescription.gainoredetachspeed">
<Replace tag="[amount]" value="1600" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomchance="12.8"/>
<AbilityConditionItem tags="ore"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="retrofit">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.retrofit" />
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ironman">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="ironhelmet"/>
<AddedRecipe itemidentifier="makeshiftarmor"/>
</Talent>
<Talent identifier="oiledmachinery">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.oiledmachinery">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="pumpndump">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.pumpndump">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<conditions>
<AbilityConditionItem tags="pump"/>
</conditions>
<Abilities>
<CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ballastdenizen">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.ballastdenizen">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="engineengineer">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.engineengineer">
<Replace tag="[amount]" value="2.5" color="gui.green"/>
<Replace tag="[max]" value="5" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="1" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="2" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="3" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="4" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="5" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="6" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="7" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel minlevel="8" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="multifunctional">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.multifunctional">
<Replace tag="[powerincrease]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="wrenchitem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="crowbaritem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="salvagecrew">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.bonusxponmission">
<Replace tag="[xpbonus]" value="30" color="gui.green"/>
<Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
</Description>
<Description tag="talentdescription.salvagecrew">
<Replace tag="[swimbonus]" value="50" color="gui.green"/>
<Replace tag="[resistanceamount]" value="10" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
<Conditions>
<AbilityConditionMission missiontype="Salvage"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="1.3"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionInSubmarine submarinetype="Wreck" />
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="This" disabledeltatime="true">
<Affliction identifier="salvagecrew" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.machinemaniac">
<Replace tag="[bonus]" value="80" color="gui.green"/>
<Replace tag="[amount]" value="3" color="gui.orange"/>
</Description>
<Description tag="talentdescription.machinemaniac.30">
<Replace tag="[requirement]" value="12" color="gui.green"/>
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
<Replace tag="[xpamount]" value="500" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.50">
<Replace tag="[requirement]" value="20" color="gui.green"/>
<Replace tag="[level]" value="1" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.100">
<Replace tag="[requirement]" value="40" color="gui.green"/>
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<!-- Give the player stats that tracks if the rewards should be given -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
</Conditions>
<Abilities>
<CharacterAbilityGiveExperience amount="2000"/>
<CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
</Conditions>
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="tinkerer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.increasemaxrepairmechanical">
<Replace tag="[percentage]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="modularrepairs">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
</Description>
<Description tag="talentdescription.freeupgrade">
<Replace tag="[level]" value="1" color="gui.green"/>
<Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="repairpack"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="hullfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="25" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="fixfoamgrenade"/>
<AddedRecipe itemidentifier="handheldstatusmonitor"/>
</Talent>
<Talent identifier="letitdrain">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.letitdrain"/>
<Description tag="talentdescription.letitdrainreminder">
<Replace tag="[itemcount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="portablepump"/>
</Talent>
<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="scrapsavant">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
<Description tag="talentdescription.doublescrapoutput" />
<Description tag="talentdescription.findadditionalscrap">
<Replace tag="[probability]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionItem tags="scrap"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
<Conditions>
<AbilityConditionItemInSubmarine submarinetype="Wreck"/>
<AbilityConditionItem tags="container"/>
</Conditions>
<Abilities>
<CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
<StatusEffects>
<StatusEffect type="OnAbility" target="UseTarget" >
<SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
</StatusEffect>
</StatusEffects>
</CharacterAbilitySpawnItemsToContainer>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="safetyfirst">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="safetyharness"/>
</Talent>
</Talents>

View File

@@ -0,0 +1,28 @@
package main
import (
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
)
func main() {
// Initialize logger with DEBUG level
logger.Init(logger.LevelDebug)
// Test different log levels
logger.Info("This is an info message")
logger.Debug("This is a debug message")
logger.Warning("This is a warning message")
logger.Error("This is an error message")
logger.Trace("This is a trace message (not visible at DEBUG level)")
// Test with a goroutine
logger.SafeGo(func() {
time.Sleep(10 * time.Millisecond)
logger.Info("Message from goroutine")
})
// Wait for goroutine to complete
time.Sleep(20 * time.Millisecond)
}

View File

@@ -1,6 +1,7 @@
package main
import (
"cook/utils"
"os"
"path/filepath"
"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
files, err := expandFilePatterns(tc.patterns)
// Convert string patterns to map[string]struct{} for ExpandGLobs
patternMap := make(map[string]struct{})
for _, pattern := range tc.patterns {
patternMap[pattern] = struct{}{}
}
files, err := utils.ExpandGLobs(patternMap)
if err != nil {
t.Fatalf("expandFilePatterns failed: %v", err)
t.Fatalf("ExpandGLobs failed: %v", err)
}
if len(files) != tc.expected {

34
go.mod
View File

@@ -1,20 +1,32 @@
module modify
module cook
go 1.24.1
go 1.23.2
require (
github.com/antchfx/xmlquery v1.4.4
git.site.quack-lab.dev/dave/cylogger v1.3.0
github.com/bmatcuk/doublestar/v4 v4.8.1
github.com/stretchr/testify v1.10.0
github.com/yuin/gopher-lua v1.1.1
gopkg.in/yaml.v3 v3.0.1
gorm.io/gorm v1.30.0
)
require (
github.com/PaesslerAG/gval v1.0.0 // indirect
github.com/PaesslerAG/jsonpath v0.1.1 // indirect
github.com/antchfx/xpath v1.3.3 // indirect
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da // indirect
github.com/sergi/go-diff v1.3.1 // indirect
github.com/stretchr/testify v1.10.0 // indirect
golang.org/x/net v0.33.0 // indirect
golang.org/x/text v0.21.0 // indirect
github.com/davecgh/go-spew v1.1.1 // indirect
github.com/google/go-cmp v0.6.0 // indirect
github.com/hexops/valast v1.5.0 // indirect
github.com/jinzhu/inflection v1.0.0 // indirect
github.com/jinzhu/now v1.1.5 // indirect
github.com/kr/pretty v0.3.1 // indirect
github.com/mattn/go-sqlite3 v1.14.22 // indirect
github.com/pmezard/go-difflib v1.0.0 // indirect
github.com/rogpeppe/go-internal v1.14.1 // indirect
golang.org/x/mod v0.21.0 // indirect
golang.org/x/sync v0.11.0 // indirect
golang.org/x/text v0.22.0 // indirect
golang.org/x/tools v0.26.0 // indirect
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
mvdan.cc/gofumpt v0.4.0 // indirect
)
require gorm.io/driver/sqlite v1.6.0

133
go.sum
View File

@@ -1,98 +1,59 @@
github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw=
git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk=
github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da h1:oI5xCqsCo564l8iNU+DwB5epxmsaqB+rhGL0m5jtYqE=
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE=
github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps=
github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM=
github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/sergi/go-diff v1.3.1 h1:xkr+Oxo4BOQKmkn/B9eMK0g5Kg/983T9DqqPHwYqD+8=
github.com/sergi/go-diff v1.3.1/go.mod h1:aMJSSKb2lpPvRNec0+w3fl7LP9IOFzdc9Pa4NFbPK1I=
github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs=
github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
golang.org/x/net v0.33.0 h1:74SYHlV8BIgHIFC/LrYkOGIwL19eTYXQ5wc6TBuO36I=
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo=
golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0=
golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY=
golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w=
golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ=
golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=

463
main.go
View File

@@ -3,57 +3,45 @@ package main
import (
"flag"
"fmt"
"log"
"os"
"sort"
"sync"
"time"
"github.com/bmatcuk/doublestar/v4"
"cook/processor"
"cook/utils"
"modify/processor"
"gopkg.in/yaml.v3"
logger "git.site.quack-lab.dev/dave/cylogger"
)
type GlobalStats struct {
TotalMatches int
TotalModifications int
ProcessedFiles int
FailedFiles int
TotalMatches int
TotalModifications int
ProcessedFiles int
FailedFiles int
ModificationsPerCommand sync.Map
}
type FileMode string
const (
ModeRegex FileMode = "regex"
ModeXML FileMode = "xml"
ModeJSON FileMode = "json"
)
var stats GlobalStats
var logger *log.Logger
var (
fileModeFlag = flag.String("mode", "regex", "Processing mode: regex, xml, json")
stats GlobalStats = GlobalStats{
ModificationsPerCommand: sync.Map{},
}
)
func init() {
log.SetFlags(log.Lmicroseconds | log.Lshortfile)
logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
stats = GlobalStats{}
}
func main() {
flag.Usage = func() {
CreateExampleConfig()
fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nOptions:\n")
fmt.Fprintf(os.Stderr, " -mode string\n")
fmt.Fprintf(os.Stderr, " Processing mode: regex, xml, json (default \"regex\")\n")
fmt.Fprintf(os.Stderr, " -reset\n")
fmt.Fprintf(os.Stderr, " Reset files to their original state\n")
fmt.Fprintf(os.Stderr, " -loglevel string\n")
fmt.Fprintf(os.Stderr, " Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
fmt.Fprintf(os.Stderr, "\nExamples:\n")
fmt.Fprintf(os.Stderr, " Regex mode (default):\n")
fmt.Fprintf(os.Stderr, " %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " XML mode:\n")
fmt.Fprintf(os.Stderr, " %s -mode=xml -xpath=\"//value\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " JSON mode:\n")
fmt.Fprintf(os.Stderr, " %s -mode=json -jsonpath=\"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
fmt.Fprintf(os.Stderr, " s1, s2, etc. are used to refer to capture groups as strings.\n")
fmt.Fprintf(os.Stderr, " Helper functions: num(str) converts string to number, str(num) converts number to string\n")
@@ -62,107 +50,372 @@ func main() {
fmt.Fprintf(os.Stderr, " You can use any valid Lua code, including if statements, loops, etc.\n")
fmt.Fprintf(os.Stderr, " Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
}
// TODO: Fix bed shitting when doing *.yml in barotrauma directory
flag.Parse()
args := flag.Args()
if len(args) < 3 {
fmt.Fprintf(os.Stderr, "%s mode requires %d arguments minimum\n", *fileModeFlag, 3)
logger.InitFlag()
logger.Info("Initializing with log level: %s", logger.GetLevel().String())
if flag.NArg() == 0 {
flag.Usage()
return
}
// Get the appropriate pattern and expression based on mode
var pattern, luaExpr string
var filePatterns []string
pattern = args[0]
luaExpr = args[1]
filePatterns = args[2:]
// Prepare the Lua expression
originalLuaExpr := luaExpr
luaExpr = processor.BuildLuaScript(luaExpr)
if originalLuaExpr != luaExpr {
logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
}
// Expand file patterns with glob support
files, err := expandFilePatterns(filePatterns)
db, err := utils.GetDB()
if err != nil {
fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
logger.Error("Failed to get database: %v", err)
return
}
if len(files) == 0 {
fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
workdone, err := HandleSpecialArgs(args, err, db)
if err != nil {
logger.Error("Failed to handle special args: %v", err)
return
}
if workdone {
return
}
// Create the processor based on mode
var proc processor.Processor
switch *fileModeFlag {
case "regex":
proc = &processor.RegexProcessor{}
logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
pattern, luaExpr, len(files))
// case "xml":
// proc = &processor.XMLProcessor{}
// pattern = *xpathFlag
// logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
// pattern, luaExpr, len(files))
case "json":
proc = &processor.JSONProcessor{}
logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
pattern, luaExpr, len(files))
// The plan is:
// Load all commands
commands, err := utils.LoadCommands(args)
if err != nil || len(commands) == 0 {
logger.Error("Failed to load commands: %v", err)
flag.Usage()
return
}
var wg sync.WaitGroup
// Process each file
for _, file := range files {
wg.Add(1)
go func(file string) {
defer wg.Done()
logger.Printf("Processing file: %s", file)
if *utils.Filter != "" {
logger.Info("Filtering commands by name: %s", *utils.Filter)
commands = utils.FilterCommands(commands, *utils.Filter)
logger.Info("Filtered %d commands", len(commands))
}
modCount, matchCount, err := proc.Process(file, pattern, luaExpr)
if err != nil {
fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
stats.FailedFiles++
// Then aggregate all the globs and deduplicate them
globs := utils.AggregateGlobs(commands)
logger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
for _, command := range commands {
logger.Trace("Command: %s", command.Name)
logger.Trace("Regex: %s", command.Regex)
logger.Trace("Files: %v", command.Files)
logger.Trace("Lua: %s", command.Lua)
logger.Trace("Reset: %t", command.Reset)
logger.Trace("Isolate: %t", command.Isolate)
logger.Trace("LogLevel: %s", command.LogLevel)
}
// Resolve all the files for all the globs
logger.Info("Found %d unique file patterns", len(globs))
files, err := utils.ExpandGLobs(globs)
if err != nil {
logger.Error("Failed to expand file patterns: %v", err)
return
}
logger.Info("Found %d files to process", len(files))
// Somehow connect files to commands via globs..
// For each file check every glob of every command
// Maybe memoize this part
// That way we know what commands affect what files
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
logger.Error("Failed to associate files with commands: %v", err)
return
}
err = utils.ResetWhereNecessary(associations, db)
if err != nil {
logger.Error("Failed to reset files where necessary: %v", err)
return
}
// Then for each file run all commands associated with the file
workers := make(chan struct{}, *utils.ParallelFiles)
wg := sync.WaitGroup{}
// Add performance tracking
startTime := time.Now()
var fileMutex sync.Mutex
// Create a map to store loggers for each command
commandLoggers := make(map[string]*logger.Logger)
for _, command := range commands {
// Create a named logger for each command
cmdName := command.Name
if cmdName == "" {
// If no name is provided, use a short version of the regex pattern
if len(command.Regex) > 20 {
cmdName = command.Regex[:17] + "..."
} else {
logger.Printf("Successfully processed file: %s", file)
stats.ProcessedFiles++
stats.TotalMatches += matchCount
stats.TotalModifications += modCount
cmdName = command.Regex
}
}(file)
}
// Parse the log level for this specific command
cmdLogLevel := logger.ParseLevel(command.LogLevel)
// Create a logger with the command name as a field
commandLoggers[command.Name] = logger.WithField("command", cmdName)
commandLoggers[command.Name].SetLevel(cmdLogLevel)
logger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
}
for file, association := range associations {
workers <- struct{}{}
wg.Add(1)
logger.SafeGoWithArgs(func(args ...interface{}) {
defer func() { <-workers }()
defer wg.Done()
// Track per-file processing time
fileStartTime := time.Now()
logger.Debug("Reading file %q", file)
fileData, err := os.ReadFile(file)
if err != nil {
logger.Error("Failed to read file %q: %v", file, err)
return
}
fileDataStr := string(fileData)
logger.Debug("Saving file %q to database", file)
err = db.SaveFile(file, fileData)
if err != nil {
logger.Error("Failed to save file %q to database: %v", file, err)
return
}
logger.Debug("Running isolate commands for file %q", file)
fileDataStr, err = RunIsolateCommands(association, file, fileDataStr, &fileMutex)
if err != nil {
logger.Error("Failed to run isolate commands for file %q: %v", file, err)
return
}
logger.Debug("Running other commands for file %q", file)
fileDataStr, err = RunOtherCommands(file, fileDataStr, association, &fileMutex, commandLoggers)
if err != nil {
logger.Error("Failed to run other commands for file %q: %v", file, err)
return
}
logger.Debug("Writing file %q", file)
err = os.WriteFile(file, []byte(fileDataStr), 0644)
if err != nil {
logger.Error("Failed to write file %q: %v", file, err)
return
}
logger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
}, file, commands)
}
wg.Wait()
processingTime := time.Since(startTime)
logger.Info("Processing completed in %v", processingTime)
if stats.ProcessedFiles > 0 {
logger.Info("Average time per file: %v", processingTime/time.Duration(stats.ProcessedFiles))
}
// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
// Do that with logger.WithField("loglevel", level.String())
// Since each command also has its own log level
// TODO: Maybe even figure out how to run individual commands...?
// TODO: What to do with git? Figure it out ....
// if *gitFlag {
// logger.Info("Git integration enabled, setting up git repository")
// err := setupGit()
// if err != nil {
// logger.Error("Failed to setup git: %v", err)
// fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
// return
// }
// }
// logger.Debug("Expanding file patterns")
// files, err := expandFilePatterns(filePatterns)
// if err != nil {
// logger.Error("Failed to expand file patterns: %v", err)
// fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
// return
// }
// if *gitFlag {
// logger.Info("Cleaning up git files before processing")
// err := cleanupGitFiles(files)
// if err != nil {
// logger.Error("Failed to cleanup git files: %v", err)
// fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
// return
// }
// }
// if *resetFlag {
// logger.Info("Files reset to their original state, nothing more to do")
// log.Printf("Files reset to their original state, nothing more to do")
// return
// }
// Print summary
if stats.TotalModifications == 0 {
fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
logger.Warning("No modifications were made in any files")
} else {
fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
logger.Info("Operation complete! Modified %d values in %d/%d files",
stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
}
}
sortedCommands := []string{}
stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
sortedCommands = append(sortedCommands, key.(string))
return true
})
sort.Strings(sortedCommands)
func expandFilePatterns(patterns []string) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
for _, pattern := range patterns {
matches, _ := doublestar.Glob(os.DirFS("."), pattern)
for _, m := range matches {
if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
filesMap[m], files = true, append(files, m)
for _, command := range sortedCommands {
count, _ := stats.ModificationsPerCommand.Load(command)
if count.(int) > 0 {
logger.Info("\tCommand %q made %d modifications", command, count)
} else {
logger.Warning("\tCommand %q made no modifications", command)
}
}
}
if len(files) > 0 {
logger.Printf("Found %d files to process", len(files))
}
return files, nil
}
func HandleSpecialArgs(args []string, err error, db utils.DB) (bool, error) {
switch args[0] {
case "reset":
err = utils.ResetAllFiles(db)
if err != nil {
logger.Error("Failed to reset all files: %v", err)
return true, err
}
logger.Info("All files reset")
return true, nil
case "dump":
err = db.RemoveAllFiles()
if err != nil {
logger.Error("Failed to remove all files from database: %v", err)
return true, err
}
logger.Info("All files removed from database")
return true, nil
}
return false, nil
}
func CreateExampleConfig() {
commands := []utils.ModifyCommand{
{
Name: "DoubleNumericValues",
Regex: "<value>(\\d+)</value>",
Lua: "v1 * 2",
Files: []string{"data/*.xml"},
LogLevel: "INFO",
},
{
Name: "UpdatePrices",
Regex: "price=\"(\\d+)\"",
Lua: "if num(v1) < 100 then return v1 * 1.5 else return v1 end",
Files: []string{"items/*.xml", "shop/*.xml"},
LogLevel: "DEBUG",
},
{
Name: "IsolatedTagUpdate",
Regex: "<tag>(.*?)</tag>",
Lua: "string.upper(s1)",
Files: []string{"config.xml"},
Isolate: true,
NoDedup: true,
LogLevel: "TRACE",
},
}
data, err := yaml.Marshal(commands)
if err != nil {
logger.Error("Failed to marshal example config: %v", err)
return
}
err = os.WriteFile("example_cook.yml", data, 0644)
if err != nil {
logger.Error("Failed to write example_cook.yml: %v", err)
return
}
logger.Info("Wrote example_cook.yml")
}
func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, fileMutex *sync.Mutex, commandLoggers map[string]*logger.Logger) (string, error) {
// Aggregate all the modifications and execute them
modifications := []utils.ReplaceCommand{}
for _, command := range association.Commands {
// Use command-specific logger if available, otherwise fall back to default logger
cmdLogger := logger.Default
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
}
cmdLogger.Info("Processing file %q with command %q", file, command.Regex)
newModifications, err := processor.ProcessRegex(fileDataStr, command, file)
if err != nil {
logger.Error("Failed to process file %q with command %q: %v", file, command.Regex, err)
continue
}
modifications = append(modifications, newModifications...)
// It is not guranteed that all the commands will be executed...
// TODO: Make this better
// We'd have to pass the map to executemodifications or something...
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
cmdLogger.Debug("Command %q generated %d modifications", command.Name, len(newModifications))
}
if len(modifications) == 0 {
logger.Warning("No modifications found for file %q", file)
return fileDataStr, nil
}
// Sort commands in reverse order for safe replacements
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
fileMutex.Lock()
stats.ProcessedFiles++
stats.TotalModifications += count
fileMutex.Unlock()
logger.Info("Executed %d modifications for file %q", count, file)
return fileDataStr, nil
}
func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string, fileMutex *sync.Mutex) (string, error) {
for _, isolateCommand := range association.IsolateCommands {
logger.Info("Processing file %q with isolate command %q", file, isolateCommand.Regex)
modifications, err := processor.ProcessRegex(fileDataStr, isolateCommand, file)
if err != nil {
logger.Error("Failed to process file %q with isolate command %q: %v", file, isolateCommand.Regex, err)
continue
}
if len(modifications) == 0 {
logger.Warning("No modifications found for file %q", file)
continue
}
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
fileMutex.Lock()
stats.ProcessedFiles++
stats.TotalModifications += count
fileMutex.Unlock()
logger.Info("Executed %d isolate modifications for file %q", count, file)
}
return fileDataStr, nil
}

View File

@@ -1,189 +0,0 @@
package processor
import (
"encoding/json"
"fmt"
"log"
"modify/processor/jsonpath"
"os"
"path/filepath"
"strings"
lua "github.com/yuin/gopher-lua"
)
// JSONProcessor implements the Processor interface for JSON documents
type JSONProcessor struct{}
// Process implements the Processor interface for JSONProcessor
func (p *JSONProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
// Read file content
cwd, err := os.Getwd()
if err != nil {
return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
}
fullPath := filepath.Join(cwd, filename)
content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ProcessContent implements the Processor interface for JSONProcessor
func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse JSON document
var jsonData interface{}
err := json.Unmarshal([]byte(content), &jsonData)
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
}
// Find nodes matching the JSONPath pattern
nodes, err := jsonpath.Get(jsonData, pattern)
if err != nil {
return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
for _, node := range nodes {
log.Printf("Processing node at path: %s with value: %v", node.Path, node.Value)
// Initialize Lua
L, err := NewLuaState()
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
log.Println("Lua state initialized successfully.")
err = p.ToLua(L, node.Value)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
}
log.Printf("Converted node value to Lua: %v", node.Value)
// Execute Lua script
log.Printf("Executing Lua script: %s", luaExpr)
if err := L.DoString(luaExpr); err != nil {
return content, len(nodes), 0, fmt.Errorf("error executing Lua %s: %v", luaExpr, err)
}
log.Println("Lua script executed successfully.")
// Get modified value
result, err := p.FromLua(L)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
}
log.Printf("Retrieved modified value from Lua: %v", result)
// Apply the modification to the JSON data
err = p.updateJSONValue(jsonData, node.Path, result)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
}
log.Printf("Updated JSON at path: %s with new value: %v", node.Path, result)
}
// Convert the modified JSON back to a string with same formatting
var jsonBytes []byte
if indent, err := detectJsonIndentation(content); err == nil && indent != "" {
// Use detected indentation for output formatting
jsonBytes, err = json.MarshalIndent(jsonData, "", indent)
} else {
// Fall back to standard 2-space indent
jsonBytes, err = json.MarshalIndent(jsonData, "", " ")
}
// We changed all the nodes trust me bro
return string(jsonBytes), len(nodes), len(nodes), nil
}
// detectJsonIndentation tries to determine the indentation used in the original JSON
func detectJsonIndentation(content string) (string, error) {
lines := strings.Split(content, "\n")
if len(lines) < 2 {
return "", fmt.Errorf("not enough lines to detect indentation")
}
// Look for the first indented line
for i := 1; i < len(lines); i++ {
line := lines[i]
trimmed := strings.TrimSpace(line)
if trimmed == "" {
continue
}
// Calculate leading whitespace
indent := line[:len(line)-len(trimmed)]
if len(indent) > 0 {
return indent, nil
}
}
return "", fmt.Errorf("no indentation detected")
}
// / Selects from the root node
// // Selects nodes in the document from the current node that match the selection no matter where they are
// . Selects the current node
// @ Selects attributes
// /bookstore/* Selects all the child element nodes of the bookstore element
// //* Selects all elements in the document
// /bookstore/book[1] Selects the first book element that is the child of the bookstore element.
// /bookstore/book[last()] Selects the last book element that is the child of the bookstore element
// /bookstore/book[last()-1] Selects the last but one book element that is the child of the bookstore element
// /bookstore/book[position()<3] Selects the first two book elements that are children of the bookstore element
// //title[@lang] Selects all the title elements that have an attribute named lang
// //title[@lang='en'] Selects all the title elements that have a "lang" attribute with a value of "en"
// /bookstore/book[price>35.00] Selects all the book elements of the bookstore element that have a price element with a value greater than 35.00
// /bookstore/book[price>35.00]/title Selects all the title elements of the book elements of the bookstore element that have a price element with a value greater than 35.00
// updateJSONValue updates a value in the JSON structure based on its JSONPath
func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
err := jsonpath.Set(jsonData, path, newValue)
if err != nil {
return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
}
return nil
}
// ToLua converts JSON values to Lua variables
func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
table, err := ToLua(L, data)
if err != nil {
return err
}
L.SetGlobal("v", table)
return nil
}
// FromLua retrieves values from Lua
func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
luaValue := L.GetGlobal("v")
return FromLua(L, luaValue)
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,495 +0,0 @@
package jsonpath
import (
"fmt"
"strconv"
)
// JSONStep represents a single step in a JSONPath query
type JSONStep struct {
Type StepType
Key string // For Child/RecursiveDescent
Index int // For Index (use -1 for wildcard "*")
}
// JSONNode represents a value in the JSON data with its path
type JSONNode struct {
Value interface{} // The value found at the path
Path string // The exact JSONPath where the value was found
}
// StepType defines the types of steps in a JSONPath
type StepType int
const (
RootStep StepType = iota // $ - The root element
ChildStep // .key - Direct child access
RecursiveDescentStep // ..key - Recursive search for key
WildcardStep // .* - All children of an object
IndexStep // [n] - Array index access (or [*] for all elements)
)
// TraversalMode determines how the traversal behaves
type TraversalMode int
const (
CollectMode TraversalMode = iota // Just collect matched nodes
ModifyFirstMode // Modify first matching node
ModifyAllMode // Modify all matching nodes
)
// ParseJSONPath parses a JSONPath string into a sequence of steps
func ParseJSONPath(path string) ([]JSONStep, error) {
if len(path) == 0 || path[0] != '$' {
return nil, fmt.Errorf("path must start with $; received: %q", path)
}
steps := []JSONStep{}
i := 0
for i < len(path) {
switch path[i] {
case '$':
steps = append(steps, JSONStep{Type: RootStep})
i++
case '.':
i++
if i < len(path) && path[i] == '.' {
// Recursive descent
i++
key, nextPos := readKey(path, i)
steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
i = nextPos
} else {
// Child step or wildcard
key, nextPos := readKey(path, i)
if key == "*" {
steps = append(steps, JSONStep{Type: WildcardStep})
} else {
steps = append(steps, JSONStep{Type: ChildStep, Key: key})
}
i = nextPos
}
case '[':
// Index step
i++
indexStr, nextPos := readIndex(path, i)
if indexStr == "*" {
steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
} else {
index, err := strconv.Atoi(indexStr)
if err != nil {
return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
}
steps = append(steps, JSONStep{Type: IndexStep, Index: index})
}
i = nextPos + 1 // Skip closing ]
default:
return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
}
}
return steps, nil
}
// readKey extracts a key name from the path
func readKey(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == '.' || path[i] == '[' {
break
}
}
return path[start:i], i
}
// readIndex extracts an array index or wildcard from the path
func readIndex(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == ']' {
break
}
}
return path[start:i], i
}
// Get retrieves values with their paths from data at the specified JSONPath
// Each returned JSONNode contains both the value and its exact path in the data structure
func Get(data interface{}, path string) ([]JSONNode, error) {
steps, err := ParseJSONPath(path)
if err != nil {
return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
results := []JSONNode{}
err = traverseWithPaths(data, steps, &results, "$")
if err != nil {
return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
}
return results, nil
}
// Set updates the value at the specified JSONPath in the original data structure.
// It only modifies the first matching node.
func Set(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
if len(steps) <= 1 {
return fmt.Errorf("cannot set root node; the provided path %q is invalid", path)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// SetAll updates all matching values at the specified JSONPath.
func SetAll(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
if len(steps) <= 1 {
return fmt.Errorf("cannot set root node; the provided path %q is invalid", path)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// setWithPath modifies values while tracking paths
func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
if node == nil || *success && mode == ModifyFirstMode {
return nil
}
// Skip root step
actualSteps := steps
if len(steps) > 0 && steps[0].Type == RootStep {
if len(steps) == 1 {
return fmt.Errorf("cannot set root node; the provided path %q is invalid", currentPath)
}
actualSteps = steps[1:]
}
// Process the first step
if len(actualSteps) == 0 {
return fmt.Errorf("cannot set root node; no steps provided for path %q", currentPath)
}
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
childPath := currentPath + "." + step.Key
if isLastStep {
// We've reached the target, set the value
m[step.Key] = value
*success = true
return nil
}
// Create intermediate nodes if necessary
child, exists := m[step.Key]
if !exists {
// Create missing intermediate node
if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
child = []interface{}{}
} else {
child = map[string]interface{}{}
}
m[step.Key] = child
}
err := setWithPath(child, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
arr[i] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
arr[step.Index] = value
*success = true
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
}
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
m[step.Key] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(val, remainingSteps, success, value, directPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
// Skip keys we've already processed directly
if step.Key != "*" && k == step.Key {
continue
}
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
m[k] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(v, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
return nil
}
// traverseWithPaths tracks both nodes and their paths during traversal
func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
if len(steps) == 0 || node == nil {
return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
}
// Skip root step
actualSteps := steps
if steps[0].Type == RootStep {
if len(steps) == 1 {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
return nil
}
actualSteps = steps[1:]
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
child, exists := m[step.Key]
if !exists {
return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
}
childPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: child, Path: childPath})
} else {
err := traverseWithPaths(child, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node is not an array; actual type: %T", node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
} else {
return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: val, Path: directPath})
} else {
err := traverseWithPaths(val, remainingSteps, results, directPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
}
}
}
}
// For wildcard, collect this node
if step.Key == "*" && isLastStep {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
*results = append(*results, JSONNode{Value: v, Path: childPath})
} else {
err := traverseWithPaths(v, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
}
return nil
}

View File

@@ -1,577 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
func TestGetWithPathsBasic(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
error bool
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
{
name: "nonexistent path",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
},
path: "$.user.email",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
if !tt.error {
t.Errorf("GetWithPaths() returned error: %v", err)
}
return
}
// For nonexistent path, we expect empty slice
if tt.name == "nonexistent path" {
if len(result) > 0 {
t.Errorf("GetWithPaths() returned %v, expected empty result", result)
}
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For wildcard results, we need to check containment rather than exact order
if tt.name == "wildcard" || tt.name == "recursive descent" {
// For each expected item, check if it exists in the results by both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
found = true
break
}
}
if !found {
t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
}
}
} else {
// Otherwise check exact equality of both values and paths
for i, expected := range tt.expected {
if !reflect.DeepEqual(result[i].Value, expected.Value) {
t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
}
if result[i].Path != expected.Path {
t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := Set(data, "$.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("nested property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
}
err := Set(data, "$.user.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
user, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user["name"] != "Jane" {
t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
}
})
t.Run("array element", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
}
err := Set(data, "$.users[0].name", "Bob")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user0["name"] != "Bob" {
t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
}
})
t.Run("complex value", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
}
newProfile := map[string]interface{}{
"email": "john.doe@example.com",
"phone": "123-456-7890",
}
err := Set(data, "$.user.profile", newProfile)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
profile, ok := userMap["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Profile is not a map")
}
if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
t.Errorf("Set() failed: expected profile to be updated with new values")
}
})
t.Run("create new property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if email, exists := userMap["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
}
})
t.Run("create nested properties", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.contact.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
contact, ok := userMap["contact"].(map[string]interface{})
if !ok {
t.Fatalf("Contact is not a map")
}
if email, exists := contact["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
}
})
t.Run("create array and element", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
// This should create an empty addresses array, but won't be able to set index 0
// since the array is empty
err := Set(data, "$.user.addresses[0].street", "123 Main St")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
})
t.Run("multiple targets (should only update first)", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := Set(data, "$.users[*].active", false)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User0 is not a map")
}
user1, ok := users[1].(map[string]interface{})
if !ok {
t.Fatalf("User1 is not a map")
}
// Only the first one should be changed
if active, exists := user0["active"]; !exists || active != false {
t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
}
// The second one should remain unchanged
if active, exists := user1["active"]; !exists || active != true {
t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
}
})
t.Run("setting on root should fail", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
}
err := Set(data, "$", "Jane")
if err == nil {
t.Errorf("Set() returned no error, expected error for setting on root")
return
}
// Data should be unchanged
if data["name"] != "John" {
t.Errorf("Data was modified when setting on root")
}
})
}
func TestSetAll(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := SetAll(data, "$.name", "Jane")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("all array elements", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := SetAll(data, "$.users[*].active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
// Both elements should be updated
for i, user := range users {
userMap, ok := user.(map[string]interface{})
if !ok {
t.Fatalf("User%d is not a map", i)
}
if active, exists := userMap["active"]; !exists || active != false {
t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
}
}
})
t.Run("recursive descent", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
"admin": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
}
err := SetAll(data, "$..active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Check user profile
userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access user.profile")
}
if active, exists := userProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
}
// Check admin profile
adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access admin.profile")
}
if active, exists := adminProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
}
})
}
func TestGetWithPathsExtended(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
t.Errorf("GetWithPaths() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// Check if value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Check if path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -1,318 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
var testData = map[string]interface{}{
"store": map[string]interface{}{
"book": []interface{}{
map[string]interface{}{
"title": "The Fellowship of the Ring",
"price": 22.99,
},
map[string]interface{}{
"title": "The Two Towers",
"price": 23.45,
},
},
"bicycle": map[string]interface{}{
"color": "red",
"price": 199.95,
},
},
}
func TestParser(t *testing.T) {
tests := []struct {
path string
steps []JSONStep
wantErr bool
}{
{
path: "$.store.bicycle.color",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "bicycle"},
{Type: ChildStep, Key: "color"},
},
},
{
path: "$..price",
steps: []JSONStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Key: "price"},
},
},
{
path: "$.store.book[*].title",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: -1}, // Wildcard
{Type: ChildStep, Key: "title"},
},
},
{
path: "$.store.book[0]",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: 0},
},
},
{
path: "invalid.path",
wantErr: true,
},
{
path: "$.store.book[abc]",
wantErr: true,
},
}
for _, tt := range tests {
t.Run(tt.path, func(t *testing.T) {
steps, err := ParseJSONPath(tt.path)
if (err != nil) != tt.wantErr {
t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
}
if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
}
})
}
}
func TestEvaluator(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
error bool
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
{
name: "wildcard_recursive",
path: "$..*",
expected: []JSONNode{
// These will be compared by value only, paths will be validated separately
{Value: testData["store"].(map[string]interface{})["book"]},
{Value: testData["store"].(map[string]interface{})["bicycle"]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
{Value: "The Fellowship of the Ring"},
{Value: 22.99},
{Value: "The Two Towers"},
{Value: 23.45},
{Value: "red"},
{Value: 199.95},
},
},
{
name: "invalid_index",
path: "$.store.book[5]",
expected: []JSONNode{},
error: true,
},
{
name: "nonexistent_property",
path: "$.store.nonexistent",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Use GetWithPaths directly
result, err := Get(testData, tt.path)
if err != nil {
if !tt.error {
t.Errorf("Get() returned error: %v", err)
}
return
}
// Special handling for wildcard recursive test
if tt.name == "wildcard_recursive" {
// Skip length check for wildcard recursive since it might vary
// Just verify that each expected item is in the results
// Validate values match and paths are filled in
for _, e := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, e.Value) {
found = true
break
}
}
if !found {
t.Errorf("Expected value %v not found in results", e.Value)
}
}
return
}
if len(result) != len(tt.expected) {
t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
}
// Validate both values and paths
for i, e := range tt.expected {
if i < len(result) {
if !reflect.DeepEqual(result[i].Value, e.Value) {
t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
}
if result[i].Path != e.Path {
t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
}
}
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("empty_data", func(t *testing.T) {
result, err := Get(nil, "$.a.b")
if err == nil {
t.Errorf("Expected error for empty data")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("empty_path", func(t *testing.T) {
_, err := ParseJSONPath("")
if err == nil {
t.Error("Expected error for empty path")
}
})
t.Run("numeric_keys", func(t *testing.T) {
data := map[string]interface{}{
"42": "answer",
}
result, err := Get(data, "$.42")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) == 0 || result[0].Value != "answer" {
t.Errorf("Expected 'answer', got %v", result)
}
})
}
func TestGetWithPaths(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(testData, tt.path)
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// First verify the value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Then verify the path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -2,116 +2,136 @@ package processor
import (
"fmt"
"strconv"
"io"
"net/http"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua"
)
// Processor defines the interface for all file processors
type Processor interface {
// Process handles processing a file with the given pattern and Lua expression
Process(filename string, pattern string, luaExpr string) (int, int, error)
// ProcessContent handles processing a string content directly with the given pattern and Lua expression
// Returns the modified content, modification count, match count, and any error
ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
// ToLua converts processor-specific data to Lua variables
ToLua(L *lua.LState, data interface{}) error
// FromLua retrieves modified data from Lua
FromLua(L *lua.LState) (interface{}, error)
}
// ModificationRecord tracks a single value modification
type ModificationRecord struct {
File string
OldValue string
NewValue string
Operation string
Context string
}
// Maybe we make this an interface again for the shits and giggles
// We will see, it could easily be...
func NewLuaState() (*lua.LState, error) {
L := lua.NewState()
// defer L.Close()
// Load math library
logger.Debug("Loading Lua math library")
L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil {
logger.Error("Failed to load Lua math library: %v", err)
return nil, fmt.Errorf("error loading Lua math library: %v", err)
}
// Initialize helper functions
logger.Debug("Initializing Lua helper functions")
if err := InitLuaHelpers(L); err != nil {
logger.Error("Failed to initialize Lua helper functions: %v", err)
return nil, err
}
return L, nil
}
// ToLua converts a struct or map to a Lua table recursively
func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
switch v := data.(type) {
case map[string]interface{}:
luaTable := L.NewTable()
for key, value := range v {
luaValue, err := ToLua(L, value)
if err != nil {
return nil, err
}
luaTable.RawSetString(key, luaValue)
}
return luaTable, nil
case []interface{}:
luaTable := L.NewTable()
for i, value := range v {
luaValue, err := ToLua(L, value)
if err != nil {
return nil, err
}
luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
}
return luaTable, nil
case string:
return lua.LString(v), nil
case bool:
return lua.LBool(v), nil
case float64:
return lua.LNumber(v), nil
default:
return nil, fmt.Errorf("unsupported data type: %T", data)
}
}
// func Process(filename string, pattern string, luaExpr string) (int, int, error) {
// logger.Debug("Processing file %q with pattern %q", filename, pattern)
//
// // Read file content
// cwd, err := os.Getwd()
// if err != nil {
// logger.Error("Failed to get current working directory: %v", err)
// return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
// }
//
// fullPath := filepath.Join(cwd, filename)
// logger.Trace("Reading file from: %s", fullPath)
//
// stat, err := os.Stat(fullPath)
// if err != nil {
// logger.Error("Failed to stat file %s: %v", fullPath, err)
// return 0, 0, fmt.Errorf("error getting file info: %v", err)
// }
// logger.Debug("File size: %d bytes, modified: %s", stat.Size(), stat.ModTime().Format(time.RFC3339))
//
// content, err := os.ReadFile(fullPath)
// if err != nil {
// logger.Error("Failed to read file %s: %v", fullPath, err)
// return 0, 0, fmt.Errorf("error reading file: %v", err)
// }
//
// fileContent := string(content)
// logger.Trace("File read successfully: %d bytes, hash: %x", len(content), md5sum(content))
//
// // Detect and log file type
// fileType := detectFileType(filename, fileContent)
// if fileType != "" {
// logger.Debug("Detected file type: %s", fileType)
// }
//
// // Process the content
// logger.Debug("Starting content processing")
// modifiedContent, modCount, matchCount, err := ProcessContent(fileContent, pattern, luaExpr)
// if err != nil {
// logger.Error("Processing error: %v", err)
// return 0, 0, err
// }
//
// logger.Debug("Processing results: %d matches, %d modifications", matchCount, modCount)
//
// // If we made modifications, save the file
// if modCount > 0 {
// // Calculate changes summary
// changePercent := float64(len(modifiedContent)) / float64(len(fileContent)) * 100
// logger.Info("File size change: %d → %d bytes (%.1f%%)",
// len(fileContent), len(modifiedContent), changePercent)
//
// logger.Debug("Writing modified content to %s", fullPath)
// err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
// if err != nil {
// logger.Error("Failed to write to file %s: %v", fullPath, err)
// return 0, 0, fmt.Errorf("error writing file: %v", err)
// }
// logger.Debug("File written successfully, new hash: %x", md5sum([]byte(modifiedContent)))
// } else if matchCount > 0 {
// logger.Debug("No content modifications needed for %d matches", matchCount)
// } else {
// logger.Debug("No matches found in file")
// }
//
// return modCount, matchCount, nil
// }
// FromLua converts a Lua table to a struct or map recursively
func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
switch v := luaValue.(type) {
// Well shit...
// Tables in lua are both maps and arrays
// As arrays they are ordered and as maps, obviously, not
// So when we parse them to a go map we fuck up the order for arrays
// We have to find a better way....
case *lua.LTable:
result := make(map[string]interface{})
v.ForEach(func(key lua.LValue, value lua.LValue) {
result[key.String()], _ = FromLua(L, value)
})
// This may be a bit wasteful...
// Hopefully it won't run often enough to matter
isArray := true
for key := range result {
_, err := strconv.Atoi(key)
if err != nil {
isArray = false
break
}
isArray, err := IsLuaTableArray(L, v)
if err != nil {
return nil, err
}
if isArray {
list := make([]interface{}, 0, len(result))
for _, value := range result {
list = append(list, value)
}
return list, nil
result := make([]interface{}, 0)
v.ForEach(func(key lua.LValue, value lua.LValue) {
converted, _ := FromLua(L, value)
result = append(result, converted)
})
return result, nil
} else {
result := make(map[string]interface{})
v.ForEach(func(key lua.LValue, value lua.LValue) {
converted, _ := FromLua(L, value)
result[key.String()] = converted
})
return result, nil
}
return result, nil
case lua.LString:
return string(v), nil
case lua.LBool:
@@ -123,17 +143,75 @@ func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
}
}
func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
logger.Trace("Checking if Lua table is an array")
L.SetGlobal("table_to_check", v)
// Use our predefined helper function from InitLuaHelpers
err := L.DoString(`is_array = isArray(table_to_check)`)
if err != nil {
logger.Error("Error determining if table is an array: %v", err)
return false, fmt.Errorf("error determining if table is array: %w", err)
}
// Check the result of our Lua function
isArray := L.GetGlobal("is_array")
// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
result := !lua.LVIsFalse(isArray)
logger.Trace("Lua table is array: %v", result)
return result, nil
}
// InitLuaHelpers initializes common Lua helper functions
func InitLuaHelpers(L *lua.LState) error {
logger.Debug("Loading Lua helper functions")
helperScript := `
-- Custom Lua helpers for math operations
function min(a, b) return math.min(a, b) end
function max(a, b) return math.max(a, b) end
function round(x) return math.floor(x + 0.5) end
function round(x, n)
if n == nil then n = 0 end
return math.floor(x * 10^n + 0.5) / 10^n
end
function floor(x) return math.floor(x) end
function ceil(x) return math.ceil(x) end
function upper(s) return string.upper(s) end
function lower(s) return string.lower(s) end
function format(s, ...) return string.format(s, ...) end
function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
-- String split helper
function strsplit(inputstr, sep)
if sep == nil then
sep = "%s"
end
local t = {}
for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
table.insert(t, str)
end
return t
end
---@param table table
---@param depth number?
function DumpTable(table, depth)
if depth == nil then
depth = 0
end
if (depth > 200) then
print("Error: Depth > 200 in dumpTable()")
return
end
for k, v in pairs(table) do
if (type(v) == "table") then
print(string.rep(" ", depth) .. k .. ":")
DumpTable(v, depth + 1)
else
print(string.rep(" ", depth) .. k .. ": ", v)
end
end
end
-- String to number conversion helper
function num(str)
@@ -149,15 +227,34 @@ end
function is_number(str)
return tonumber(str) ~= nil
end
function isArray(t)
if type(t) ~= "table" then return false end
local max = 0
local count = 0
for k, _ in pairs(t) do
if type(k) ~= "number" or k < 1 or math.floor(k) ~= k then
return false
end
max = math.max(max, k)
count = count + 1
end
return max == count
end
modified = false
`
if err := L.DoString(helperScript); err != nil {
logger.Error("Failed to load Lua helper functions: %v", err)
return fmt.Errorf("error loading helper functions: %v", err)
}
logger.Debug("Setting up Lua print function to Go")
L.SetGlobal("print", L.NewFunction(printToGo))
L.SetGlobal("fetch", L.NewFunction(fetch))
return nil
}
// Helper utility functions
// LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string {
s = strings.ReplaceAll(s, "\n", "\\n")
@@ -167,8 +264,7 @@ func LimitString(s string, maxLen int) string {
return s[:maxLen-3] + "..."
}
// BuildLuaScript prepares a Lua expression from shorthand notation
func BuildLuaScript(luaExpr string) string {
func PrependLuaAssignment(luaExpr string) string {
// Auto-prepend v1 for expressions starting with operators
if strings.HasPrefix(luaExpr, "*") ||
strings.HasPrefix(luaExpr, "/") ||
@@ -186,22 +282,135 @@ func BuildLuaScript(luaExpr string) string {
if !strings.Contains(luaExpr, "=") {
luaExpr = "v1 = " + luaExpr
}
return luaExpr
}
// Max returns the maximum of two integers
func Max(a, b int) int {
if a > b {
return a
}
return b
// BuildLuaScript prepares a Lua expression from shorthand notation
func BuildLuaScript(luaExpr string) string {
logger.Debug("Building Lua script from expression: %s", luaExpr)
luaExpr = PrependLuaAssignment(luaExpr)
// This allows the user to specify whether or not they modified a value
// If they do nothing we assume they did modify (no return at all)
// If they return before our return then they themselves specify what they did
// If nothing is returned lua assumes nil
// So we can say our value was modified if the return value is either nil or true
// If the return value is false then the user wants to keep the original
fullScript := fmt.Sprintf(`
function run()
%s
end
local res = run()
modified = res == nil or res
`, luaExpr)
return fullScript
}
// Min returns the minimum of two integers
func Min(a, b int) int {
if a < b {
return a
func printToGo(L *lua.LState) int {
top := L.GetTop()
args := make([]interface{}, top)
for i := 1; i <= top; i++ {
args[i-1] = L.Get(i)
}
return b
// Format the message with proper spacing between arguments
var parts []string
for _, arg := range args {
parts = append(parts, fmt.Sprintf("%v", arg))
}
message := strings.Join(parts, " ")
// Use the LUA log level with a script tag
logger.Lua("%s", message)
return 0
}
func fetch(L *lua.LState) int {
// Get URL from first argument
url := L.ToString(1)
if url == "" {
L.Push(lua.LNil)
L.Push(lua.LString("URL is required"))
return 2
}
// Get options from second argument if provided
var method string = "GET"
var headers map[string]string = make(map[string]string)
var body string = ""
if L.GetTop() > 1 {
options := L.ToTable(2)
if options != nil {
// Get method
if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
method = methodVal.String()
}
// Get headers
if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
if headersTable, ok := headersVal.(*lua.LTable); ok {
headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
headers[key.String()] = value.String()
})
}
}
// Get body
if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
body = bodyVal.String()
}
}
}
// Create HTTP request
req, err := http.NewRequest(method, url, strings.NewReader(body))
if err != nil {
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
return 2
}
// Set headers
for key, value := range headers {
req.Header.Set(key, value)
}
// Make request
client := &http.Client{}
resp, err := client.Do(req)
if err != nil {
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
return 2
}
defer resp.Body.Close()
// Read response body
bodyBytes, err := io.ReadAll(resp.Body)
if err != nil {
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
return 2
}
// Create response table
responseTable := L.NewTable()
responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
responseTable.RawSetString("statusText", lua.LString(resp.Status))
responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
// Set headers in response
headersTable := L.NewTable()
for key, values := range resp.Header {
headersTable.RawSetString(key, lua.LString(values[0]))
}
responseTable.RawSetString("headers", headersTable)
L.Push(responseTable)
return 1
}

View File

@@ -1,134 +1,97 @@
package processor
import (
"cook/utils"
"fmt"
"os"
"path/filepath"
"regexp"
"strconv"
"strings"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua"
)
// RegexProcessor implements the Processor interface using regex patterns
type RegexProcessor struct{}
// Process implements the Processor interface for RegexProcessor
func (p *RegexProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
// Read file content
fullPath := filepath.Join(".", filename)
content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
captures, ok := data.([]string)
if !ok {
return fmt.Errorf("expected []string for captures, got %T", data)
}
// Set variables for each capture group, starting from v1/s1 for the first capture
for i := 0; i < len(captures); i++ {
// Set string version (always available as s1, s2, etc.)
L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
// Try to convert to number and set v1, v2, etc.
if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
}
}
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Get the modified values after Lua execution
modifications := make(map[int]string)
// Check for modifications to v1-v12 and s1-s12
for i := 0; i < 12; i++ {
// Check both v and s variables to see if any were modified
vVarName := fmt.Sprintf("v%d", i+1)
sVarName := fmt.Sprintf("s%d", i+1)
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
// If our value is a number then it's very likely we want it to be a number
// And not a string
// If we do want it to be a string we will cast it into a string in lua
// wait that wouldn't work... Casting v to a string would not load it here
if vLuaVal.Type() == lua.LTNumber {
modifications[i] = vLuaVal.String()
continue
}
if sLuaVal.Type() == lua.LTString {
modifications[i] = sLuaVal.String()
continue
}
}
return modifications, nil
type CaptureGroup struct {
Name string
Value string
Updated string
Range [2]int
}
// ProcessContent applies regex replacement with Lua processing
func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
}
// The filename here exists ONLY so we can pass it to the lua environment
// It's not used for anything else
func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
var commands []utils.ReplaceCommand
logger.Trace("Processing regex: %q", command.Regex)
// Start timing the regex processing
startTime := time.Now()
// We don't HAVE to do this multiple times for a pattern
// But it's quick enough for us to not care
pattern := resolveRegexPlaceholders(command.Regex)
// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
// But it's a compromise that allows us to use | in yaml
// Otherwise we would have to escape every god damn pair of quotation marks
// And a bunch of other shit
pattern = strings.TrimSpace(pattern)
logger.Debug("Compiling regex pattern: %s", pattern)
patternCompileStart := time.Now()
compiledPattern, err := regexp.Compile(pattern)
if err != nil {
return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
logger.Error("Error compiling pattern: %v", err)
return commands, fmt.Errorf("error compiling pattern: %v", err)
}
logger.Debug("Compiled pattern successfully in %v: %s", time.Since(patternCompileStart), pattern)
previous := luaExpr
luaExpr = BuildLuaScript(luaExpr)
fmt.Printf("Changing Lua expression from: %s to: %s\n", previous, luaExpr)
L, err := NewLuaState()
if err != nil {
return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
// Initialize Lua environment
modificationCount := 0
// Same here, it's just string concatenation, it won't kill us
// More important is that we don't fuck up the command
// But we shouldn't be able to since it's passed by value
previous := command.Lua
luaExpr := BuildLuaScript(command.Lua)
logger.Debug("Transformed Lua expression: %q → %q", previous, luaExpr)
// Process all regex matches
result := content
matchFindStart := time.Now()
indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
matchFindDuration := time.Since(matchFindStart)
logger.Debug("Found %d matches in content of length %d (search took %v)",
len(indices), len(content), matchFindDuration)
// Log pattern complexity metrics
patternComplexity := estimatePatternComplexity(pattern)
logger.Debug("Pattern complexity estimate: %d", patternComplexity)
if len(indices) == 0 {
logger.Warning("No matches found for regex: %q", pattern)
logger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
// We walk backwards because we're replacing something with something else that might be longer
// And in the case it is longer than the original all indicces past that change will be fucked up
// By going backwards we fuck up all the indices to the end of the file that we don't care about
// Because there either aren't any (last match) or they're already modified (subsequent matches)
for i := len(indices) - 1; i >= 0; i-- {
matchIndices := indices[i]
for i, matchIndices := range indices {
logger.Debug("Processing match %d of %d", i+1, len(indices))
logger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
L, err := NewLuaState()
if err != nil {
logger.Error("Error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
}
L.SetGlobal("file", lua.LString(filename))
// Hmm... Maybe we don't want to defer this..
// Maybe we want to close them every iteration
// We'll leave it as is for now
defer L.Close()
logger.Trace("Lua state created successfully for match %d", i+1)
// Why we're doing this whole song and dance of indices is to properly handle empty matches
// Plus it's a little cleaner to surgically replace our matches
// If we were to use string.replace and encountered an empty match there'd be nothing to replace
@@ -137,60 +100,292 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
// As if concatenating in the middle of the array
// Plus it supports lookarounds
match := content[matchIndices[0]:matchIndices[1]]
matchPreview := match
if len(match) > 50 {
matchPreview = match[:47] + "..."
}
logger.Trace("Matched content: %q (length: %d)", matchPreview, len(match))
groups := matchIndices[2:]
if len(groups) <= 0 {
fmt.Println("No capture groups for lua to chew on")
logger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
continue
}
if len(groups)%2 == 1 {
fmt.Println("Odd number of indices of groups, what the fuck?")
logger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
continue
}
captures := make([]string, 0, len(groups)/2)
// Count how many valid groups we have
validGroups := 0
for j := 0; j < len(groups); j += 2 {
captures = append(captures, content[groups[j]:groups[j+1]])
if groups[j] != -1 && groups[j+1] != -1 {
validGroups++
}
}
logger.Debug("Found %d valid capture groups in match", validGroups)
for _, index := range groups {
if index == -1 {
logger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
continue
}
}
if err := p.ToLua(L, captures); err != nil {
fmt.Println("Error setting Lua variables:", err)
// We have to use array to preserve order
// Very important for the reconstruction step
// Because we must overwrite the values in reverse order
// See comments a few dozen lines above for more details
captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
groupNames := compiledPattern.SubexpNames()[1:]
for i, name := range groupNames {
start := groups[i*2]
end := groups[i*2+1]
if start == -1 || end == -1 {
continue
}
value := content[start:end]
captureGroups = append(captureGroups, &CaptureGroup{
Name: name,
Value: value,
Range: [2]int{start, end},
})
// Include name info in log if available
if name != "" {
logger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
} else {
logger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
}
}
// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
if !command.NoDedup {
logger.Debug("Deduplicating capture groups as specified in command settings")
captureGroups = deduplicateGroups(captureGroups)
}
if err := toLua(L, captureGroups); err != nil {
logger.Error("Failed to set Lua variables: %v", err)
continue
}
logger.Trace("Set %d capture groups as Lua variables", len(captureGroups))
if err := L.DoString(luaExpr); err != nil {
fmt.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
logger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
err, luaExpr, captureGroups)
continue
}
logger.Trace("Lua script executed successfully")
// Get modifications from Lua
modResult, err := p.FromLua(L)
captureGroups, err = fromLua(L, captureGroups)
if err != nil {
fmt.Println("Error getting modifications:", err)
logger.Error("Failed to retrieve modifications from Lua: %v", err)
continue
}
logger.Trace("Retrieved updated values from Lua")
replacement := ""
replacementVar := L.GetGlobal("replacement")
if replacementVar.Type() != lua.LTNil {
replacement = replacementVar.String()
logger.Debug("Using global replacement: %q", replacement)
}
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
logger.Debug("Skipping match - no modifications made by Lua script")
continue
}
// Apply modifications to the matched text
modsMap, ok := modResult.(map[int]string)
if !ok || len(modsMap) == 0 {
fmt.Println("No modifications to apply")
continue
}
if replacement == "" {
// Apply the modifications to the original match
replacement = match
// Apply the modifications to the original match
replacement := match
for i := len(modsMap) - 1; i >= 0; i-- {
newVal := modsMap[i]
// Indices of the group are relative to content
// To relate them to match we have to subtract the match start index
groupStart := groups[i*2] - matchIndices[0]
groupEnd := groups[i*2+1] - matchIndices[0]
replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
}
// Count groups that were actually modified
modifiedGroups := 0
for _, capture := range captureGroups {
if capture.Value != capture.Updated {
modifiedGroups++
}
}
logger.Info("%d of %d capture groups identified for modification", modifiedGroups, len(captureGroups))
modificationCount++
result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
for _, capture := range captureGroups {
if capture.Value == capture.Updated {
logger.Info("Capture group unchanged: %s", LimitString(capture.Value, 50))
continue
}
// Log what changed with context
logger.Debug("Capture group %s scheduled for modification: %q → %q",
capture.Name, capture.Value, capture.Updated)
// Indices of the group are relative to content
// To relate them to match we have to subtract the match start index
// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
commands = append(commands, utils.ReplaceCommand{
From: capture.Range[0],
To: capture.Range[1],
With: capture.Updated,
})
}
} else {
commands = append(commands, utils.ReplaceCommand{
From: matchIndices[0],
To: matchIndices[1],
With: replacement,
})
}
}
return result, modificationCount, len(indices), nil
logger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
deduplicatedGroups := make([]*CaptureGroup, 0)
for _, group := range captureGroups {
overlaps := false
logger.Debug("Checking capture group: %s with range %v", group.Name, group.Range)
for _, existingGroup := range deduplicatedGroups {
logger.Debug("Comparing with existing group: %s with range %v", existingGroup.Name, existingGroup.Range)
if group.Range[0] < existingGroup.Range[1] && group.Range[1] > existingGroup.Range[0] {
overlaps = true
logger.Warning("Detected overlap between capture group '%s' and existing group '%s' in range %v-%v and %v-%v", group.Name, existingGroup.Name, group.Range[0], group.Range[1], existingGroup.Range[0], existingGroup.Range[1])
break
}
}
if overlaps {
// We CAN just continue despite this fuckup
logger.Warning("Overlapping capture group: %s", group.Name)
continue
}
logger.Debug("No overlap detected for capture group: %s. Adding to deduplicated groups.", group.Name)
deduplicatedGroups = append(deduplicatedGroups, group)
}
return deduplicatedGroups
}
// The order of these replaces is important
// This one handles !num-s inside of named capture groups
// If it were not here our !num in a named capture group would
// Expand to another capture group in the capture group
// We really only want one (our named) capture group
func resolveRegexPlaceholders(pattern string) string {
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
}
namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
parts := namedGroupNum.FindStringSubmatch(match)
if len(parts) != 3 {
return match
}
replacement := `-?\d*\.?\d+`
return parts[1] + replacement
})
pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
// !rep(pattern, count) repeats the pattern n times
// Inserting !any between each repetition
pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
parts := repPattern.FindStringSubmatch(match)
if len(parts) != 3 {
return match
}
repeatedPattern := parts[1]
count := parts[2]
repetitions, _ := strconv.Atoi(count)
return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
})
return pattern
}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func toLua(L *lua.LState, data interface{}) error {
captureGroups, ok := data.([]*CaptureGroup)
if !ok {
return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
}
groupindex := 0
for _, capture := range captureGroups {
if capture.Name == "" {
// We don't want to change the name of the capture group
// Even if it's empty
tempName := fmt.Sprintf("%d", groupindex+1)
groupindex++
L.SetGlobal("s"+tempName, lua.LString(capture.Value))
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal("v"+tempName, lua.LNumber(val))
}
} else {
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal(capture.Name, lua.LNumber(val))
} else {
L.SetGlobal(capture.Name, lua.LString(capture.Value))
}
}
}
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
captureIndex := 0
for _, capture := range captureGroups {
if capture.Name == "" {
capture.Name = fmt.Sprintf("%d", captureIndex+1)
vVarName := fmt.Sprintf("v%s", capture.Name)
sVarName := fmt.Sprintf("s%s", capture.Name)
captureIndex++
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
if sLuaVal.Type() == lua.LTString {
capture.Updated = sLuaVal.String()
}
// Numbers have priority
if vLuaVal.Type() == lua.LTNumber {
capture.Updated = vLuaVal.String()
}
} else {
// Easy shit
capture.Updated = L.GetGlobal(capture.Name).String()
}
}
return captureGroups, nil
}
// estimatePatternComplexity gives a rough estimate of regex pattern complexity
// This can help identify potentially problematic patterns
func estimatePatternComplexity(pattern string) int {
complexity := len(pattern)
// Add complexity for potentially expensive operations
complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
complexity += strings.Count(pattern, "[^") * 3 // Negated character class
complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
complexity += strings.Count(pattern, "(") * 2 // Capture groups
complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
complexity += strings.Count(pattern, "{") * 2 // Counted repetition
return complexity
}

File diff suppressed because it is too large Load Diff

27
processor/test_helper.go Normal file
View File

@@ -0,0 +1,27 @@
package processor
import (
"io"
"os"
logger "git.site.quack-lab.dev/dave/cylogger"
)
func init() {
// Only modify logger in test mode
// This checks if we're running under 'go test'
if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
// Initialize logger with ERROR level for tests
// to minimize noise in test output
logger.Init(logger.LevelError)
// Optionally redirect logger output to discard
// This prevents logger output from interfering with test output
disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
if disableTestLogs {
// Create a new logger that writes to nowhere
silentLogger := logger.New(io.Discard, "", 0)
logger.Default = silentLogger
}
}
}

View File

@@ -1,217 +0,0 @@
package processor
import (
"fmt"
"os"
"path/filepath"
"strings"
"github.com/antchfx/xmlquery"
lua "github.com/yuin/gopher-lua"
)
// XMLProcessor implements the Processor interface for XML documents
type XMLProcessor struct{}
// Process implements the Processor interface for XMLProcessor
func (p *XMLProcessor) Process(filename string, pattern string, luaExpr string) (int, int, error) {
// Read file content
fullPath := filepath.Join(".", filename)
content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ProcessContent implements the Processor interface for XMLProcessor
func (p *XMLProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse XML document
doc, err := xmlquery.Parse(strings.NewReader(content))
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
}
// Find nodes matching the XPath pattern
nodes, err := xmlquery.QueryAll(doc, pattern)
if err != nil {
return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
// Initialize Lua
L := lua.NewState()
defer L.Close()
// Load math library
L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil {
return content, 0, 0, fmt.Errorf("error loading Lua math library: %v", err)
}
// Load helper functions
if err := InitLuaHelpers(L); err != nil {
return content, 0, 0, err
}
// Apply modifications to each node
modCount := 0
for _, node := range nodes {
// Reset Lua state for each node
L.SetGlobal("v1", lua.LNil)
L.SetGlobal("s1", lua.LNil)
// Get the node value
var originalValue string
if node.Type == xmlquery.AttributeNode {
originalValue = node.InnerText()
} else if node.Type == xmlquery.TextNode {
originalValue = node.Data
} else {
originalValue = node.InnerText()
}
// Convert to Lua variables
err = p.ToLua(L, originalValue)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
}
// Execute Lua script
if err := L.DoString(luaExpr); err != nil {
return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
}
// Get modified value
result, err := p.FromLua(L)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
}
newValue, ok := result.(string)
if !ok {
return content, modCount, matchCount, fmt.Errorf("expected string result from Lua, got %T", result)
}
// Skip if no change
if newValue == originalValue {
continue
}
// Apply modification
if node.Type == xmlquery.AttributeNode {
// For attribute nodes, update the attribute value
node.Parent.Attr = append([]xmlquery.Attr{}, node.Parent.Attr...)
for i, attr := range node.Parent.Attr {
if attr.Name.Local == node.Data {
node.Parent.Attr[i].Value = newValue
break
}
}
} else if node.Type == xmlquery.TextNode {
// For text nodes, update the text content
node.Data = newValue
} else {
// For element nodes, replace inner text
// Simple approach: set the InnerText directly if there are no child elements
if node.FirstChild == nil || (node.FirstChild != nil && node.FirstChild.Type == xmlquery.TextNode && node.FirstChild.NextSibling == nil) {
if node.FirstChild != nil {
node.FirstChild.Data = newValue
} else {
// Create a new text node and add it as the first child
textNode := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: newValue,
}
node.FirstChild = textNode
}
} else {
// Complex case: node has mixed content or child elements
// Replace just the text content while preserving child elements
// This is a simplified approach - more complex XML may need more robust handling
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type == xmlquery.TextNode {
child.Data = newValue
break // Update only the first text node
}
}
}
}
modCount++
}
// Serialize the modified XML document to string
if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
// If we have an XML declaration, start with it
declaration := doc.FirstChild.OutputXML(true)
// Remove the firstChild (declaration) before serializing the rest of the document
doc.FirstChild = doc.FirstChild.NextSibling
return declaration + doc.OutputXML(true), modCount, matchCount, nil
}
return doc.OutputXML(true), modCount, matchCount, nil
}
// ToLua converts XML node values to Lua variables
func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
value, ok := data.(string)
if !ok {
return fmt.Errorf("expected string value, got %T", data)
}
// Set as string variable
L.SetGlobal("s1", lua.LString(value))
// Try to convert to number if possible
L.SetGlobal("v1", lua.LNumber(0)) // Default to 0
if err := L.DoString(fmt.Sprintf("v1 = tonumber(%q) or 0", value)); err != nil {
return fmt.Errorf("error converting value to number: %v", err)
}
return nil
}
// FromLua gets modified values from Lua
func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Check if string variable was modified
s1 := L.GetGlobal("s1")
if s1 != lua.LNil {
if s1Str, ok := s1.(lua.LString); ok {
return string(s1Str), nil
}
}
// Check if numeric variable was modified
v1 := L.GetGlobal("v1")
if v1 != lua.LNil {
if v1Num, ok := v1.(lua.LNumber); ok {
return fmt.Sprintf("%v", v1Num), nil
}
}
// Default return empty string
return "", nil
}

File diff suppressed because it is too large Load Diff

View File

@@ -0,0 +1,137 @@
package regression
import (
"cook/processor"
"cook/utils"
"os"
"path/filepath"
"testing"
)
func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
command := utils.ModifyCommand{
Regex: regex,
Lua: lua,
LogLevel: "TRACE",
}
commands, err := processor.ProcessRegex(content, command, "test")
if err != nil {
return "", 0, 0, err
}
result, modifications := utils.ExecuteModifications(commands, content)
return result, modifications, len(commands), nil
}
func TestTalentsMechanicOutOfRange(t *testing.T) {
given := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
actual := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="30" color="gui.green"/>
<Replace tag="[duration]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="20"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
if matches != 4 {
t.Errorf("Expected 4 matches, got %d", matches)
}
if mods != 4 {
t.Errorf("Expected 4 modifications, got %d", mods)
}
if result != actual {
t.Errorf("expected %s, got %s", actual, result)
}
}
func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
cwd, err := os.Getwd()
if err != nil {
t.Fatalf("Error getting current working directory: %v", err)
}
given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
// We don't really care how many god damn matches there are as long as the result is correct
// if matches != 45 {
// t.Errorf("Expected 45 match, got %d", matches)
// }
//
// if mods != 45 {
// t.Errorf("Expected 45 modification, got %d", mods)
// }
if string(result) != string(expected) {
t.Errorf("expected %s, got %s", expected, result)
}
}

View File

@@ -16,7 +16,8 @@ fi
echo "Tag: $TAG"
echo "Building the thing..."
go build -o BigChef.exe .
go build -o chef.exe .
go install .
echo "Creating a release..."
TOKEN="$GITEA_API_KEY"
@@ -43,6 +44,6 @@ echo "Release ID: $RELEASE_ID"
echo "Uploading the things..."
curl -X POST \
-H "Authorization: token $TOKEN" \
-F "attachment=@BigChef.exe" \
"$GITEA/api/v1/repos/$REPO/releases/${RELEASE_ID}/assets?name=BigChef.exe"
rm BigChef.exe
-F "attachment=@chef.exe" \
"$GITEA/api/v1/repos/$REPO/releases/${RELEASE_ID}/assets?name=chef.exe"
rm chef.exe

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

View File

@@ -1,12 +0,0 @@
<config>
<item>
<value>75</value>
<multiplier>2</multiplier>
<divider>4</divider>
</item>
<item>
<value>150</value>
<multiplier>3</multiplier>
<divider>2</divider>
</item>
</config>

View File

@@ -1,37 +0,0 @@
<?xml version="1.0" encoding="UTF-8"?>
<testdata>
<!-- Numeric values -->
<item>
<id>1</id>
<value>200</value>
<price>24.99</price>
<quantity>5</quantity>
</item>
<!-- Text values -->
<item>
<id>2</id>
<name>Test Product</name>
<description>This is a test product description</description>
<category>Test</category>
</item>
<!-- Mixed content -->
<item>
<id>3</id>
<name>Mixed Product</name>
<price>19.99</price>
<code>PRD-123</code>
<tags>sale,discount,new</tags>
</item>
<!-- Empty and special values -->
<item>
<id>4</id>
<value></value>
<specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
<multiline>Line 1
Line 2
Line 3</multiline>
</item>
</testdata>

1252
testfiles/OutpostItems.xml Normal file

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

120
utils/db.go Normal file
View File

@@ -0,0 +1,120 @@
package utils
import (
"fmt"
"path/filepath"
"time"
"git.site.quack-lab.dev/dave/cylogger"
"gorm.io/driver/sqlite"
"gorm.io/gorm"
)
type DB interface {
DB() *gorm.DB
Raw(sql string, args ...any) *gorm.DB
SaveFile(filePath string, fileData []byte) error
GetFile(filePath string) ([]byte, error)
GetAllFiles() ([]FileSnapshot, error)
RemoveAllFiles() error
}
type FileSnapshot struct {
Date time.Time `gorm:"primaryKey"`
FilePath string `gorm:"primaryKey"`
FileData []byte `gorm:"type:blob"`
}
type DBWrapper struct {
db *gorm.DB
}
var db *DBWrapper
func GetDB() (DB, error) {
var err error
dbFile := filepath.Join("data.sqlite")
db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
// SkipDefaultTransaction: true,
PrepareStmt: true,
// Logger: gormlogger.Default.LogMode(gormlogger.Silent),
})
if err != nil {
return nil, err
}
db.AutoMigrate(&FileSnapshot{})
return &DBWrapper{db: db}, nil
}
// Just a wrapper
func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
return db.db.Raw(sql, args...)
}
func (db *DBWrapper) DB() *gorm.DB {
return db.db
}
func (db *DBWrapper) FileExists(filePath string) (bool, error) {
var count int64
err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
return count > 0, err
}
func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
log := cylogger.Default.WithPrefix(fmt.Sprintf("SaveFile: %q", filePath))
exists, err := db.FileExists(filePath)
if err != nil {
log.Error("Error checking if file exists: %v", err)
return err
}
log.Debug("File exists: %t", exists)
// Nothing to do, file already exists
if exists {
log.Debug("File already exists, skipping save")
return nil
}
log.Debug("Saving file to database")
return db.db.Create(&FileSnapshot{
Date: time.Now(),
FilePath: filePath,
FileData: fileData,
}).Error
}
func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
log := cylogger.Default.WithPrefix(fmt.Sprintf("GetFile: %q", filePath))
log.Debug("Getting file from database")
var fileSnapshot FileSnapshot
err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
if err != nil {
return nil, err
}
log.Debug("File found in database")
return fileSnapshot.FileData, nil
}
func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
log := cylogger.Default.WithPrefix("GetAllFiles")
log.Debug("Getting all files from database")
var fileSnapshots []FileSnapshot
err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
if err != nil {
return nil, err
}
log.Debug("Found %d files in database", len(fileSnapshots))
return fileSnapshots, nil
}
func (db *DBWrapper) RemoveAllFiles() error {
log := cylogger.Default.WithPrefix("RemoveAllFiles")
log.Debug("Removing all files from database")
err := db.db.Exec("DELETE FROM file_snapshots").Error
if err != nil {
return err
}
log.Debug("All files removed from database")
return nil
}

96
utils/file.go Normal file
View File

@@ -0,0 +1,96 @@
package utils
import (
"fmt"
"os"
"path/filepath"
"strings"
"git.site.quack-lab.dev/dave/cylogger"
)
func CleanPath(path string) string {
log := cylogger.Default.WithPrefix(fmt.Sprintf("CleanPath: %q", path))
log.Trace("Start")
path = filepath.Clean(path)
path = strings.ReplaceAll(path, "\\", "/")
log.Trace("Done: %q", path)
return path
}
func ToAbs(path string) string {
log := cylogger.Default.WithPrefix(fmt.Sprintf("ToAbs: %q", path))
log.Trace("Start")
if filepath.IsAbs(path) {
log.Trace("Path is already absolute: %q", path)
return CleanPath(path)
}
cwd, err := os.Getwd()
if err != nil {
log.Error("Error getting cwd: %v", err)
return CleanPath(path)
}
log.Trace("Cwd: %q", cwd)
return CleanPath(filepath.Join(cwd, path))
}
func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
log := cylogger.Default.WithPrefix("ResetWhereNecessary")
log.Debug("Start")
dirtyFiles := make(map[string]struct{})
for _, association := range associations {
for _, command := range association.Commands {
log.Debug("Checking command %q for file %q", command.Name, association.File)
if command.Reset {
log.Debug("Command %q requires reset for file %q", command.Name, association.File)
dirtyFiles[association.File] = struct{}{}
}
}
for _, command := range association.IsolateCommands {
log.Debug("Checking isolate command %q for file %q", command.Name, association.File)
if command.Reset {
log.Debug("Isolate command %q requires reset for file %q", command.Name, association.File)
dirtyFiles[association.File] = struct{}{}
}
}
}
log.Debug("Dirty files: %v", dirtyFiles)
for file := range dirtyFiles {
log.Debug("Resetting file %q", file)
fileData, err := db.GetFile(file)
if err != nil {
log.Warning("Failed to get file %q: %v", file, err)
continue
}
log.Debug("Writing file %q to disk", file)
err = os.WriteFile(file, fileData, 0644)
if err != nil {
log.Warning("Failed to write file %q: %v", file, err)
continue
}
log.Debug("File %q written to disk", file)
}
log.Debug("Done")
return nil
}
func ResetAllFiles(db DB) error {
log := cylogger.Default.WithPrefix("ResetAllFiles")
log.Debug("Start")
fileSnapshots, err := db.GetAllFiles()
if err != nil {
return err
}
log.Debug("Found %d files in database", len(fileSnapshots))
for _, fileSnapshot := range fileSnapshots {
log.Debug("Resetting file %q", fileSnapshot.FilePath)
err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
if err != nil {
log.Warning("Failed to write file %q: %v", fileSnapshot.FilePath, err)
continue
}
log.Debug("File %q written to disk", fileSnapshot.FilePath)
}
log.Debug("Done")
return nil
}

10
utils/flags.go Normal file
View File

@@ -0,0 +1,10 @@
package utils
import (
"flag"
)
var (
ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
Filter = flag.String("f", "", "Filter commands before running them")
)

261
utils/modifycommand.go Normal file
View File

@@ -0,0 +1,261 @@
package utils
import (
"fmt"
"os"
"path/filepath"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/bmatcuk/doublestar/v4"
"gopkg.in/yaml.v3"
)
type ModifyCommand struct {
Name string `yaml:"name"`
Regex string `yaml:"regex"`
Lua string `yaml:"lua"`
Files []string `yaml:"files"`
Reset bool `yaml:"reset"`
LogLevel string `yaml:"loglevel"`
Isolate bool `yaml:"isolate"`
NoDedup bool `yaml:"nodedup"`
Disabled bool `yaml:"disable"`
}
type CookFile []ModifyCommand
func (c *ModifyCommand) Validate() error {
if c.Regex == "" {
return fmt.Errorf("pattern is required")
}
if c.Lua == "" {
return fmt.Errorf("lua expression is required")
}
if len(c.Files) == 0 {
return fmt.Errorf("at least one file is required")
}
if c.LogLevel == "" {
c.LogLevel = "INFO"
}
return nil
}
// Ehh.. Not much better... Guess this wasn't the big deal
var matchesMemoTable map[string]bool = make(map[string]bool)
func Matches(path string, glob string) (bool, error) {
key := fmt.Sprintf("%s:%s", path, glob)
if matches, ok := matchesMemoTable[key]; ok {
logger.Debug("Found match for file %q and glob %q in memo table", path, glob)
return matches, nil
}
matches, err := doublestar.Match(glob, path)
if err != nil {
return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
}
matchesMemoTable[key] = matches
return matches, nil
}
func SplitPattern(pattern string) (string, string) {
static, pattern := doublestar.SplitPattern(pattern)
cwd, err := os.Getwd()
if err != nil {
return "", ""
}
if static == "" {
static = cwd
}
if !filepath.IsAbs(static) {
static = filepath.Join(cwd, static)
static = filepath.Clean(static)
}
static = strings.ReplaceAll(static, "\\", "/")
return static, pattern
}
type FileCommandAssociation struct {
File string
IsolateCommands []ModifyCommand
Commands []ModifyCommand
}
func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
associationCount := 0
fileCommands := make(map[string]FileCommandAssociation)
for _, file := range files {
file = strings.ReplaceAll(file, "\\", "/")
fileCommands[file] = FileCommandAssociation{
File: file,
IsolateCommands: []ModifyCommand{},
Commands: []ModifyCommand{},
}
for _, command := range commands {
for _, glob := range command.Files {
glob = strings.ReplaceAll(glob, "\\", "/")
static, pattern := SplitPattern(glob)
patternFile := strings.Replace(file, static+`/`, "", 1)
matches, err := Matches(patternFile, pattern)
if err != nil {
logger.Trace("Failed to match glob %s with file %s: %v", glob, file, err)
continue
}
if matches {
logger.Debug("Found match for file %q and command %q", file, command.Regex)
association := fileCommands[file]
if command.Isolate {
association.IsolateCommands = append(association.IsolateCommands, command)
} else {
association.Commands = append(association.Commands, command)
}
fileCommands[file] = association
associationCount++
}
}
}
logger.Debug("Found %d commands for file %q", len(fileCommands[file].Commands), file)
if len(fileCommands[file].Commands) == 0 {
logger.Info("No commands found for file %q", file)
}
if len(fileCommands[file].IsolateCommands) > 0 {
logger.Info("Found %d isolate commands for file %q", len(fileCommands[file].IsolateCommands), file)
}
}
logger.Info("Found %d associations between %d files and %d commands", associationCount, len(files), len(commands))
return fileCommands, nil
}
func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
logger.Info("Aggregating globs for %d commands", len(commands))
globs := make(map[string]struct{})
for _, command := range commands {
for _, glob := range command.Files {
glob = strings.Replace(glob, "~", os.Getenv("HOME"), 1)
glob = strings.ReplaceAll(glob, "\\", "/")
globs[glob] = struct{}{}
}
}
logger.Info("Found %d unique globs", len(globs))
return globs
}
func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
cwd, err := os.Getwd()
if err != nil {
return nil, fmt.Errorf("failed to get current working directory: %w", err)
}
logger.Debug("Expanding patterns from directory: %s", cwd)
for pattern := range patterns {
logger.Trace("Processing pattern: %s", pattern)
static, pattern := SplitPattern(pattern)
matches, _ := doublestar.Glob(os.DirFS(static), pattern)
logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
for _, m := range matches {
m = filepath.Join(static, m)
info, err := os.Stat(m)
if err != nil {
logger.Warning("Error getting file info for %s: %v", m, err)
continue
}
if !info.IsDir() && !filesMap[m] {
logger.Trace("Adding file to process list: %s", m)
filesMap[m], files = true, append(files, m)
}
}
}
if len(files) > 0 {
logger.Debug("Found %d files to process: %v", len(files), files)
}
return files, nil
}
func LoadCommands(args []string) ([]ModifyCommand, error) {
commands := []ModifyCommand{}
logger.Info("Loading commands from cook files: %s", args)
for _, arg := range args {
newcommands, err := LoadCommandsFromCookFiles(arg)
if err != nil {
return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
}
logger.Info("Successfully loaded %d commands from cook files", len(newcommands))
for _, cmd := range newcommands {
if cmd.Disabled {
logger.Info("Skipping disabled command: %s", cmd.Name)
continue
}
commands = append(commands, cmd)
}
logger.Info("Now total commands: %d", len(commands))
}
logger.Info("Loaded %d commands from all cook file", len(commands))
return commands, nil
}
func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
static, pattern := SplitPattern(pattern)
commands := []ModifyCommand{}
cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
return nil, fmt.Errorf("failed to glob cook files: %w", err)
}
for _, cookFile := range cookFiles {
cookFile = filepath.Join(static, cookFile)
cookFile = filepath.Clean(cookFile)
cookFile = strings.ReplaceAll(cookFile, "\\", "/")
logger.Info("Loading commands from cook file: %s", cookFile)
cookFileData, err := os.ReadFile(cookFile)
if err != nil {
return nil, fmt.Errorf("failed to read cook file: %w", err)
}
newcommands, err := LoadCommandsFromCookFile(cookFileData)
if err != nil {
return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
}
commands = append(commands, newcommands...)
}
return commands, nil
}
func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
commands := []ModifyCommand{}
err := yaml.Unmarshal(cookFileData, &commands)
if err != nil {
return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
}
return commands, nil
}
// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
func CountGlobsBeforeDedup(commands []ModifyCommand) int {
count := 0
for _, cmd := range commands {
count += len(cmd.Files)
}
return count
}
func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
filteredCommands := []ModifyCommand{}
filters := strings.Split(filter, ",")
for _, cmd := range commands {
for _, filter := range filters {
if strings.Contains(cmd.Name, filter) {
filteredCommands = append(filteredCommands, cmd)
}
}
}
return filteredCommands
}

1000
utils/modifycommand_test.go Normal file

File diff suppressed because it is too large Load Diff

58
utils/replacecommand.go Normal file
View File

@@ -0,0 +1,58 @@
package utils
import (
"fmt"
"sort"
logger "git.site.quack-lab.dev/dave/cylogger"
)
type ReplaceCommand struct {
From int
To int
With string
}
func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
var err error
sort.Slice(modifications, func(i, j int) bool {
return modifications[i].From > modifications[j].From
})
logger.Trace("Preparing to apply %d replacement commands in reverse order", len(modifications))
executed := 0
for _, modification := range modifications {
fileData, err = modification.Execute(fileData)
if err != nil {
logger.Error("Failed to execute replacement: %v", err)
continue
}
executed++
}
logger.Info("Successfully applied %d text replacements", executed)
return fileData, executed
}
func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
err := m.Validate(len(fileDataStr))
if err != nil {
return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
}
logger.Trace("Replace pos %d-%d with %q", m.From, m.To, m.With)
return fileDataStr[:m.From] + m.With + fileDataStr[m.To:], nil
}
func (m *ReplaceCommand) Validate(maxsize int) error {
if m.To < m.From {
return fmt.Errorf("command to is less than from: %v", m)
}
if m.From > maxsize || m.To > maxsize {
return fmt.Errorf("command from or to is greater than replacement length: %v", m)
}
if m.From < 0 || m.To < 0 {
return fmt.Errorf("command from or to is less than 0: %v", m)
}
return nil
}

View File

@@ -0,0 +1,504 @@
package utils
import (
"testing"
"github.com/stretchr/testify/assert"
)
func TestReplaceCommandExecute(t *testing.T) {
tests := []struct {
name string
input string
command ReplaceCommand
expected string
shouldError bool
}{
{
name: "Simple replacement",
input: "This is a test string",
command: ReplaceCommand{From: 5, To: 7, With: "was"},
expected: "This was a test string",
shouldError: false,
},
{
name: "Replace at beginning",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 5, With: "Hi"},
expected: "Hi world",
shouldError: false,
},
{
name: "Replace at end",
input: "Hello world",
command: ReplaceCommand{From: 6, To: 11, With: "everyone"},
expected: "Hello everyone",
shouldError: false,
},
{
name: "Replace entire string",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
expected: "Goodbye!",
shouldError: false,
},
{
name: "Error: From > To",
input: "Test string",
command: ReplaceCommand{From: 7, To: 5, With: "fail"},
expected: "Test string",
shouldError: true,
},
{
name: "Error: From > string length",
input: "Test",
command: ReplaceCommand{From: 10, To: 12, With: "fail"},
expected: "Test",
shouldError: true,
},
{
name: "Error: To > string length",
input: "Test",
command: ReplaceCommand{From: 2, To: 10, With: "fail"},
expected: "Test",
shouldError: true,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
result, err := tc.command.Execute(tc.input)
if tc.shouldError {
if err == nil {
t.Errorf("Expected an error for command %+v but got none", tc.command)
}
} else {
if err != nil {
t.Errorf("Unexpected error: %v", err)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
}
})
}
}
func TestExecuteModifications(t *testing.T) {
tests := []struct {
name string
input string
modifications []ReplaceCommand
expected string
expectedCount int
}{
{
name: "Single modification",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
},
expected: "Hi world",
expectedCount: 1,
},
{
name: "Multiple modifications",
input: "This is a test string",
modifications: []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 8, To: 14, With: "sample"},
},
expected: "That is sample string",
expectedCount: 2,
},
{
name: "Overlapping modifications",
input: "ABCDEF",
modifications: []ReplaceCommand{
{From: 0, To: 3, With: "123"}, // ABC -> 123
{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
},
// The actual behavior with the current implementation
expected: "123yzF",
expectedCount: 2,
},
{
name: "Sequential modifications",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 5, To: 6, With: ""}, // Remove the space
{From: 6, To: 11, With: "everyone"},
},
expected: "Hieveryone",
expectedCount: 3,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
// Make a copy of the modifications to avoid modifying the test case
mods := make([]ReplaceCommand, len(tc.modifications))
copy(mods, tc.modifications)
result, count := ExecuteModifications(mods, tc.input)
if count != tc.expectedCount {
t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
})
}
}
func TestReverseOrderExecution(t *testing.T) {
// This test verifies the current behavior of modification application
input := "Original text with multiple sections"
// Modifications in specific positions
modifications := []ReplaceCommand{
{From: 0, To: 8, With: "Modified"}, // Original -> Modified
{From: 9, To: 13, With: "document"}, // text -> document
{From: 14, To: 22, With: "without"}, // with -> without
{From: 23, To: 31, With: "any"}, // multiple -> any
}
// The actual current behavior of our implementation
expected := "Modified document withouttanytions"
result, count := ExecuteModifications(modifications, input)
if count != 4 {
t.Errorf("Expected 4 modifications, got %d", count)
}
if result != expected {
t.Errorf("Expected %q, got %q", expected, result)
}
}
// Replace text in the middle of a string with new content
func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello replaced, how are you?", result)
}
// Replace with empty string (deletion)
func TestReplaceCommandExecute_DeletesText(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello , how are you?", result)
}
// Replace with longer string than original segment
func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "longerreplacement",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello longerreplacement, how are you?", result)
}
// From and To values are the same (zero-length replacement)
func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 5,
With: "inserted",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Helloinserted world", result)
}
// From value is greater than To value
func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 10,
To: 5,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// From or To values exceed string length
func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 50, // Exceeds the length of the fileContent
With: "replaced",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world", result)
}
// From or To values are negative
func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: -1,
To: 10,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// Modifications are applied in reverse order (from highest to lowest 'From' value)
func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 10, To: 14, With: "sample"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a sample string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// One or more modifications fail but others succeed
func TestExecuteModificationsWithPartialFailures(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
// Create a custom ReplaceCommand implementation that will fail
failingCommand := ReplaceCommand{
From: 15,
To: 10, // Invalid range (To < From) to cause failure
With: "will fail",
}
// Valid commands
validCommand1 := ReplaceCommand{
From: 0,
To: 4,
With: "That",
}
validCommand2 := ReplaceCommand{
From: 26,
To: 38,
With: "modifications",
}
modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a test string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
// Only 2 out of 3 modifications should succeed
if executed != 2 {
t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
}
}
// All valid modifications are executed and the modified string is returned
func TestExecuteModificationsAllValid(t *testing.T) {
// Setup test data
fileData := "Hello world, this is a test"
modifications := []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 18, To: 20, With: "was"},
{From: 21, To: 27, With: "an example"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "Hi world, this was an example"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// The count of successfully executed modifications is returned
func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
// Setup test data
fileData := "Initial text for testing"
modifications := []ReplaceCommand{
{From: 0, To: 7, With: "Final"},
{From: 12, To: 16, With: "example"},
{From: 17, To: 24, With: "process"},
}
// Execute the function
_, executed := ExecuteModifications(modifications, fileData)
// Verify the count of executed modifications
expectedExecuted := 3
if executed != expectedExecuted {
t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
}
}
// Empty modifications list returns the original string with zero executed count
func TestExecuteModificationsWithEmptyList(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
if result != fileData {
t.Errorf("Expected result to be %q, but got %q", fileData, result)
}
if executed != 0 {
t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
}
}
// Modifications with identical 'From' values
func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 10, To: 14, With: "sample"},
{From: 10, To: 14, With: "example"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
// Yes, it's mangled, yes, it's intentional
// Every subsequent command works with the modified contents of the previous command
// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
// So we prepend "example" and end up with "examplele"
// Whether sample or example goes first here is irrelevant to us
// But it just so happens that sample goes first, so we end up with "examplele"
expectedResult := "This is a examplele string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// Modifications that would affect each other if not sorted properly
func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
// Setup test data
fileData := "The quick brown fox jumps over the lazy dog"
modifications := []ReplaceCommand{
{From: 4, To: 9, With: "slow"},
{From: 10, To: 15, With: "red"},
{From: 16, To: 19, With: "cat"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "The slow red cat jumps over the lazy dog"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}