Trim regex to work with yaml pipe

Force always /
Fuck windows and its path fuck windows
2025-04-01 12:17:42 +02:00 · 2025-04-01 12:15:03 +02:00 · 2025-04-01 12:12:58 +02:00 · 2025-04-01 12:09:29 +02:00 · 2025-04-01 12:02:45 +02:00 · 2025-04-01 11:57:48 +02:00
38 changed files with 6371 additions and 8133 deletions
--- a/.gitignore
+++ b/.gitignore
@@ -1 +1,2 @@
 *.exe
 .qodo
--- a/.vscode/launch.json
+++ b/.vscode/launch.json
@@ -5,16 +5,44 @@
 	"version": "0.2.0",
 	"configurations": [
 		{
-			"name": "Launch Package",
+			"name": "Launch Package (Barotrauma)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
-				"LightComponent!anyrange=\"(!num)\"",
+				"-loglevel",
-				"*4",
+				"trace",
-				"**/*.xml"
+				"-cook",
 				"*.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Barotrauma cookfile)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"cookassistant.yml",
 			]
 		},
 		{
 			"name": "Launch Package (Workspace)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"args": [
 				"-loglevel",
 				"trace",
 				"-cook",
 				"cookscoop.yml",
 			]
 		}
 	]
--- a/TalentsMechanic.xml
+++ b/TalentsMechanic.xml
@@ -1,651 +0,0 @@
 <?xml version="1.0" encoding="utf-8"?>
 <Talents>
  <Talent identifier="powerarmor">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.powerarmor">
      <Replace tag="[bonusmovement]" value="25" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHasItem tags="deepdivinglarge" />
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
      </Abilities>
    </AbilityGroupInterval>
    <AddedRecipe itemidentifier="exosuit"/>
  </Talent>
  <Talent identifier="foolhardy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="foolhardy" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="berserker">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.lowhealthstatboost">
      <Replace tag="[health]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
              <Affliction identifier="berserker" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="mudraptorwrestler">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.mudraptorwrestler">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.additionalstattypeself">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData weapontype="NoWeapon,Melee" />
        <AbilityConditionCharacter>
          <Conditional group="eq mudraptor" />
        </AbilityConditionCharacter>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="heavylifting">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.heavylifting">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionHoldingItem tags="alienartifact,crate"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="iamthatguy">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.iamthatguy">
      <Replace tag="[amount]" value="20" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.skillbonus">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
      <Abilities>
        <CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="heavywrench"/>
  </Talent>
  <Talent identifier="robotics">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.robotics"/>
    <Description tag="talentdescription.roboticsreminder">
      <Replace tag="[amount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="defensebotspawner"/>
    <AddedRecipe itemidentifier="defensebotammobox"/>
  </Talent>
  <Talent identifier="ironstorm">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ironstorm">
      <Replace tag="[chance]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="scrapcannon"/>
  </Talent>
  <Talent identifier="residualwaste">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.residualwaste">
      <Replace tag="[chance]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.2"/>
        <!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
        <AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="massproduction">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.massproduction">
      <Replace tag="[chance]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
      <Conditions>
        <AbilityConditionServerRandom randomChance="0.4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityRemoveRandomIngredient>
          <AbilityConditionItem category="Material"/>
        </CharacterAbilityRemoveRandomIngredient>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="toolmaintenance">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.toolmaintenance">
      <Replace tag="[amount]" value="1" color="gui.green"/>
    </Description>
    <!-- Give once when unlocking the talent -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupEffect>
    <!-- Give every 60 seconds for late comers -->
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="miner">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
    <Description tag="talentdescription.miner">
      <Replace tag="[probability]" value="320" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.gainoredetachspeed">
      <Replace tag="[amount]" value="1600" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionServerRandom randomchance="12.8"/>
        <AbilityConditionItem tags="ore"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="retrofit">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.retrofit" />
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ironman">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="ironhelmet"/>
    <AddedRecipe itemidentifier="makeshiftarmor"/>
  </Talent>
  <Talent identifier="oiledmachinery">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.oiledmachinery">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="pumpndump">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.pumpndump">
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <conditions>
        <AbilityConditionItem tags="pump"/>
      </conditions>
      <Abilities>
        <CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="ballastdenizen">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
    <Description tag="talentdescription.ballastdenizen">
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="engineengineer">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
    <Description tag="talentdescription.engineengineer">
      <Replace tag="[amount]" value="2.5" color="gui.green"/>
      <Replace tag="[max]" value="5" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.doesnotstack" />
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="1" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="2" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="3" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="4" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="5" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="6" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel levelequals="7" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
      </Abilities>
    </AbilityGroupInterval>
    <AbilityGroupInterval interval="60">
      <Conditions>
        <AbilityConditionHasLevel minlevel="8" />
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="multifunctional">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.multifunctional">
      <Replace tag="[powerincrease]" value="50" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="wrenchitem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnAttack">
      <Conditions>
        <AbilityConditionAttackData tags="crowbaritem"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="salvagecrew">
    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
    <Description tag="talentdescription.bonusxponmission">
      <Replace tag="[xpbonus]" value="30" color="gui.green"/>
      <Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.salvagecrew">
      <Replace tag="[swimbonus]" value="50" color="gui.green"/>
      <Replace tag="[resistanceamount]" value="10" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
      <Conditions>
        <AbilityConditionMission missiontype="Salvage"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="1.3"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupInterval interval="0.9">
      <Conditions>
        <AbilityConditionInSubmarine submarinetype="Wreck" />
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="This" disabledeltatime="true">
              <Affliction identifier="salvagecrew" amount="1.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupInterval>
  </Talent>
  <Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.machinemaniac">
      <Replace tag="[bonus]" value="80" color="gui.green"/>
      <Replace tag="[amount]" value="3" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.30">
      <Replace tag="[requirement]" value="12" color="gui.green"/>
      <Replace tag="[amount]" value="10" color="gui.green"/>
      <Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
      <Replace tag="[xpamount]" value="500" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.50">
      <Replace tag="[requirement]" value="20" color="gui.green"/>
      <Replace tag="[level]" value="1" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.machinemaniac.100">
      <Replace tag="[requirement]" value="40" color="gui.green"/>
      <Replace tag="[amount]" value="50" color="gui.green"/>
    </Description>
    <!-- Give the player stats that tracks if the rewards should be given -->
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGiveExperience amount="2000"/>
        <CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="tinkerer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.increasemaxrepairmechanical">
      <Replace tag="[percentage]" value="40" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="modularrepairs">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.freeupgrade">
      <Replace tag="[level]" value="1" color="gui.green"/>
      <Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="repairpack"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="hullfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
    </Description>
    <Description tag="talentdescription.additionalstattype">
      <Replace tag="[amount]" value="25" color="gui.green"/>
      <Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="fixfoamgrenade"/>
    <AddedRecipe itemidentifier="handheldstatusmonitor"/>
  </Talent>
  <Talent identifier="letitdrain">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.letitdrain"/>
    <Description tag="talentdescription.letitdrainreminder">
      <Replace tag="[itemcount]" value="2" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
      </Abilities>
    </AbilityGroupEffect>
    <AddedRecipe itemidentifier="portablepump"/>
  </Talent>
  <Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.quickfixer">
      <Replace tag="[amount]" value="20" color="gui.green"/>
      <Replace tag="[duration]" value="10" color="gui.green"/>
    </Description>
    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
    <AbilityGroupEffect abilityeffecttype="None">
      <Abilities>
        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
      <Conditions>
        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityApplyStatusEffects>
          <StatusEffects>
            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
              <Affliction identifier="quickfixer" amount="10.0"/>
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilityApplyStatusEffects>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="scrapsavant">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
    <Description tag="talentdescription.doublescrapoutput" />
    <Description tag="talentdescription.findadditionalscrap">
      <Replace tag="[probability]" value="20" color="gui.green"/>
    </Description>
    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
      <Conditions>
        <AbilityConditionItem tags="scrap"/>
      </Conditions>
      <Abilities>
        <CharacterAbilityModifyValue multiplyvalue="2"/>
      </Abilities>
    </AbilityGroupEffect>
    <AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
      <Conditions>
        <AbilityConditionItemInSubmarine submarinetype="Wreck"/>
        <AbilityConditionItem tags="container"/>
      </Conditions>
      <Abilities>
        <CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
          <StatusEffects>
            <StatusEffect type="OnAbility" target="UseTarget" >
              <SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
            </StatusEffect>
          </StatusEffects>
        </CharacterAbilitySpawnItemsToContainer>
      </Abilities>
    </AbilityGroupEffect>
  </Talent>
  <Talent identifier="safetyfirst">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
    <Description tag="talentdescription.unlockrecipe">
      <Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
    </Description>
    <AddedRecipe itemidentifier="safetyharness"/>
  </Talent>
 </Talents>
--- a/cmd/log_format_test/main.go
+++ b/cmd/log_format_test/main.go
@@ -0,0 +1,27 @@
 package main
 import (
 	"modify/logger"
 	"time"
 )
 func main() {
 	// Initialize logger with DEBUG level
 	logger.Init(logger.LevelDebug)
 	// Test different log levels
 	logger.Info("This is an info message")
 	logger.Debug("This is a debug message")
 	logger.Warning("This is a warning message")
 	logger.Error("This is an error message")
 	logger.Trace("This is a trace message (not visible at DEBUG level)")
 	// Test with a goroutine
 	logger.SafeGo(func() {
 		time.Sleep(10 * time.Millisecond)
 		logger.Info("Message from goroutine")
 	})
 	// Wait for goroutine to complete
 	time.Sleep(20 * time.Millisecond)
 }
--- a/glob_test.go
+++ b/glob_test.go
@@ -1,6 +1,7 @@
 package main
 import (
 	"modify/utils"
 	"os"
 	"path/filepath"
 	"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
-			files, err := expandFilePatterns(tc.patterns)
+			// Convert string patterns to map[string]struct{} for ExpandGLobs
 			patternMap := make(map[string]struct{})
 			for _, pattern := range tc.patterns {
 				patternMap[pattern] = struct{}{}
 			}
 			files, err := utils.ExpandGLobs(patternMap)
 			if err != nil {
-				t.Fatalf("expandFilePatterns failed: %v", err)
+				t.Fatalf("ExpandGLobs failed: %v", err)
 			}
 			if len(files) != tc.expected {
--- a/go.mod
+++ b/go.mod
@@ -3,10 +3,10 @@ module modify
 go 1.24.1
 require (
 	github.com/PaesslerAG/jsonpath v0.1.1
 	github.com/antchfx/xmlquery v1.4.4
 	github.com/bmatcuk/doublestar/v4 v4.8.1
 	github.com/stretchr/testify v1.10.0
 	github.com/yuin/gopher-lua v1.1.1
 	gopkg.in/yaml.v3 v3.0.1
 )
 require (
@@ -15,12 +15,14 @@ require (
 	github.com/ProtonMail/go-crypto v1.1.5 // indirect
 	github.com/cloudflare/circl v1.6.0 // indirect
 	github.com/cyphar/filepath-securejoin v0.4.1 // indirect
 	github.com/davecgh/go-spew v1.1.1 // indirect
 	github.com/emirpasic/gods v1.18.1 // indirect
 	github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
 	github.com/go-git/go-billy/v5 v5.6.2 // indirect
 	github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect
 	github.com/kevinburke/ssh_config v1.2.0 // indirect
 	github.com/pjbgf/sha1cd v0.3.2 // indirect
 	github.com/pmezard/go-difflib v1.0.0 // indirect
 	github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect
 	github.com/skeema/knownhosts v1.3.1 // indirect
 	github.com/xanzy/ssh-agent v0.3.3 // indirect
@@ -30,10 +32,7 @@ require (
 )
 require (
 	github.com/PaesslerAG/gval v1.0.0 // indirect
 	github.com/antchfx/xpath v1.3.3 // indirect
 	github.com/go-git/go-git/v5 v5.14.0
 	github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect
 	golang.org/x/net v0.35.0 // indirect
 	golang.org/x/text v0.22.0 // indirect
 )
--- a/go.sum
+++ b/go.sum
@@ -3,19 +3,10 @@ dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk=
 github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY=
 github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY=
 github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU=
 github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
 github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
 github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
 github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
 github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
 github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4=
 github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE=
 github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8=
 github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4=
 github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
 github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
 github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
 github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
 github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio=
 github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs=
 github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
@@ -41,10 +32,8 @@ github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMj
 github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
 github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60=
 github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k=
 github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
 github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ=
 github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw=
 github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
 github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8=
 github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU=
 github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A=
@@ -80,91 +69,31 @@ github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOf
 github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
 github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM=
 github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw=
 github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
 github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
 github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
 golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
 golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
 golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
 golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
 golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
 golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
 golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
 golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs=
 golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ=
 golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8=
 golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY=
 golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
 golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
 golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
 golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
 golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
 golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
 golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
 golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
 golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
 golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
 golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
 golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
 golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
 golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
 golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
 golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
 golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
 golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc=
 golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
 golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
 golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
 golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
 golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
 golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
 golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
 golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
 golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU=
 golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
 golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
 golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
 golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
 golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
 golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
 golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
 golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
 golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
 golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
 golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
 golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
 golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
 golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
 gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
 gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
 gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
--- a/logger/logger.go
+++ b/logger/logger.go
@@ -1,12 +1,14 @@
 package logger
 import (
 	"bytes"
 	"fmt"
 	"io"
 	"log"
 	"os"
 	"path/filepath"
 	"runtime"
 	"strconv"
 	"strings"
 	"sync"
 	"time"
@@ -26,6 +28,8 @@ const (
 	LevelDebug
 	// LevelTrace is for very detailed tracing information
 	LevelTrace
 	// LevelLua is specifically for output from Lua scripts
 	LevelLua
 )
 var levelNames = map[LogLevel]string{
@@ -34,6 +38,7 @@ var levelNames = map[LogLevel]string{
 	LevelInfo:    "INFO",
 	LevelDebug:   "DEBUG",
 	LevelTrace:   "TRACE",
 	LevelLua:     "LUA",
 }
 var levelColors = map[LogLevel]string{
@@ -42,6 +47,7 @@ var levelColors = map[LogLevel]string{
 	LevelInfo:    "\033[1;32m", // Bold Green
 	LevelDebug:   "\033[1;36m", // Bold Cyan
 	LevelTrace:   "\033[1;35m", // Bold Magenta
 	LevelLua:     "\033[1;34m", // Bold Blue
 }
 // ResetColor is the ANSI code to reset text color
@@ -57,6 +63,7 @@ type Logger struct {
 	useColors     bool
 	callerOffset  int
 	defaultFields map[string]interface{}
 	showGoroutine bool
 }
 var (
@@ -81,6 +88,8 @@ func ParseLevel(levelStr string) LogLevel {
 		return LevelDebug
 	case "TRACE":
 		return LevelTrace
 	case "LUA":
 		return LevelLua
 	default:
 		return defaultLogLevel
 	}
@@ -104,6 +113,7 @@ func New(out io.Writer, prefix string, flag int) *Logger {
 		useColors:     true,
 		callerOffset:  0,
 		defaultFields: make(map[string]interface{}),
 		showGoroutine: true,
 	}
 }
@@ -139,6 +149,20 @@ func (l *Logger) SetCallerOffset(offset int) {
 	l.callerOffset = offset
 }
 // SetShowGoroutine sets whether to include goroutine ID in log messages
 func (l *Logger) SetShowGoroutine(show bool) {
 	l.mu.Lock()
 	defer l.mu.Unlock()
 	l.showGoroutine = show
 }
 // ShowGoroutine returns whether goroutine ID is included in log messages
 func (l *Logger) ShowGoroutine() bool {
 	l.mu.Lock()
 	defer l.mu.Unlock()
 	return l.showGoroutine
 }
 // WithField adds a field to the logger's context
 func (l *Logger) WithField(key string, value interface{}) *Logger {
 	newLogger := &Logger{
@@ -149,6 +173,7 @@ func (l *Logger) WithField(key string, value interface{}) *Logger {
 		useColors:     l.useColors,
 		callerOffset:  l.callerOffset,
 		defaultFields: make(map[string]interface{}),
 		showGoroutine: l.showGoroutine,
 	}
 	// Copy existing fields
@@ -171,6 +196,7 @@ func (l *Logger) WithFields(fields map[string]interface{}) *Logger {
 		useColors:     l.useColors,
 		callerOffset:  l.callerOffset,
 		defaultFields: make(map[string]interface{}),
 		showGoroutine: l.showGoroutine,
 	}
 	// Copy existing fields
@@ -185,6 +211,17 @@ func (l *Logger) WithFields(fields map[string]interface{}) *Logger {
 	return newLogger
 }
 // GetGoroutineID extracts the goroutine ID from the runtime stack
 func GetGoroutineID() string {
 	buf := make([]byte, 64)
 	n := runtime.Stack(buf, false)
 	// Format of first line is "goroutine N [state]:"
 	// We only need the N part
 	buf = buf[:n]
 	idField := bytes.Fields(bytes.Split(buf, []byte{':'})[0])[1]
 	return string(idField)
 }
 // formatMessage formats a log message with level, time, file, and line information
 func (l *Logger) formatMessage(level LogLevel, format string, args ...interface{}) string {
 	var msg string
@@ -212,7 +249,25 @@ func (l *Logger) formatMessage(level LogLevel, format string, args ...interface{
 	var caller string
 	if l.flag&log.Lshortfile != 0 || l.flag&log.Llongfile != 0 {
-		_, file, line, ok := runtime.Caller(3 + l.callerOffset)
+		// Find the actual caller by scanning up the stack
 		// until we find a function outside the logger package
 		var file string
 		var line int
 		var ok bool
 		// Start at a reasonable depth and scan up to 10 frames
 		for depth := 4; depth < 15; depth++ {
 			_, file, line, ok = runtime.Caller(depth)
 			if !ok {
 				break
 			}
 			// If the caller is not in the logger package, we found our caller
 			if !strings.Contains(file, "logger/logger.go") {
 				break
 			}
 		}
 		if !ok {
 			file = "???"
 			line = 0
@@ -221,9 +276,10 @@ func (l *Logger) formatMessage(level LogLevel, format string, args ...interface{
 		if l.flag&log.Lshortfile != 0 {
 			file = filepath.Base(file)
 		}
-		caller = fmt.Sprintf("%s:%d ", file, line)
+		caller = fmt.Sprintf("%-25s ", file+":"+strconv.Itoa(line))
 	}
 	// Format the timestamp with fixed width
 	var timeStr string
 	if l.flag&(log.Ldate|log.Ltime|log.Lmicroseconds) != 0 {
 		t := time.Now()
@@ -235,17 +291,30 @@ func (l *Logger) formatMessage(level LogLevel, format string, args ...interface{
 			if l.flag&log.Lmicroseconds != 0 {
 				timeStr += fmt.Sprintf(".%06d", t.Nanosecond()/1000)
 			}
 			timeStr += " "
 		}
 		timeStr = fmt.Sprintf("%-15s ", timeStr)
 	}
-	return fmt.Sprintf("%s%s%s%s[%s%s%s]%s %s\n",
+	// Add goroutine ID if enabled, with fixed width
-		l.prefix, timeStr, caller, levelColor, levelNames[level], resetColor, fields, resetColor, msg)
+	var goroutineStr string
 	if l.showGoroutine {
 		goroutineID := GetGoroutineID()
 		goroutineStr = fmt.Sprintf("[g:%-4s] ", goroutineID)
 	}
 	// Create a colored level indicator with both brackets colored
 	levelStr := fmt.Sprintf("%s[%s]%s", levelColor, levelNames[level], levelColor)
 	// Add a space after the level and before the reset color
 	levelColumn := fmt.Sprintf("%s %s", levelStr, resetColor)
 	return fmt.Sprintf("%s%s%s%s%s%s%s\n",
 		l.prefix, timeStr, caller, goroutineStr, levelColumn, msg, fields)
 }
 // log logs a message at the specified level
 func (l *Logger) log(level LogLevel, format string, args ...interface{}) {
-	if level > l.currentLevel {
+	// Always show LUA level logs regardless of the current log level
 	if level != LevelLua && level > l.currentLevel {
 		return
 	}
@@ -281,6 +350,11 @@ func (l *Logger) Trace(format string, args ...interface{}) {
 	l.log(LevelTrace, format, args...)
 }
 // Lua logs a Lua message
 func (l *Logger) Lua(format string, args ...interface{}) {
 	l.log(LevelLua, format, args...)
 }
 // Global log functions that use DefaultLogger
 // Error logs an error message using the default logger
@@ -323,6 +397,24 @@ func Trace(format string, args ...interface{}) {
 	DefaultLogger.Trace(format, args...)
 }
 // Lua logs a Lua message using the default logger
 func Lua(format string, args ...interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.Lua(format, args...)
 }
 // LogPanic logs a panic error and its stack trace
 func LogPanic(r interface{}) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	stack := make([]byte, 4096)
 	n := runtime.Stack(stack, false)
 	DefaultLogger.Error("PANIC: %v\n%s", r, stack[:n])
 }
 // SetLevel sets the log level for the default logger
 func SetLevel(level LogLevel) {
 	if DefaultLogger == nil {
@@ -355,3 +447,19 @@ func WithFields(fields map[string]interface{}) *Logger {
 	}
 	return DefaultLogger.WithFields(fields)
 }
 // SetShowGoroutine enables or disables goroutine ID display in the default logger
 func SetShowGoroutine(show bool) {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	DefaultLogger.SetShowGoroutine(show)
 }
 // ShowGoroutine returns whether goroutine ID is included in default logger's messages
 func ShowGoroutine() bool {
 	if DefaultLogger == nil {
 		Init(defaultLogLevel)
 	}
 	return DefaultLogger.ShowGoroutine()
 }
--- a/logger/panic_handler.go
+++ b/logger/panic_handler.go
@@ -0,0 +1,49 @@
 package logger
 import (
 	"fmt"
 	"runtime/debug"
 )
 // PanicHandler handles a panic and logs it
 func PanicHandler() {
 	if r := recover(); r != nil {
 		goroutineID := GetGoroutineID()
 		stackTrace := debug.Stack()
 		Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
 	}
 }
 // SafeGo launches a goroutine with panic recovery
 // Usage: logger.SafeGo(func() { ... your code ... })
 func SafeGo(f func()) {
 	go func() {
 		defer PanicHandler()
 		f()
 	}()
 }
 // SafeGoWithArgs launches a goroutine with panic recovery and passes arguments
 // Usage: logger.SafeGoWithArgs(func(arg1, arg2 interface{}) { ... }, "value1", 42)
 func SafeGoWithArgs(f func(...interface{}), args ...interface{}) {
 	go func() {
 		defer PanicHandler()
 		f(args...)
 	}()
 }
 // SafeExec executes a function with panic recovery
 // Useful for code that should not panic
 func SafeExec(f func()) (err error) {
 	defer func() {
 		if r := recover(); r != nil {
 			goroutineID := GetGoroutineID()
 			stackTrace := debug.Stack()
 			Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
 			err = fmt.Errorf("panic recovered: %v", r)
 		}
 	}()
 	f()
 	return nil
 }
--- a/main.go
+++ b/main.go
@@ -3,18 +3,17 @@ package main
 import (
 	"flag"
 	"fmt"
 	"log"
 	"os"
-	"path/filepath"
+	"sort"
 	"sync"
 	"time"
-	"github.com/bmatcuk/doublestar/v4"
+	"modify/processor"
 	"modify/utils"
 	"github.com/go-git/go-git/v5"
 	"github.com/go-git/go-git/v5/plumbing/object"
 	"modify/logger"
 	"modify/processor"
 )
 type GlobalStats struct {
@@ -22,317 +21,307 @@ type GlobalStats struct {
 	TotalModifications      int
 	ProcessedFiles          int
 	FailedFiles             int
 	ModificationsPerCommand sync.Map
 }
 var stats GlobalStats
 var stdLogger *log.Logger // Legacy logger for compatibility
 var (
 	jsonFlag  = flag.Bool("json", false, "Process JSON files")
 	xmlFlag   = flag.Bool("xml", false, "Process XML files")
 	gitFlag   = flag.Bool("git", false, "Use git to manage files")
 	resetFlag = flag.Bool("reset", false, "Reset files to their original state")
 	logLevel  = flag.String("loglevel", "INFO", "Set log level: ERROR, WARNING, INFO, DEBUG, TRACE")
 	repo     *git.Repository
 	worktree *git.Worktree
 	stats    GlobalStats = GlobalStats{
 		ModificationsPerCommand: sync.Map{},
 	}
 )
 func init() {
 	// Keep standard logger setup for compatibility with legacy code
 	log.SetFlags(log.Lmicroseconds | log.Lshortfile)
 	stdLogger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
 	stats = GlobalStats{}
 }
 func main() {
 	// TODO: Implement some sort of git integration
 	// Maybe use go-git
 	// Specify a -git flag
 	// If we are operating with git then:
 	// Inmitialize a repo if one doesn't exist (try to open right?)
 	// For each file matched by glob first figure out if it's already tracked
 	// If not tracked then track it and commit (either it alone or maybe multiple together somehow)
 	// Then reset the file (to undo previous modifications)
 	// THEN change the file
 	// In addition add a -undo flag that will ONLY reset the files without changing them
 	// Only for the ones matched by glob
 	// ^ important because binary files would fuck us up
 	flag.Usage = func() {
 		fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nOptions:\n")
 		fmt.Fprintf(os.Stderr, "  -json\n")
 		fmt.Fprintf(os.Stderr, "        Process JSON files\n")
 		fmt.Fprintf(os.Stderr, "  -xml\n")
 		fmt.Fprintf(os.Stderr, "        Process XML files\n")
 		fmt.Fprintf(os.Stderr, "  -git\n")
 		fmt.Fprintf(os.Stderr, "        Use git to manage files\n")
 		fmt.Fprintf(os.Stderr, "  -reset\n")
 		fmt.Fprintf(os.Stderr, "        Reset files to their original state\n")
 		fmt.Fprintf(os.Stderr, "  -loglevel string\n")
 		fmt.Fprintf(os.Stderr, "        Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
 		fmt.Fprintf(os.Stderr, "  -mode string\n")
 		fmt.Fprintf(os.Stderr, "        Processing mode: regex, xml, json (default \"regex\")\n")
 		fmt.Fprintf(os.Stderr, "\nExamples:\n")
 		fmt.Fprintf(os.Stderr, "  Regex mode (default):\n")
 		fmt.Fprintf(os.Stderr, "    %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "  XML mode:\n")
 		fmt.Fprintf(os.Stderr, "    %s -xml \"//value\" \"*1.5\" data.xml\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "  JSON mode:\n")
 		fmt.Fprintf(os.Stderr, "    %s -json \"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
 		fmt.Fprintf(os.Stderr, "      s1, s2, etc. are used to refer to capture groups as strings.\n")
 		fmt.Fprintf(os.Stderr, "      Helper functions: num(str) converts string to number, str(num) converts number to string\n")
 		fmt.Fprintf(os.Stderr, "      is_number(str) checks if a string is numeric\n")
 		fmt.Fprintf(os.Stderr, "      For XML and JSON, the captured values are exposed as 'v', which can be of any type we capture (string, number, table).\n")
 		fmt.Fprintf(os.Stderr, "      If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n")
 		fmt.Fprintf(os.Stderr, "      You can use any valid Lua code, including if statements, loops, etc.\n")
 		fmt.Fprintf(os.Stderr, "      Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
 	}
-
+	// TODO: Fix bed shitting when doing *.yml in barotrauma directory
 	flag.Parse()
 	args := flag.Args()
-	// Initialize logger with the specified log level
+	level := logger.ParseLevel(*utils.LogLevel)
 	level := logger.ParseLevel(*logLevel)
 	logger.Init(level)
 	logger.Info("Initializing with log level: %s", level.String())
-	args := flag.Args()
+	// The plan is:
-	if *resetFlag {
+	// Load all commands
-		*gitFlag = true
+	commands, err := utils.LoadCommands(args)
-	}
+	if err != nil {
-
+		logger.Error("Failed to load commands: %v", err)
 	if len(args) < 3 {
 		logger.Error("At least %d arguments are required", 3)
 		flag.Usage()
 		return
 	}
-	// Get the appropriate pattern and expression based on mode
+	if *utils.Filter != "" {
-	var pattern, luaExpr string
+		logger.Info("Filtering commands by name: %s", *utils.Filter)
-	var filePatterns []string
+		commands = utils.FilterCommands(commands, *utils.Filter)
-
+		logger.Info("Filtered %d commands", len(commands))
 	pattern = args[0]
 	luaExpr = args[1]
 	filePatterns = args[2:]
 	// Prepare the Lua expression
 	originalLuaExpr := luaExpr
 	luaExpr = processor.BuildLuaScript(luaExpr)
 	if originalLuaExpr != luaExpr {
 		logger.Debug("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
 	}
-	if *gitFlag {
+	// Then aggregate all the globs and deduplicate them
-		logger.Info("Git integration enabled, setting up git repository")
+	globs := utils.AggregateGlobs(commands)
-		err := setupGit()
+	logger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
-		if err != nil {
+
-			logger.Error("Failed to setup git: %v", err)
+	for _, command := range commands {
-			fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
+		logger.Trace("Command: %s", command.Name)
-			return
+		logger.Trace("Regex: %s", command.Regex)
-		}
+		logger.Trace("Files: %v", command.Files)
 		logger.Trace("Lua: %s", command.Lua)
 		logger.Trace("Git: %t", command.Git)
 		logger.Trace("Reset: %t", command.Reset)
 		logger.Trace("Isolate: %t", command.Isolate)
 		logger.Trace("LogLevel: %s", command.LogLevel)
 	}
-	// Expand file patterns with glob support
+	// Resolve all the files for all the globs
-	logger.Debug("Expanding file patterns: %v", filePatterns)
+	logger.Info("Found %d unique file patterns", len(globs))
-	files, err := expandFilePatterns(filePatterns)
+	files, err := utils.ExpandGLobs(globs)
 	if err != nil {
 		logger.Error("Failed to expand file patterns: %v", err)
 		fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
 		return
 	}
 	logger.Info("Found %d files to process", len(files))
-	if len(files) == 0 {
+	// Somehow connect files to commands via globs..
-		logger.Warning("No files found matching the specified patterns")
+	// For each file check every glob of every command
-		fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
+	// Maybe memoize this part
-		return
+	// That way we know what commands affect what files
-	}
+	associations, err := utils.AssociateFilesWithCommands(files, commands)
 	if *gitFlag {
 		logger.Info("Cleaning up git files before processing")
 		err := cleanupGitFiles(files)
 	if err != nil {
-			logger.Error("Failed to cleanup git files: %v", err)
+		logger.Error("Failed to associate files with commands: %v", err)
 			fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
 			return
 		}
 	}
 	if *resetFlag {
 		logger.Info("Files reset to their original state, nothing more to do")
 		log.Printf("Files reset to their original state, nothing more to do")
 		return
 	}
-	// Create the processor based on mode
+	// Then for each file run all commands associated with the file
-	var proc processor.Processor
+	workers := make(chan struct{}, *utils.ParallelFiles)
-	switch {
+	wg := sync.WaitGroup{}
-	case *xmlFlag:
+
-		proc = &processor.XMLProcessor{}
+	// Add performance tracking
-		logger.Info("Starting XML modifier with XPath %q, expression %q on %d files",
+	startTime := time.Now()
-			pattern, luaExpr, len(files))
+	var fileMutex sync.Mutex
-	case *jsonFlag:
+
-		proc = &processor.JSONProcessor{}
+	// Create a map to store loggers for each command
-		logger.Info("Starting JSON modifier with JSONPath %q, expression %q on %d files",
+	commandLoggers := make(map[string]*logger.Logger)
-			pattern, luaExpr, len(files))
+	for _, command := range commands {
-	default:
+		// Create a named logger for each command
-		proc = &processor.RegexProcessor{}
+		cmdName := command.Name
-		logger.Info("Starting regex modifier with pattern %q, expression %q on %d files",
+		if cmdName == "" {
-			pattern, luaExpr, len(files))
+			// If no name is provided, use a short version of the regex pattern
 			if len(command.Regex) > 20 {
 				cmdName = command.Regex[:17] + "..."
 			} else {
 				cmdName = command.Regex
 			}
 		}
-	var wg sync.WaitGroup
+		// Parse the log level for this specific command
-	// Process each file
+		cmdLogLevel := logger.ParseLevel(command.LogLevel)
-	for _, file := range files {
+
 		// Create a logger with the command name as a field
 		commandLoggers[command.Name] = logger.WithField("command", cmdName)
 		commandLoggers[command.Name].SetLevel(cmdLogLevel)
 		logger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
 	}
 	// This aggregation is great but what if one modification replaces the whole entire file?
 	// Shit......
 	// TODO: Add "Isolate" field to modifications which makes them run alone
 	for file, association := range associations {
 		workers <- struct{}{}
 		wg.Add(1)
-		go func(file string) {
+		logger.SafeGoWithArgs(func(args ...interface{}) {
 			defer func() { <-workers }()
 			defer wg.Done()
 			logger.Debug("Processing file: %s", file)
-			// It's a bit fucked, maybe I could do better to call it from proc... But it'll do for now
+			// Track per-file processing time
-			modCount, matchCount, err := processor.Process(proc, file, pattern, luaExpr)
+			fileStartTime := time.Now()
 			fileData, err := os.ReadFile(file)
 			if err != nil {
-				logger.Error("Failed to process file %s: %v", file, err)
+				logger.Error("Failed to read file %q: %v", file, err)
-				fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
+				return
 				stats.FailedFiles++
 			} else {
 				if modCount > 0 {
 					logger.Info("Successfully processed file %s: %d modifications from %d matches",
 						file, modCount, matchCount)
 				} else if matchCount > 0 {
 					logger.Info("Found %d matches in file %s but made no modifications",
 						matchCount, file)
 				} else {
 					logger.Debug("No matches found in file: %s", file)
 			}
-				stats.ProcessedFiles++
+			fileDataStr := string(fileData)
-				stats.TotalMatches += matchCount
+
-				stats.TotalModifications += modCount
+			fileDataStr, err = RunIsolateCommands(association, file, fileDataStr, &fileMutex)
 			if err != nil {
 				logger.Error("Failed to run isolate commands for file %q: %v", file, err)
 				return
 			}
-		}(file)
+
 			fileDataStr, err = RunOtherCommands(file, fileDataStr, association, &fileMutex, commandLoggers)
 			if err != nil {
 				logger.Error("Failed to run other commands for file %q: %v", file, err)
 				return
 			}
 			err = os.WriteFile(file, []byte(fileDataStr), 0644)
 			if err != nil {
 				logger.Error("Failed to write file %q: %v", file, err)
 				return
 			}
 			logger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
 		}, file, commands)
 	}
 	wg.Wait()
 	processingTime := time.Since(startTime)
 	logger.Info("Processing completed in %v", processingTime)
 	if stats.ProcessedFiles > 0 {
 		logger.Info("Average time per file: %v", processingTime/time.Duration(stats.ProcessedFiles))
 	}
 	// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
 	// Do that with logger.WithField("loglevel", level.String())
 	// Since each command also has its own log level
 	// TODO: Maybe even figure out how to run individual commands...?
 	// TODO: What to do with git? Figure it out ....
 	// if *gitFlag {
 	// 	logger.Info("Git integration enabled, setting up git repository")
 	// 	err := setupGit()
 	// 	if err != nil {
 	// 		logger.Error("Failed to setup git: %v", err)
 	// 		fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
 	// 		return
 	// 	}
 	// }
 	// logger.Debug("Expanding file patterns")
 	// files, err := expandFilePatterns(filePatterns)
 	// if err != nil {
 	// 	logger.Error("Failed to expand file patterns: %v", err)
 	// 	fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
 	// 	return
 	// }
 	// if *gitFlag {
 	// 	logger.Info("Cleaning up git files before processing")
 	// 	err := cleanupGitFiles(files)
 	// 	if err != nil {
 	// 		logger.Error("Failed to cleanup git files: %v", err)
 	// 		fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
 	// 		return
 	// 	}
 	// }
 	// if *resetFlag {
 	// 	logger.Info("Files reset to their original state, nothing more to do")
 	// 	log.Printf("Files reset to their original state, nothing more to do")
 	// 	return
 	// }
 	// Print summary
 	if stats.TotalModifications == 0 {
 		logger.Warning("No modifications were made in any files")
 		fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
 	} else {
 		logger.Info("Operation complete! Modified %d values in %d/%d files",
 			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
-		fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
+		sortedCommands := []string{}
-			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
+		stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
-	}
+			sortedCommands = append(sortedCommands, key.(string))
-}
+			return true
 func setupGit() error {
 	cwd, err := os.Getwd()
 	if err != nil {
 		return fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	logger.Debug("Current working directory obtained: %s", cwd)
 	logger.Debug("Attempting to open git repository at %s", cwd)
 	repo, err = git.PlainOpen(cwd)
 	if err != nil {
 		logger.Debug("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
 		repo, err = git.PlainInit(cwd, false)
 		if err != nil {
 			return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
 		}
 		logger.Info("Successfully initialized a new git repository at %s", cwd)
 	} else {
 		logger.Info("Successfully opened existing git repository at %s", cwd)
 	}
 	logger.Debug("Attempting to obtain worktree for repository at %s", cwd)
 	worktree, err = repo.Worktree()
 	if err != nil {
 		return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
 	}
 	logger.Debug("Successfully obtained worktree for repository at %s", cwd)
 	return nil
 }
 func expandFilePatterns(patterns []string) ([]string, error) {
 	var files []string
 	filesMap := make(map[string]bool)
 	cwd, err := os.Getwd()
 	if err != nil {
 		return nil, fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	logger.Debug("Expanding patterns from directory: %s", cwd)
 	for _, pattern := range patterns {
 		logger.Trace("Processing pattern: %s", pattern)
 		matches, _ := doublestar.Glob(os.DirFS(cwd), pattern)
 		logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
 		for _, m := range matches {
 			info, err := os.Stat(m)
 			if err != nil {
 				logger.Warning("Error getting file info for %s: %v", m, err)
 				continue
 			}
 			if !info.IsDir() && !filesMap[m] {
 				logger.Trace("Adding file to process list: %s", m)
 				filesMap[m], files = true, append(files, m)
 			}
 		}
 	}
 	if len(files) > 0 {
 		logger.Debug("Found %d files to process: %v", len(files), files)
 	}
 	return files, nil
 }
 func cleanupGitFiles(files []string) error {
 	for _, file := range files {
 		logger.Debug("Checking git status for file: %s", file)
 		status, err := worktree.Status()
 		if err != nil {
 			logger.Error("Error getting worktree status: %v", err)
 			fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
 			return fmt.Errorf("error getting worktree status: %w", err)
 		}
 		if status.IsUntracked(file) {
 			logger.Info("Detected untracked file: %s. Adding to git index.", file)
 			_, err = worktree.Add(file)
 			if err != nil {
 				logger.Error("Error adding file to git: %v", err)
 				fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
 				return fmt.Errorf("error adding file to git: %w", err)
 			}
 			filename := filepath.Base(file)
 			logger.Info("File %s added successfully. Committing with message: 'Track %s'", filename, filename)
 			_, err = worktree.Commit("Track "+filename, &git.CommitOptions{
 				Author: &object.Signature{
 					Name:  "Big Chef",
 					Email: "bigchef@bigchef.com",
 					When:  time.Now(),
 				},
 		})
-			if err != nil {
+		sort.Strings(sortedCommands)
-				logger.Error("Error committing file: %v", err)
+
-				fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
+		for _, command := range sortedCommands {
-				return fmt.Errorf("error committing file: %w", err)
+			count, _ := stats.ModificationsPerCommand.Load(command)
-			}
+			if count.(int) > 0 {
-			logger.Info("Successfully committed file: %s", filename)
+				logger.Info("\tCommand %q made %d modifications", command, count)
 			} else {
-			logger.Info("File %s is already tracked. Restoring it to the working tree.", file)
+				logger.Warning("\tCommand %q made no modifications", command)
-			err := worktree.Restore(&git.RestoreOptions{
+			}
 				Files:    []string{file},
 				Staged:   true,
 				Worktree: true,
 			})
 			if err != nil {
 				logger.Error("Error restoring file: %v", err)
 				fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
 				return fmt.Errorf("error restoring file: %w", err)
 			}
 			logger.Info("File %s restored successfully", file)
 		}
 	}
-	return nil
+}
 func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, fileMutex *sync.Mutex, commandLoggers map[string]*logger.Logger) (string, error) {
 	// Aggregate all the modifications and execute them
 	modifications := []utils.ReplaceCommand{}
 	for _, command := range association.Commands {
 		// Use command-specific logger if available, otherwise fall back to default logger
 		cmdLogger := logger.DefaultLogger
 		if cmdLog, ok := commandLoggers[command.Name]; ok {
 			cmdLogger = cmdLog
 		}
 		cmdLogger.Info("Processing file %q with command %q", file, command.Regex)
 		newModifications, err := processor.ProcessRegex(fileDataStr, command, file)
 		if err != nil {
 			return fileDataStr, fmt.Errorf("failed to process file %q with command %q: %w", file, command.Regex, err)
 		}
 		modifications = append(modifications, newModifications...)
 		// It is not guranteed that all the commands will be executed...
 		// TODO: Make this better
 		// We'd have to pass the map to executemodifications or something...
 		count, ok := stats.ModificationsPerCommand.Load(command.Name)
 		if !ok {
 			count = 0
 		}
 		stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
 		cmdLogger.Debug("Command %q generated %d modifications", command.Name, len(newModifications))
 	}
 	if len(modifications) == 0 {
 		logger.Info("No modifications found for file %q", file)
 		return fileDataStr, nil
 	}
 	// Sort commands in reverse order for safe replacements
 	var count int
 	fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
 	fileMutex.Lock()
 	stats.ProcessedFiles++
 	stats.TotalModifications += count
 	fileMutex.Unlock()
 	logger.Info("Executed %d modifications for file %q", count, file)
 	return fileDataStr, nil
 }
 func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string, fileMutex *sync.Mutex) (string, error) {
 	for _, isolateCommand := range association.IsolateCommands {
 		logger.Info("Processing file %q with isolate command %q", file, isolateCommand.Regex)
 		modifications, err := processor.ProcessRegex(fileDataStr, isolateCommand, file)
 		if err != nil {
 			return fileDataStr, fmt.Errorf("failed to process file %q with isolate command %q: %w", file, isolateCommand.Regex, err)
 		}
 		if len(modifications) == 0 {
 			logger.Warning("No modifications found for file %q", file)
 			return fileDataStr, nil
 		}
 		var count int
 		fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
 		fileMutex.Lock()
 		stats.ProcessedFiles++
 		stats.TotalModifications += count
 		fileMutex.Unlock()
 		logger.Info("Executed %d isolate modifications for file %q", count, file)
 	}
 	return fileDataStr, nil
 }
--- a/processor/json.go
+++ b/processor/json.go
@@ -1,194 +0,0 @@
 package processor
 import (
 	"encoding/json"
 	"fmt"
 	"modify/logger"
 	"modify/processor/jsonpath"
 	lua "github.com/yuin/gopher-lua"
 )
 // JSONProcessor implements the Processor interface for JSON documents
 type JSONProcessor struct{}
 // ProcessContent implements the Processor interface for JSONProcessor
 func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
 	logger.Debug("Processing JSON content with JSONPath: %s", pattern)
 	// Parse JSON document
 	logger.Trace("Parsing JSON document")
 	var jsonData interface{}
 	err := json.Unmarshal([]byte(content), &jsonData)
 	if err != nil {
 		logger.Error("Failed to parse JSON: %v", err)
 		return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
 	}
 	// Find nodes matching the JSONPath pattern
 	logger.Debug("Executing JSONPath query: %s", pattern)
 	nodes, err := jsonpath.Get(jsonData, pattern)
 	if err != nil {
 		logger.Error("Failed to execute JSONPath: %v", err)
 		return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
 	}
 	matchCount := len(nodes)
 	logger.Debug("Found %d nodes matching JSONPath", matchCount)
 	if matchCount == 0 {
 		logger.Warning("No nodes matched the JSONPath pattern: %s", pattern)
 		return content, 0, 0, nil
 	}
 	modCount := 0
 	for i, node := range nodes {
 		logger.Trace("Processing node #%d at path: %s with value: %v", i+1, node.Path, node.Value)
 		// Initialize Lua
 		L, err := NewLuaState()
 		if err != nil {
 			logger.Error("Failed to create Lua state: %v", err)
 			return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		defer L.Close()
 		logger.Trace("Lua state initialized successfully")
 		err = p.ToLua(L, node.Value)
 		if err != nil {
 			logger.Error("Failed to convert value to Lua: %v", err)
 			return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
 		}
 		logger.Trace("Converted node value to Lua: %v", node.Value)
 		originalScript := luaExpr
 		fullScript := BuildLuaScript(luaExpr)
 		logger.Debug("Original script: %q, Full script: %q", originalScript, fullScript)
 		// Execute Lua script
 		logger.Trace("Executing Lua script: %q", fullScript)
 		if err := L.DoString(fullScript); err != nil {
 			logger.Error("Failed to execute Lua script: %v", err)
 			return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
 		}
 		logger.Trace("Lua script executed successfully")
 		// Get modified value
 		result, err := p.FromLua(L)
 		if err != nil {
 			logger.Error("Failed to get result from Lua: %v", err)
 			return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
 		}
 		logger.Trace("Retrieved modified value from Lua: %v", result)
 		modified := false
 		modified = L.GetGlobal("modified").String() == "true"
 		if !modified {
 			logger.Debug("No changes made to node at path: %s", node.Path)
 			continue
 		}
 		// Apply the modification to the JSON data
 		logger.Debug("Updating JSON at path: %s with new value: %v", node.Path, result)
 		err = p.updateJSONValue(jsonData, node.Path, result)
 		if err != nil {
 			logger.Error("Failed to update JSON at path %s: %v", node.Path, err)
 			return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
 		}
 		logger.Debug("Updated JSON at path: %s successfully", node.Path)
 		modCount++
 	}
 	logger.Info("JSON processing complete: %d modifications from %d matches", modCount, matchCount)
 	// Convert the modified JSON back to a string with same formatting
 	logger.Trace("Marshalling JSON data back to string")
 	var jsonBytes []byte
 	jsonBytes, err = json.MarshalIndent(jsonData, "", "  ")
 	if err != nil {
 		logger.Error("Failed to marshal JSON: %v", err)
 		return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
 	}
 	return string(jsonBytes), modCount, matchCount, nil
 }
 // updateJSONValue updates a value in the JSON structure based on its JSONPath
 func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
 	logger.Trace("Updating JSON value at path: %s", path)
 	// Special handling for root node
 	if path == "$" {
 		logger.Debug("Handling special case for root node update")
 		// For the root node, we'll copy the value to the jsonData reference
 		// This is a special case since we can't directly replace the interface{} variable
 		// We need to handle different types of root elements
 		switch rootValue := newValue.(type) {
 		case map[string]interface{}:
 			// For objects, we need to copy over all keys
 			rootMap, ok := jsonData.(map[string]interface{})
 			if !ok {
 				// If the original wasn't a map, completely replace it with the new map
 				// This is handled by the jsonpath.Set function
 				logger.Debug("Root was not a map, replacing entire root")
 				return jsonpath.Set(jsonData, path, newValue)
 			}
 			// Clear the original map
 			logger.Trace("Clearing original root map")
 			for k := range rootMap {
 				delete(rootMap, k)
 			}
 			// Copy all keys from the new map
 			logger.Trace("Copying keys to root map")
 			for k, v := range rootValue {
 				rootMap[k] = v
 			}
 			return nil
 		case []interface{}:
 			// For arrays, we need to handle similarly
 			rootArray, ok := jsonData.([]interface{})
 			if !ok {
 				// If the original wasn't an array, use jsonpath.Set
 				logger.Debug("Root was not an array, replacing entire root")
 				return jsonpath.Set(jsonData, path, newValue)
 			}
 			// Clear and recreate the array
 			logger.Trace("Replacing root array")
 			*&rootArray = rootValue
 			return nil
 		default:
 			// For other types, use jsonpath.Set
 			logger.Debug("Replacing root with primitive value")
 			return jsonpath.Set(jsonData, path, newValue)
 		}
 	}
 	// For non-root paths, use the regular Set method
 	logger.Trace("Using regular Set method for non-root path")
 	err := jsonpath.Set(jsonData, path, newValue)
 	if err != nil {
 		logger.Error("Failed to set JSON value at path %s: %v", path, err)
 		return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
 	}
 	return nil
 }
 // ToLua converts JSON values to Lua variables
 func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
 	table, err := ToLua(L, data)
 	if err != nil {
 		return err
 	}
 	L.SetGlobal("v", table)
 	return nil
 }
 // FromLua retrieves values from Lua
 func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	luaValue := L.GetGlobal("v")
 	return FromLua(L, luaValue)
 }
--- a/processor/json_test.go
+++ b/processor/json_test.go
--- a/processor/jsonpath/jsonpath.go
+++ b/processor/jsonpath/jsonpath.go
@@ -1,490 +0,0 @@
 package jsonpath
 import (
 	"fmt"
 	"strconv"
 )
 // JSONStep represents a single step in a JSONPath query
 type JSONStep struct {
 	Type  StepType
 	Key   string // For Child/RecursiveDescent
 	Index int    // For Index (use -1 for wildcard "*")
 }
 // JSONNode represents a value in the JSON data with its path
 type JSONNode struct {
 	Value interface{} // The value found at the path
 	Path  string      // The exact JSONPath where the value was found
 }
 // StepType defines the types of steps in a JSONPath
 type StepType int
 const (
 	RootStep             StepType = iota // $ - The root element
 	ChildStep                            // .key - Direct child access
 	RecursiveDescentStep                 // ..key - Recursive search for key
 	WildcardStep                         // .* - All children of an object
 	IndexStep                            // [n] - Array index access (or [*] for all elements)
 )
 // TraversalMode determines how the traversal behaves
 type TraversalMode int
 const (
 	CollectMode     TraversalMode = iota // Just collect matched nodes
 	ModifyFirstMode                      // Modify first matching node
 	ModifyAllMode                        // Modify all matching nodes
 )
 // ParseJSONPath parses a JSONPath string into a sequence of steps
 func ParseJSONPath(path string) ([]JSONStep, error) {
 	if len(path) == 0 || path[0] != '$' {
 		return nil, fmt.Errorf("path must start with $; received: %q", path)
 	}
 	steps := []JSONStep{}
 	i := 0
 	for i < len(path) {
 		switch path[i] {
 		case '$':
 			steps = append(steps, JSONStep{Type: RootStep})
 			i++
 		case '.':
 			i++
 			if i < len(path) && path[i] == '.' {
 				// Recursive descent
 				i++
 				key, nextPos := readKey(path, i)
 				steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
 				i = nextPos
 			} else {
 				// Child step or wildcard
 				key, nextPos := readKey(path, i)
 				if key == "*" {
 					steps = append(steps, JSONStep{Type: WildcardStep})
 				} else {
 					steps = append(steps, JSONStep{Type: ChildStep, Key: key})
 				}
 				i = nextPos
 			}
 		case '[':
 			// Index step
 			i++
 			indexStr, nextPos := readIndex(path, i)
 			if indexStr == "*" {
 				steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
 			} else {
 				index, err := strconv.Atoi(indexStr)
 				if err != nil {
 					return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
 				}
 				steps = append(steps, JSONStep{Type: IndexStep, Index: index})
 			}
 			i = nextPos + 1 // Skip closing ]
 		default:
 			return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
 		}
 	}
 	return steps, nil
 }
 // readKey extracts a key name from the path
 func readKey(path string, start int) (string, int) {
 	i := start
 	for ; i < len(path); i++ {
 		if path[i] == '.' || path[i] == '[' {
 			break
 		}
 	}
 	return path[start:i], i
 }
 // readIndex extracts an array index or wildcard from the path
 func readIndex(path string, start int) (string, int) {
 	i := start
 	for ; i < len(path); i++ {
 		if path[i] == ']' {
 			break
 		}
 	}
 	return path[start:i], i
 }
 // Get retrieves values with their paths from data at the specified JSONPath
 // Each returned JSONNode contains both the value and its exact path in the data structure
 func Get(data interface{}, path string) ([]JSONNode, error) {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	results := []JSONNode{}
 	err = traverseWithPaths(data, steps, &results, "$")
 	if err != nil {
 		return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
 	}
 	return results, nil
 }
 // Set updates the value at the specified JSONPath in the original data structure.
 // It only modifies the first matching node.
 func Set(data interface{}, path string, value interface{}) error {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	success := false
 	err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
 	if err != nil {
 		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
 	}
 	return nil
 }
 // SetAll updates all matching values at the specified JSONPath.
 func SetAll(data interface{}, path string, value interface{}) error {
 	steps, err := ParseJSONPath(path)
 	if err != nil {
 		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
 	}
 	success := false
 	err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
 	if err != nil {
 		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
 	}
 	return nil
 }
 // setWithPath modifies values while tracking paths
 func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
 	if node == nil || *success && mode == ModifyFirstMode {
 		return nil
 	}
 	// Skip root step
 	actualSteps := steps
 	if len(steps) > 0 && steps[0].Type == RootStep {
 		actualSteps = steps[1:]
 	}
 	// If we have no steps left, we're setting the root value
 	if len(actualSteps) == 0 {
 		// For the root node, we need to handle it differently depending on what's passed in
 		// since we can't directly replace the interface{} variable
 		// We'll signal success and let the JSONProcessor handle updating the root
 		*success = true
 		return nil
 	}
 	// Process the first step
 	step := actualSteps[0]
 	remainingSteps := actualSteps[1:]
 	isLastStep := len(remainingSteps) == 0
 	switch step.Type {
 	case ChildStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
 		}
 		childPath := currentPath + "." + step.Key
 		if isLastStep {
 			// We've reached the target, set the value
 			m[step.Key] = value
 			*success = true
 			return nil
 		}
 		// Create intermediate nodes if necessary
 		child, exists := m[step.Key]
 		if !exists {
 			// Create missing intermediate node
 			if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
 				child = []interface{}{}
 			} else {
 				child = map[string]interface{}{}
 			}
 			m[step.Key] = child
 		}
 		err := setWithPath(child, remainingSteps, success, value, childPath, mode)
 		if err != nil {
 			return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 		}
 	case IndexStep:
 		arr, ok := node.([]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
 		}
 		// Handle wildcard index
 		if step.Index == -1 {
 			for i, item := range arr {
 				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				if isLastStep {
 					arr[i] = value
 					*success = true
 					if mode == ModifyFirstMode {
 						return nil
 					}
 				} else {
 					err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
 					if err != nil {
 						return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
 					}
 					if *success && mode == ModifyFirstMode {
 						return nil
 					}
 				}
 			}
 			return nil
 		}
 		// Handle specific index
 		if step.Index >= 0 && step.Index < len(arr) {
 			item := arr[step.Index]
 			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
 			if isLastStep {
 				arr[step.Index] = value
 				*success = true
 			} else {
 				err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
 				}
 			}
 		}
 	case RecursiveDescentStep:
 		// For recursive descent, first check direct match at this level
 		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
 			if val, exists := m[step.Key]; exists {
 				directPath := currentPath + "." + step.Key
 				if isLastStep {
 					m[step.Key] = value
 					*success = true
 					if mode == ModifyFirstMode {
 						return nil
 					}
 				} else {
 					err := setWithPath(val, remainingSteps, success, value, directPath, mode)
 					if err != nil {
 						return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
 					}
 					if *success && mode == ModifyFirstMode {
 						return nil
 					}
 				}
 			}
 		}
 		// Then continue recursion to all children
 		switch n := node.(type) {
 		case map[string]interface{}:
 			for k, v := range n {
 				childPath := currentPath + "." + k
 				// Skip keys we've already processed directly
 				if step.Key != "*" && k == step.Key {
 					continue
 				}
 				err := setWithPath(v, steps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		case []interface{}:
 			for i, v := range n {
 				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				err := setWithPath(v, steps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		}
 	case WildcardStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
 		}
 		for k, v := range m {
 			childPath := currentPath + "." + k
 			if isLastStep {
 				m[k] = value
 				*success = true
 				if mode == ModifyFirstMode {
 					return nil
 				}
 			} else {
 				err := setWithPath(v, remainingSteps, success, value, childPath, mode)
 				if err != nil {
 					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
 				}
 				if *success && mode == ModifyFirstMode {
 					return nil
 				}
 			}
 		}
 	}
 	return nil
 }
 // traverseWithPaths tracks both nodes and their paths during traversal
 func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
 	if len(steps) == 0 || node == nil {
 		return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
 	}
 	// Skip root step
 	actualSteps := steps
 	if steps[0].Type == RootStep {
 		if len(steps) == 1 {
 			*results = append(*results, JSONNode{Value: node, Path: currentPath})
 			return nil
 		}
 		actualSteps = steps[1:]
 	}
 	// Process the first step
 	step := actualSteps[0]
 	remainingSteps := actualSteps[1:]
 	isLastStep := len(remainingSteps) == 0
 	switch step.Type {
 	case ChildStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node is not a map; actual type: %T", node)
 		}
 		child, exists := m[step.Key]
 		if !exists {
 			return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
 		}
 		childPath := currentPath + "." + step.Key
 		if isLastStep {
 			*results = append(*results, JSONNode{Value: child, Path: childPath})
 		} else {
 			err := traverseWithPaths(child, remainingSteps, results, childPath)
 			if err != nil {
 				return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 			}
 		}
 	case IndexStep:
 		arr, ok := node.([]interface{})
 		if !ok {
 			return fmt.Errorf("node is not an array; actual type: %T", node)
 		}
 		// Handle wildcard index
 		if step.Index == -1 {
 			for i, item := range arr {
 				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				if isLastStep {
 					*results = append(*results, JSONNode{Value: item, Path: itemPath})
 				} else {
 					err := traverseWithPaths(item, remainingSteps, results, itemPath)
 					if err != nil {
 						return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
 					}
 				}
 			}
 			return nil
 		}
 		// Handle specific index
 		if step.Index >= 0 && step.Index < len(arr) {
 			item := arr[step.Index]
 			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
 			if isLastStep {
 				*results = append(*results, JSONNode{Value: item, Path: itemPath})
 			} else {
 				err := traverseWithPaths(item, remainingSteps, results, itemPath)
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
 				}
 			}
 		} else {
 			return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
 		}
 	case RecursiveDescentStep:
 		// For recursive descent, first check direct match at this level
 		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
 			if val, exists := m[step.Key]; exists {
 				directPath := currentPath + "." + step.Key
 				if isLastStep {
 					*results = append(*results, JSONNode{Value: val, Path: directPath})
 				} else {
 					err := traverseWithPaths(val, remainingSteps, results, directPath)
 					if err != nil {
 						return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
 					}
 				}
 			}
 		}
 		// For wildcard, collect this node
 		if step.Key == "*" && isLastStep {
 			*results = append(*results, JSONNode{Value: node, Path: currentPath})
 		}
 		// Then continue recursion to all children
 		switch n := node.(type) {
 		case map[string]interface{}:
 			for k, v := range n {
 				childPath := currentPath + "." + k
 				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		case []interface{}:
 			for i, v := range n {
 				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
 				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		}
 	case WildcardStep:
 		m, ok := node.(map[string]interface{})
 		if !ok {
 			return fmt.Errorf("node is not a map; actual type: %T", node)
 		}
 		for k, v := range m {
 			childPath := currentPath + "." + k
 			if isLastStep {
 				*results = append(*results, JSONNode{Value: v, Path: childPath})
 			} else {
 				err := traverseWithPaths(v, remainingSteps, results, childPath)
 				if err != nil {
 					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
 				}
 			}
 		}
 	}
 	return nil
 }
--- a/processor/jsonpath/jsonpath_get_set_test.go
+++ b/processor/jsonpath/jsonpath_get_set_test.go
@@ -1,577 +0,0 @@
 package jsonpath
 import (
 	"reflect"
 	"testing"
 )
 func TestGetWithPathsBasic(t *testing.T) {
 	tests := []struct {
 		name     string
 		data     map[string]interface{}
 		path     string
 		expected []JSONNode
 		error    bool
 	}{
 		{
 			name: "simple property",
 			data: map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 			path: "$.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.name"},
 			},
 		},
 		{
 			name: "nested property",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"age":  30,
 				},
 			},
 			path: "$.user.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.user.name"},
 			},
 		},
 		{
 			name: "array access",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[1].name",
 			expected: []JSONNode{
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "wildcard",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[*].name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.users[0].name"},
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "recursive descent",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"profile": map[string]interface{}{
 						"email": "john@example.com",
 					},
 				},
 				"admin": map[string]interface{}{
 					"email": "admin@example.com",
 				},
 			},
 			path: "$..email",
 			expected: []JSONNode{
 				{Value: "john@example.com", Path: "$.user.profile.email"},
 				{Value: "admin@example.com", Path: "$.admin.email"},
 			},
 		},
 		{
 			name: "nonexistent path",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 				},
 			},
 			path:     "$.user.email",
 			expected: []JSONNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(tt.data, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("GetWithPaths() returned error: %v", err)
 				}
 				return
 			}
 			// For nonexistent path, we expect empty slice
 			if tt.name == "nonexistent path" {
 				if len(result) > 0 {
 					t.Errorf("GetWithPaths() returned %v, expected empty result", result)
 				}
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For wildcard results, we need to check containment rather than exact order
 			if tt.name == "wildcard" || tt.name == "recursive descent" {
 				// For each expected item, check if it exists in the results by both value and path
 				for _, expected := range tt.expected {
 					found := false
 					for _, r := range result {
 						if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
 							found = true
 							break
 						}
 					}
 					if !found {
 						t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
 					}
 				}
 			} else {
 				// Otherwise check exact equality of both values and paths
 				for i, expected := range tt.expected {
 					if !reflect.DeepEqual(result[i].Value, expected.Value) {
 						t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
 					}
 					if result[i].Path != expected.Path {
 						t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestSet(t *testing.T) {
 	t.Run("simple property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 			"age":  30,
 		}
 		 err := Set(data, "$.name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		if data["name"] != "Jane" {
 			t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
 		}
 	})
 	t.Run("nested property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 		}
 		err := Set(data, "$.user.name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		user, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if user["name"] != "Jane" {
 			t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
 		}
 	})
 	t.Run("array element", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"name": "John", "age": 30},
 				map[string]interface{}{"name": "Jane", "age": 25},
 			},
 		}
 		err := Set(data, "$.users[0].name", "Bob")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		user0, ok := users[0].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if user0["name"] != "Bob" {
 			t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
 		}
 	})
 	t.Run("complex value", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 				"profile": map[string]interface{}{
 					"email": "john@example.com",
 				},
 			},
 		}
 		newProfile := map[string]interface{}{
 			"email": "john.doe@example.com",
 			"phone": "123-456-7890",
 		}
 		err := Set(data, "$.user.profile", newProfile)
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		profile, ok := userMap["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Profile is not a map")
 		}
 		if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
 			t.Errorf("Set() failed: expected profile to be updated with new values")
 		}
 	})
 	t.Run("create new property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		err := Set(data, "$.user.email", "john@example.com")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		if email, exists := userMap["email"]; !exists || email != "john@example.com" {
 			t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
 		}
 	})
 	t.Run("create nested properties", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		err := Set(data, "$.user.contact.email", "john@example.com")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		userMap, ok := data["user"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User is not a map")
 		}
 		contact, ok := userMap["contact"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Contact is not a map")
 		}
 		if email, exists := contact["email"]; !exists || email != "john@example.com" {
 			t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
 		}
 	})
 	t.Run("create array and element", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"name": "John",
 			},
 		}
 		// This should create an empty addresses array, but won't be able to set index 0
 		// since the array is empty
 		err := Set(data, "$.user.addresses[0].street", "123 Main St")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 	})
 	t.Run("multiple targets (should only update first)", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"active": true},
 				map[string]interface{}{"active": true},
 			},
 		}
 		err := Set(data, "$.users[*].active", false)
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		user0, ok := users[0].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User0 is not a map")
 		}
 		user1, ok := users[1].(map[string]interface{})
 		if !ok {
 			t.Fatalf("User1 is not a map")
 		}
 		// Only the first one should be changed
 		if active, exists := user0["active"]; !exists || active != false {
 			t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
 		}
 		// The second one should remain unchanged
 		if active, exists := user1["active"]; !exists || active != true {
 			t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
 		}
 	})
 	t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 		}
 		err := Set(data, "$", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Data should be unchanged
 		if data["name"] != "John" {
 			t.Errorf("Data was modified when setting on root")
 		}
 	})
 }
 func TestSetAll(t *testing.T) {
 	t.Run("simple property", func(t *testing.T) {
 		data := map[string]interface{}{
 			"name": "John",
 			"age":  30,
 		}
 		err := SetAll(data, "$.name", "Jane")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		if data["name"] != "Jane" {
 			t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
 		}
 	})
 	t.Run("all array elements", func(t *testing.T) {
 		data := map[string]interface{}{
 			"users": []interface{}{
 				map[string]interface{}{"active": true},
 				map[string]interface{}{"active": true},
 			},
 		}
 		err := SetAll(data, "$.users[*].active", false)
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		users, ok := data["users"].([]interface{})
 		if !ok {
 			t.Fatalf("Users is not a slice")
 		}
 		// Both elements should be updated
 		for i, user := range users {
 			userMap, ok := user.(map[string]interface{})
 			if !ok {
 				t.Fatalf("User%d is not a map", i)
 			}
 			if active, exists := userMap["active"]; !exists || active != false {
 				t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
 			}
 		}
 	})
 	t.Run("recursive descent", func(t *testing.T) {
 		data := map[string]interface{}{
 			"user": map[string]interface{}{
 				"profile": map[string]interface{}{
 					"active": true,
 				},
 			},
 			"admin": map[string]interface{}{
 				"profile": map[string]interface{}{
 					"active": true,
 				},
 			},
 		}
 		err := SetAll(data, "$..active", false)
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Check user profile
 		userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Failed to access user.profile")
 		}
 		if active, exists := userProfile["active"]; !exists || active != false {
 			t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
 		}
 		// Check admin profile
 		adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
 		if !ok {
 			t.Fatalf("Failed to access admin.profile")
 		}
 		if active, exists := adminProfile["active"]; !exists || active != false {
 			t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
 		}
 	})
 }
 func TestGetWithPathsExtended(t *testing.T) {
 	tests := []struct {
 		name     string
 		data     map[string]interface{}
 		path     string
 		expected []JSONNode
 	}{
 		{
 			name: "simple property",
 			data: map[string]interface{}{
 				"name": "John",
 				"age":  30,
 			},
 			path: "$.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.name"},
 			},
 		},
 		{
 			name: "nested property",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"age":  30,
 				},
 			},
 			path: "$.user.name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.user.name"},
 			},
 		},
 		{
 			name: "array access",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[1].name",
 			expected: []JSONNode{
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "wildcard",
 			data: map[string]interface{}{
 				"users": []interface{}{
 					map[string]interface{}{"name": "John", "age": 30},
 					map[string]interface{}{"name": "Jane", "age": 25},
 				},
 			},
 			path: "$.users[*].name",
 			expected: []JSONNode{
 				{Value: "John", Path: "$.users[0].name"},
 				{Value: "Jane", Path: "$.users[1].name"},
 			},
 		},
 		{
 			name: "recursive descent",
 			data: map[string]interface{}{
 				"user": map[string]interface{}{
 					"name": "John",
 					"profile": map[string]interface{}{
 						"email": "john@example.com",
 					},
 				},
 				"admin": map[string]interface{}{
 					"email": "admin@example.com",
 				},
 			},
 			path: "$..email",
 			expected: []JSONNode{
 				{Value: "john@example.com", Path: "$.user.profile.email"},
 				{Value: "admin@example.com", Path: "$.admin.email"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(tt.data, tt.path)
 			if err != nil {
 				t.Errorf("GetWithPaths() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// Check if value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Check if path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
--- a/processor/jsonpath/jsonpath_test.go
+++ b/processor/jsonpath/jsonpath_test.go
@@ -1,318 +0,0 @@
 package jsonpath
 import (
 	"reflect"
 	"testing"
 )
 var testData = map[string]interface{}{
 	"store": map[string]interface{}{
 		"book": []interface{}{
 			map[string]interface{}{
 				"title": "The Fellowship of the Ring",
 				"price": 22.99,
 			},
 			map[string]interface{}{
 				"title": "The Two Towers",
 				"price": 23.45,
 			},
 		},
 		"bicycle": map[string]interface{}{
 			"color": "red",
 			"price": 199.95,
 		},
 	},
 }
 func TestParser(t *testing.T) {
 	tests := []struct {
 		path    string
 		steps   []JSONStep
 		wantErr bool
 	}{
 		{
 			path: "$.store.bicycle.color",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "bicycle"},
 				{Type: ChildStep, Key: "color"},
 			},
 		},
 		{
 			path: "$..price",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: RecursiveDescentStep, Key: "price"},
 			},
 		},
 		{
 			path: "$.store.book[*].title",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "book"},
 				{Type: IndexStep, Index: -1}, // Wildcard
 				{Type: ChildStep, Key: "title"},
 			},
 		},
 		{
 			path: "$.store.book[0]",
 			steps: []JSONStep{
 				{Type: RootStep},
 				{Type: ChildStep, Key: "store"},
 				{Type: ChildStep, Key: "book"},
 				{Type: IndexStep, Index: 0},
 			},
 		},
 		{
 			path:    "invalid.path",
 			wantErr: true,
 		},
 		{
 			path:    "$.store.book[abc]",
 			wantErr: true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.path, func(t *testing.T) {
 			steps, err := ParseJSONPath(tt.path)
 			if (err != nil) != tt.wantErr {
 				t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
 			}
 			if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
 				t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
 			}
 		})
 	}
 }
 func TestEvaluator(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []JSONNode
 		error    bool
 	}{
 		{
 			name: "simple_property_access",
 			path: "$.store.bicycle.color",
 			expected: []JSONNode{
 				{Value: "red", Path: "$.store.bicycle.color"},
 			},
 		},
 		{
 			name: "array_index_access",
 			path: "$.store.book[0].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 			},
 		},
 		{
 			name: "wildcard_array_access",
 			path: "$.store.book[*].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 				{Value: "The Two Towers", Path: "$.store.book[1].title"},
 			},
 		},
 		{
 			name: "recursive_price_search",
 			path: "$..price",
 			expected: []JSONNode{
 				{Value: 22.99, Path: "$.store.book[0].price"},
 				{Value: 23.45, Path: "$.store.book[1].price"},
 				{Value: 199.95, Path: "$.store.bicycle.price"},
 			},
 		},
 		{
 			name: "wildcard_recursive",
 			path: "$..*",
 			expected: []JSONNode{
 				// These will be compared by value only, paths will be validated separately
 				{Value: testData["store"].(map[string]interface{})["book"]},
 				{Value: testData["store"].(map[string]interface{})["bicycle"]},
 				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
 				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
 				{Value: "The Fellowship of the Ring"},
 				{Value: 22.99},
 				{Value: "The Two Towers"},
 				{Value: 23.45},
 				{Value: "red"},
 				{Value: 199.95},
 			},
 		},
 		{
 			name:     "invalid_index",
 			path:     "$.store.book[5]",
 			expected: []JSONNode{},
 			error:    true,
 		},
 		{
 			name:     "nonexistent_property",
 			path:     "$.store.nonexistent",
 			expected: []JSONNode{},
 			error:    true,
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			// Use GetWithPaths directly
 			result, err := Get(testData, tt.path)
 			if err != nil {
 				if !tt.error {
 					t.Errorf("Get() returned error: %v", err)
 				}
 				return
 			}
 			// Special handling for wildcard recursive test
 			if tt.name == "wildcard_recursive" {
 				// Skip length check for wildcard recursive since it might vary
 				// Just verify that each expected item is in the results
 				// Validate values match and paths are filled in
 				for _, e := range tt.expected {
 					found := false
 					for _, r := range result {
 						if reflect.DeepEqual(r.Value, e.Value) {
 							found = true
 							break
 						}
 					}
 					if !found {
 						t.Errorf("Expected value %v not found in results", e.Value)
 					}
 				}
 				return
 			}
 			if len(result) != len(tt.expected) {
 				t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
 			}
 			// Validate both values and paths
 			for i, e := range tt.expected {
 				if i < len(result) {
 					if !reflect.DeepEqual(result[i].Value, e.Value) {
 						t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
 					}
 					if result[i].Path != e.Path {
 						t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
 					}
 				}
 			}
 		})
 	}
 }
 func TestEdgeCases(t *testing.T) {
 	t.Run("empty_data", func(t *testing.T) {
 		result, err := Get(nil, "$.a.b")
 		if err == nil {
 			t.Errorf("Expected error for empty data")
 			return
 		}
 		if len(result) > 0 {
 			t.Errorf("Expected empty result, got %v", result)
 		}
 	})
 	t.Run("empty_path", func(t *testing.T) {
 		_, err := ParseJSONPath("")
 		if err == nil {
 			t.Error("Expected error for empty path")
 		}
 	})
 	t.Run("numeric_keys", func(t *testing.T) {
 		data := map[string]interface{}{
 			"42": "answer",
 		}
 		result, err := Get(data, "$.42")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) == 0 || result[0].Value != "answer" {
 			t.Errorf("Expected 'answer', got %v", result)
 		}
 	})
 }
 func TestGetWithPaths(t *testing.T) {
 	tests := []struct {
 		name     string
 		path     string
 		expected []JSONNode
 	}{
 		{
 			name: "simple_property_access",
 			path: "$.store.bicycle.color",
 			expected: []JSONNode{
 				{Value: "red", Path: "$.store.bicycle.color"},
 			},
 		},
 		{
 			name: "array_index_access",
 			path: "$.store.book[0].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 			},
 		},
 		{
 			name: "wildcard_array_access",
 			path: "$.store.book[*].title",
 			expected: []JSONNode{
 				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
 				{Value: "The Two Towers", Path: "$.store.book[1].title"},
 			},
 		},
 		{
 			name: "recursive_price_search",
 			path: "$..price",
 			expected: []JSONNode{
 				{Value: 22.99, Path: "$.store.book[0].price"},
 				{Value: 23.45, Path: "$.store.book[1].price"},
 				{Value: 199.95, Path: "$.store.bicycle.price"},
 			},
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(testData, tt.path)
 			if err != nil {
 				t.Errorf("Get() returned error: %v", err)
 				return
 			}
 			// Check if lengths match
 			if len(result) != len(tt.expected) {
 				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
 				return
 			}
 			// For each expected item, find its match in the results and verify both value and path
 			for _, expected := range tt.expected {
 				found := false
 				for _, r := range result {
 					// First verify the value matches
 					if reflect.DeepEqual(r.Value, expected.Value) {
 						found = true
 						// Then verify the path matches
 						if r.Path != expected.Path {
 							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
 						}
 						break
 					}
 				}
 				if !found {
 					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
 				}
 			}
 		})
 	}
 }
--- a/processor/processor.go
+++ b/processor/processor.go
@@ -2,41 +2,15 @@ package processor
 import (
 	"fmt"
 	"os"
 	"path/filepath"
 	"strings"
 	"github.com/antchfx/xmlquery"
 	lua "github.com/yuin/gopher-lua"
 	"modify/logger"
 )
-// Processor defines the interface for all file processors
+// Maybe we make this an interface again for the shits and giggles
-type Processor interface {
+// We will see, it could easily be...
 	// Process handles processing a file with the given pattern and Lua expression
 	// Now implemented as a base function in processor.go
 	// Process(filename string, pattern string, luaExpr string) (int, int, error)
 	// ProcessContent handles processing a string content directly with the given pattern and Lua expression
 	// Returns the modified content, modification count, match count, and any error
 	ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
 	// ToLua converts processor-specific data to Lua variables
 	ToLua(L *lua.LState, data interface{}) error
 	// FromLua retrieves modified data from Lua
 	FromLua(L *lua.LState) (interface{}, error)
 }
 // ModificationRecord tracks a single value modification
 type ModificationRecord struct {
 	File      string
 	OldValue  string
 	NewValue  string
 	Operation string
 	Context   string
 }
 func NewLuaState() (*lua.LState, error) {
 	L := lua.NewState()
@@ -61,94 +35,73 @@ func NewLuaState() (*lua.LState, error) {
 	return L, nil
 }
-func Process(p Processor, filename string, pattern string, luaExpr string) (int, int, error) {
+// func Process(filename string, pattern string, luaExpr string) (int, int, error) {
-	// Read file content
+// 	logger.Debug("Processing file %q with pattern %q", filename, pattern)
-	cwd, err := os.Getwd()
+//
-	if err != nil {
+// 	// Read file content
-		logger.Error("Failed to get current working directory: %v", err)
+// 	cwd, err := os.Getwd()
-		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
+// 	if err != nil {
-	}
+// 		logger.Error("Failed to get current working directory: %v", err)
-
+// 		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
-	fullPath := filepath.Join(cwd, filename)
+// 	}
-	logger.Trace("Reading file content from: %s", fullPath)
+//
-	content, err := os.ReadFile(fullPath)
+// 	fullPath := filepath.Join(cwd, filename)
-	if err != nil {
+// 	logger.Trace("Reading file from: %s", fullPath)
-		logger.Error("Failed to read file %s: %v", fullPath, err)
+//
-		return 0, 0, fmt.Errorf("error reading file: %v", err)
+// 	stat, err := os.Stat(fullPath)
-	}
+// 	if err != nil {
-
+// 		logger.Error("Failed to stat file %s: %v", fullPath, err)
-	fileContent := string(content)
+// 		return 0, 0, fmt.Errorf("error getting file info: %v", err)
-	logger.Trace("File %s read successfully, size: %d bytes", fullPath, len(content))
+// 	}
-
+// 	logger.Debug("File size: %d bytes, modified: %s", stat.Size(), stat.ModTime().Format(time.RFC3339))
-	// Process the content
+//
-	logger.Debug("Processing content for file: %s", filename)
+// 	content, err := os.ReadFile(fullPath)
-	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
+// 	if err != nil {
-	if err != nil {
+// 		logger.Error("Failed to read file %s: %v", fullPath, err)
-		logger.Error("Error processing content for file %s: %v", filename, err)
+// 		return 0, 0, fmt.Errorf("error reading file: %v", err)
-		return 0, 0, err
+// 	}
-	}
+//
-
+// 	fileContent := string(content)
-	// If we made modifications, save the file
+// 	logger.Trace("File read successfully: %d bytes, hash: %x", len(content), md5sum(content))
-	if modCount > 0 {
+//
-		logger.Info("Writing %d modifications to file: %s", modCount, filename)
+// 	// Detect and log file type
-		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
+// 	fileType := detectFileType(filename, fileContent)
-		if err != nil {
+// 	if fileType != "" {
-			logger.Error("Failed to write to file %s: %v", fullPath, err)
+// 		logger.Debug("Detected file type: %s", fileType)
-			return 0, 0, fmt.Errorf("error writing file: %v", err)
+// 	}
-		}
+//
-		logger.Debug("File %s written successfully", filename)
+// 	// Process the content
-	} else {
+// 	logger.Debug("Starting content processing")
-		logger.Debug("No modifications to write for file: %s", filename)
+// 	modifiedContent, modCount, matchCount, err := ProcessContent(fileContent, pattern, luaExpr)
-	}
+// 	if err != nil {
-
+// 		logger.Error("Processing error: %v", err)
-	return modCount, matchCount, nil
+// 		return 0, 0, err
-}
+// 	}
-
+//
-// ToLua converts a struct or map to a Lua table recursively
+// 	logger.Debug("Processing results: %d matches, %d modifications", matchCount, modCount)
-func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
+//
-	switch v := data.(type) {
+// 	// If we made modifications, save the file
-	case *xmlquery.Node:
+// 	if modCount > 0 {
-		luaTable := L.NewTable()
+// 		// Calculate changes summary
-		luaTable.RawSetString("text", lua.LString(v.Data))
+// 		changePercent := float64(len(modifiedContent)) / float64(len(fileContent)) * 100
-		// Should be a map, simple key value pairs
+// 		logger.Info("File size change: %d → %d bytes (%.1f%%)",
-		attr, err := ToLua(L, v.Attr)
+// 			len(fileContent), len(modifiedContent), changePercent)
-		if err != nil {
+//
-			return nil, err
+// 		logger.Debug("Writing modified content to %s", fullPath)
-		}
+// 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
-		luaTable.RawSetString("attr", attr)
+// 		if err != nil {
-		return luaTable, nil
+// 			logger.Error("Failed to write to file %s: %v", fullPath, err)
-	case map[string]interface{}:
+// 			return 0, 0, fmt.Errorf("error writing file: %v", err)
-		luaTable := L.NewTable()
+// 		}
-		for key, value := range v {
+// 		logger.Debug("File written successfully, new hash: %x", md5sum([]byte(modifiedContent)))
-			luaValue, err := ToLua(L, value)
+// 	} else if matchCount > 0 {
-			if err != nil {
+// 		logger.Debug("No content modifications needed for %d matches", matchCount)
-				return nil, err
+// 	} else {
-			}
+// 		logger.Debug("No matches found in file")
-			luaTable.RawSetString(key, luaValue)
+// 	}
-		}
+//
-		return luaTable, nil
+// 	return modCount, matchCount, nil
-	case []interface{}:
+// }
 		luaTable := L.NewTable()
 		for i, value := range v {
 			luaValue, err := ToLua(L, value)
 			if err != nil {
 				return nil, err
 			}
 			luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
 		}
 		return luaTable, nil
 	case string:
 		return lua.LString(v), nil
 	case bool:
 		return lua.LBool(v), nil
 	case float64:
 		return lua.LNumber(v), nil
 	case nil:
 		return lua.LNil, nil
 	default:
 		return nil, fmt.Errorf("unsupported data type: %T", data)
 	}
 }
 // FromLua converts a Lua table to a struct or map recursively
 func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
@@ -226,6 +179,38 @@ function upper(s) return string.upper(s) end
 function lower(s) return string.lower(s) end
 function format(s, ...) return string.format(s, ...) end
 -- String split helper
 function strsplit(inputstr, sep)
  if sep == nil then
    sep = "%s"
  end
  local t = {}
  for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
    table.insert(t, str)
  end
  return t
 end
 ---@param table table
 ---@param depth number?
 function DumpTable(table, depth)
 	if depth == nil then
 		depth = 0
 	end
 	if (depth > 200) then
 		print("Error: Depth > 200 in dumpTable()")
 		return
 	end
 	for k, v in pairs(table) do
 		if (type(v) == "table") then
 			print(string.rep("  ", depth) .. k .. ":")
 			DumpTable(v, depth + 1)
 		else
 			print(string.rep("  ", depth) .. k .. ": ", v)
 		end
 	end
 end
 -- String to number conversion helper
 function num(str)
    return tonumber(str) or 0
@@ -267,8 +252,6 @@ modified = false
 	return nil
 }
 // Helper utility functions
 // LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	s = strings.ReplaceAll(s, "\n", "\\n")
@@ -324,27 +307,20 @@ func BuildLuaScript(luaExpr string) string {
 func printToGo(L *lua.LState) int {
 	top := L.GetTop()
 	args := make([]interface{}, top)
 	for i := 1; i <= top; i++ {
 		args[i-1] = L.Get(i)
 	}
-	message := fmt.Sprint(args...)
+
-	logger.Info("[Lua] %s", message)
+	// Format the message with proper spacing between arguments
 	var parts []string
 	for _, arg := range args {
 		parts = append(parts, fmt.Sprintf("%v", arg))
 	}
 	message := strings.Join(parts, " ")
 	// Use the LUA log level with a script tag
 	logger.Lua("%s", message)
 	return 0
 }
 // Max returns the maximum of two integers
 func Max(a, b int) int {
 	if a > b {
 		return a
 	}
 	return b
 }
 // Min returns the minimum of two integers
 func Min(a, b int) int {
 	if a < b {
 		return a
 	}
 	return b
 }
--- a/processor/regex.go
+++ b/processor/regex.go
@@ -3,20 +3,314 @@ package processor
 import (
 	"fmt"
 	"regexp"
 	"sort"
 	"strconv"
 	"strings"
 	"time"
 	lua "github.com/yuin/gopher-lua"
 	"modify/logger"
 	"modify/utils"
 )
-// RegexProcessor implements the Processor interface using regex patterns
+type CaptureGroup struct {
-type RegexProcessor struct{}
+	Name    string
 	Value   string
 	Updated string
 	Range   [2]int
 }
 // ProcessContent applies regex replacement with Lua processing
 // The filename here exists ONLY so we can pass it to the lua environment
 // It's not used for anything else
 func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
 	var commands []utils.ReplaceCommand
 	logger.Trace("Processing regex: %q", command.Regex)
 	// Start timing the regex processing
 	startTime := time.Now()
 	// We don't HAVE to do this multiple times for a pattern
 	// But it's quick enough for us to not care
 	pattern := resolveRegexPlaceholders(command.Regex)
 	// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
 	// But it's a compromise that allows us to use | in yaml
 	// Otherwise we would have to escape every god damn pair of quotation marks
 	// And a bunch of other shit
 	pattern = strings.TrimSpace(pattern)
 	logger.Debug("Compiling regex pattern: %s", pattern)
 	patternCompileStart := time.Now()
 	compiledPattern, err := regexp.Compile(pattern)
 	if err != nil {
 		logger.Error("Error compiling pattern: %v", err)
 		return commands, fmt.Errorf("error compiling pattern: %v", err)
 	}
 	logger.Debug("Compiled pattern successfully in %v: %s", time.Since(patternCompileStart), pattern)
 	// Same here, it's just string concatenation, it won't kill us
 	// More important is that we don't fuck up the command
 	// But we shouldn't be able to since it's passed by value
 	previous := command.Lua
 	luaExpr := BuildLuaScript(command.Lua)
 	logger.Debug("Transformed Lua expression: %q → %q", previous, luaExpr)
 	// Process all regex matches
 	matchFindStart := time.Now()
 	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
 	matchFindDuration := time.Since(matchFindStart)
 	logger.Debug("Found %d matches in content of length %d (search took %v)",
 		len(indices), len(content), matchFindDuration)
 	// Log pattern complexity metrics
 	patternComplexity := estimatePatternComplexity(pattern)
 	logger.Debug("Pattern complexity estimate: %d", patternComplexity)
 	if len(indices) == 0 {
 		logger.Warning("No matches found for regex: %q", pattern)
 		logger.Debug("Total regex processing time: %v", time.Since(startTime))
 		return commands, nil
 	}
 	// We walk backwards because we're replacing something with something else that might be longer
 	// And in the case it is longer than the original all indicces past that change will be fucked up
 	// By going backwards we fuck up all the indices to the end of the file that we don't care about
 	// Because there either aren't any (last match) or they're already modified (subsequent matches)
 	for i, matchIndices := range indices {
 		logger.Debug("Processing match %d of %d", i+1, len(indices))
 		logger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
 		L, err := NewLuaState()
 		if err != nil {
 			logger.Error("Error creating Lua state: %v", err)
 			return commands, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		L.SetGlobal("file", lua.LString(filename))
 		// Hmm... Maybe we don't want to defer this..
 		// Maybe we want to close them every iteration
 		// We'll leave it as is for now
 		defer L.Close()
 		logger.Trace("Lua state created successfully for match %d", i+1)
 		// Why we're doing this whole song and dance of indices is to properly handle empty matches
 		// Plus it's a little cleaner to surgically replace our matches
 		// If we were to use string.replace and encountered an empty match there'd be nothing to replace
 		// But using indices an empty match would have its starting and ending indices be the same
 		// So when we're cutting open the array we say 0:7 + modified + 7:end
 		// As if concatenating in the middle of the array
 		// Plus it supports lookarounds
 		match := content[matchIndices[0]:matchIndices[1]]
 		matchPreview := match
 		if len(match) > 50 {
 			matchPreview = match[:47] + "..."
 		}
 		logger.Trace("Matched content: %q (length: %d)", matchPreview, len(match))
 		groups := matchIndices[2:]
 		if len(groups) <= 0 {
 			logger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
 			continue
 		}
 		if len(groups)%2 == 1 {
 			logger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
 			continue
 		}
 		// Count how many valid groups we have
 		validGroups := 0
 		for j := 0; j < len(groups); j += 2 {
 			if groups[j] != -1 && groups[j+1] != -1 {
 				validGroups++
 			}
 		}
 		logger.Debug("Found %d valid capture groups in match", validGroups)
 		for _, index := range groups {
 			if index == -1 {
 				logger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
 				continue
 			}
 		}
 		// We have to use array to preserve order
 		// Very important for the reconstruction step
 		// Because we must overwrite the values in reverse order
 		// See comments a few dozen lines above for more details
 		captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
 		groupNames := compiledPattern.SubexpNames()[1:]
 		for i, name := range groupNames {
 			start := groups[i*2]
 			end := groups[i*2+1]
 			if start == -1 || end == -1 {
 				continue
 			}
 			value := content[start:end]
 			captureGroups = append(captureGroups, &CaptureGroup{
 				Name:  name,
 				Value: value,
 				Range: [2]int{start, end},
 			})
 			// Include name info in log if available
 			if name != "" {
 				logger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
 			} else {
 				logger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
 			}
 		}
 		// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
 		if !command.NoDedup {
 			logger.Debug("Deduplicating capture groups as specified in command settings")
 			captureGroups = deduplicateGroups(captureGroups)
 		}
 		if err := toLua(L, captureGroups); err != nil {
 			logger.Error("Failed to set Lua variables: %v", err)
 			continue
 		}
 		logger.Trace("Set %d capture groups as Lua variables", len(captureGroups))
 		if err := L.DoString(luaExpr); err != nil {
 			logger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
 				err, luaExpr, captureGroups)
 			continue
 		}
 		logger.Trace("Lua script executed successfully")
 		// Get modifications from Lua
 		captureGroups, err = fromLua(L, captureGroups)
 		if err != nil {
 			logger.Error("Failed to retrieve modifications from Lua: %v", err)
 			continue
 		}
 		logger.Trace("Retrieved updated values from Lua")
 		replacement := ""
 		replacementVar := L.GetGlobal("replacement")
 		if replacementVar.Type() != lua.LTNil {
 			replacement = replacementVar.String()
 			logger.Debug("Using global replacement: %q", replacement)
 		}
 		// Check if modification flag is set
 		modifiedVal := L.GetGlobal("modified")
 		if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
 			logger.Debug("Skipping match - no modifications made by Lua script")
 			continue
 		}
 		if replacement == "" {
 			// Apply the modifications to the original match
 			replacement = match
 			// Count groups that were actually modified
 			modifiedGroups := 0
 			for _, capture := range captureGroups {
 				if capture.Value != capture.Updated {
 					modifiedGroups++
 				}
 			}
 			logger.Info("%d of %d capture groups identified for modification", modifiedGroups, len(captureGroups))
 			for _, capture := range captureGroups {
 				if capture.Value == capture.Updated {
 					logger.Info("Capture group unchanged: %s", LimitString(capture.Value, 50))
 					continue
 				}
 				// Log what changed with context
 				logger.Debug("Capture group %s scheduled for modification: %q → %q",
 					capture.Name, capture.Value, capture.Updated)
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
 				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 				commands = append(commands, utils.ReplaceCommand{
 					From: capture.Range[0],
 					To:   capture.Range[1],
 					With: capture.Updated,
 				})
 			}
 		} else {
 			commands = append(commands, utils.ReplaceCommand{
 				From: matchIndices[0],
 				To:   matchIndices[1],
 				With: replacement,
 			})
 		}
 	}
 	logger.Debug("Total regex processing time: %v", time.Since(startTime))
 	return commands, nil
 }
 func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
 	deduplicatedGroups := make([]*CaptureGroup, 0)
 	for _, group := range captureGroups {
 		overlaps := false
 		logger.Debug("Checking capture group: %s with range %v", group.Name, group.Range)
 		for _, existingGroup := range deduplicatedGroups {
 			logger.Debug("Comparing with existing group: %s with range %v", existingGroup.Name, existingGroup.Range)
 			if group.Range[0] < existingGroup.Range[1] && group.Range[1] > existingGroup.Range[0] {
 				overlaps = true
 				logger.Warning("Detected overlap between capture group '%s' and existing group '%s' in range %v-%v and %v-%v", group.Name, existingGroup.Name, group.Range[0], group.Range[1], existingGroup.Range[0], existingGroup.Range[1])
 				break
 			}
 		}
 		if overlaps {
 			// We CAN just continue despite this fuckup
 			logger.Warning("Overlapping capture group: %s", group.Name)
 			continue
 		}
 		logger.Debug("No overlap detected for capture group: %s. Adding to deduplicated groups.", group.Name)
 		deduplicatedGroups = append(deduplicatedGroups, group)
 	}
 	return deduplicatedGroups
 }
 // The order of these replaces is important
 // This one handles !num-s inside of named capture groups
 // If it were not here our !num in a named capture group would
 // Expand to another capture group in the capture group
 // We really only want one (our named) capture group
 func resolveRegexPlaceholders(pattern string) string {
 	// Handle special pattern modifications
 	if !strings.HasPrefix(pattern, "(?s)") {
 		pattern = "(?s)" + pattern
 	}
 	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
 	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
 		parts := namedGroupNum.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			return match
 		}
 		replacement := `-?\d*\.?\d+`
 		return parts[1] + replacement
 	})
 	pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
 	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
 	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
 	// !rep(pattern, count) repeats the pattern n times
 	// Inserting !any between each repetition
 	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
 		parts := repPattern.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			return match
 		}
 		repeatedPattern := parts[1]
 		count := parts[2]
 		repetitions, _ := strconv.Atoi(count)
 		return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
 	})
 	return pattern
 }
 // ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
-func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
+func toLua(L *lua.LState, data interface{}) error {
 	captureGroups, ok := data.([]*CaptureGroup)
 	if !ok {
 		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
@@ -49,13 +343,8 @@ func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
 	return nil
 }
 func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	// Stub to satisfy interface
 	return nil, nil
 }
 // FromLua implements the Processor interface for RegexProcessor
-func (p *RegexProcessor) FromLuaCustom(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
+func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
 	captureIndex := 0
 	for _, capture := range captureGroups {
 		if capture.Name == "" {
@@ -84,216 +373,20 @@ func (p *RegexProcessor) FromLuaCustom(L *lua.LState, captureGroups []*CaptureGr
 	return captureGroups, nil
 }
-type CaptureGroup struct {
+// estimatePatternComplexity gives a rough estimate of regex pattern complexity
-	Name    string
+// This can help identify potentially problematic patterns
-	Value   string
+func estimatePatternComplexity(pattern string) int {
-	Updated string
+	complexity := len(pattern)
-	Range   [2]int
+
-}
+	// Add complexity for potentially expensive operations
-type ReplaceCommand struct {
+	complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
-	From int
+	complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
-	To   int
+	complexity += strings.Count(pattern, "[^") * 3  // Negated character class
-	With string
+	complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
-}
+	complexity += strings.Count(pattern, "(") * 2   // Capture groups
-
+	complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
-// ProcessContent applies regex replacement with Lua processing
+	complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
-func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
+	complexity += strings.Count(pattern, "{") * 2   // Counted repetition
-	pattern = ResolveRegexPlaceholders(pattern)
+
-	logger.Debug("Compiling regex pattern: %s", pattern)
+	return complexity
 	compiledPattern, err := regexp.Compile(pattern)
 	if err != nil {
 		logger.Error("Error compiling pattern: %v", err)
 		return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
 	}
 	logger.Debug("Compiled pattern successfully: %s", pattern)
 	previous := luaExpr
 	luaExpr = BuildLuaScript(luaExpr)
 	logger.Debug("Changing Lua expression from: %s to: %s", previous, luaExpr)
 	// Initialize Lua environment
 	modificationCount := 0
 	// Process all regex matches
 	result := content
 	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
 	logger.Debug("Found %d matches in the content", len(indices))
 	// We walk backwards because we're replacing something with something else that might be longer
 	// And in the case it is longer than the original all indicces past that change will be fucked up
 	// By going backwards we fuck up all the indices to the end of the file that we don't care about
 	// Because there either aren't any (last match) or they're already modified (subsequent matches)
 	for i := len(indices) - 1; i >= 0; i-- {
 		L, err := NewLuaState()
 		if err != nil {
 			logger.Error("Error creating Lua state: %v", err)
 			return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		// Hmm... Maybe we don't want to defer this..
 		// Maybe we want to close them every iteration
 		// We'll leave it as is for now
 		defer L.Close()
 		logger.Trace("Lua state created successfully")
 		matchIndices := indices[i]
 		logger.Trace("Processing match indices: %v", matchIndices)
 		// Why we're doing this whole song and dance of indices is to properly handle empty matches
 		// Plus it's a little cleaner to surgically replace our matches
 		// If we were to use string.replace and encountered an empty match there'd be nothing to replace
 		// But using indices an empty match would have its starting and ending indices be the same
 		// So when we're cutting open the array we say 0:7 + modified + 7:end
 		// As if concatenating in the middle of the array
 		// Plus it supports lookarounds
 		match := content[matchIndices[0]:matchIndices[1]]
 		logger.Trace("Matched content: %s", match)
 		groups := matchIndices[2:]
 		if len(groups) <= 0 {
 			logger.Warning("No capture groups for lua to chew on")
 			continue
 		}
 		if len(groups)%2 == 1 {
 			logger.Warning("Odd number of indices of groups, what the fuck?")
 			continue
 		}
 		for _, index := range groups {
 			if index == -1 {
 				// return "", 0, 0, fmt.Errorf("negative indices encountered: %v. This indicates that there was an issue with the match indices, possibly due to an empty match or an unexpected pattern. Please check the regex pattern and input content.", matchIndices)
 				logger.Warning("Negative indices encountered: %v. This indicates that there was an issue with the match indices, possibly due to an empty match or an unexpected pattern. This is not an error but it's possibly not what you want.", matchIndices)
 				continue
 			}
 		}
 		// We have to use array to preserve order
 		// Very important for the reconstruction step
 		// Because we must overwrite the values in reverse order
 		// See comments a few dozen lines above for more details
 		captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
 		groupNames := compiledPattern.SubexpNames()[1:]
 		for i, name := range groupNames {
 			// if name == "" {
 			// 	continue
 			// }
 			start := groups[i*2]
 			end := groups[i*2+1]
 			if start == -1 || end == -1 {
 				continue
 			}
 			captureGroups = append(captureGroups, &CaptureGroup{
 				Name:  name,
 				Value: content[start:end],
 				Range: [2]int{start, end},
 			})
 		}
 		for _, capture := range captureGroups {
 			logger.Trace("Capture group: %+v", *capture)
 		}
 		if err := p.ToLua(L, captureGroups); err != nil {
 			logger.Error("Error setting Lua variables: %v", err)
 			continue
 		}
 		logger.Trace("Lua variables set successfully")
 		if err := L.DoString(luaExpr); err != nil {
 			logger.Error("Error executing Lua code %s for groups %+v: %v", luaExpr, captureGroups, err)
 			continue
 		}
 		logger.Trace("Lua code executed successfully")
 		// Get modifications from Lua
 		captureGroups, err = p.FromLuaCustom(L, captureGroups)
 		if err != nil {
 			logger.Error("Error getting modifications: %v", err)
 			continue
 		}
 		replacement := ""
 		replacementVar := L.GetGlobal("replacement")
 		if replacementVar.Type() != lua.LTNil {
 			replacement = replacementVar.String()
 		}
 		// Check if modification flag is set
 		modifiedVal := L.GetGlobal("modified")
 		if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
 			logger.Debug("No modifications made by Lua script")
 			continue
 		}
 		if replacement == "" {
 			commands := make([]ReplaceCommand, 0, len(captureGroups))
 			// Apply the modifications to the original match
 			replacement = match
 			for _, capture := range captureGroups {
 				logger.Debug("Applying modification: %s", capture.Updated)
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
 				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
 				commands = append(commands, ReplaceCommand{
 					From: capture.Range[0] - matchIndices[0],
 					To:   capture.Range[1] - matchIndices[0],
 					With: capture.Updated,
 				})
 			}
 			sort.Slice(commands, func(i, j int) bool {
 				return commands[i].From > commands[j].From
 			})
 			for _, command := range commands {
 				replacement = replacement[:command.From] + command.With + replacement[command.To:]
 			}
 		}
 		modificationCount++
 		result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
 		logger.Debug("Modification count updated: %d", modificationCount)
 	}
 	logger.Debug("Process completed with %d modifications", modificationCount)
 	return result, modificationCount, len(indices), nil
 }
 // The order of these replaces is important
 // This one handles !num-s inside of named capture groups
 // If it were not here our !num in a named capture group would
 // Expand to another capture group in the capture group
 // We really only want one (our named) capture group
 func ResolveRegexPlaceholders(pattern string) string {
 	// Handle special pattern modifications
 	if !strings.HasPrefix(pattern, "(?s)") {
 		pattern = "(?s)" + pattern
 		// Use fmt.Printf for test compatibility
 		fmt.Printf("Pattern modified to include (?s): %s\n", pattern)
 	}
 	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
 	pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
 		parts := namedGroupNum.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			return match
 		}
 		replacement := `-?\d*\.?\d+`
 		return parts[1] + replacement
 	})
 	pattern = strings.ReplaceAll(pattern, "!num", `"?(-?\d*\.?\d+)"?`)
 	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
 	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
 	// !rep(pattern, count) repeats the pattern n times
 	// Inserting !any between each repetition
 	pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
 		parts := repPattern.FindStringSubmatch(match)
 		if len(parts) != 3 {
 			return match
 		}
 		repeatedPattern := parts[1]
 		count := parts[2]
 		repetitions, _ := strconv.Atoi(count)
 		return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
 	})
 	return pattern
 }
--- a/processor/regex_test.go
+++ b/processor/regex_test.go
--- a/processor/test_helper.go
+++ b/processor/test_helper.go
@@ -1,12 +1,15 @@
 package processor
 import (
-	"io/ioutil"
+	"io"
 	"modify/logger"
 	"os"
 )
 func init() {
 	// Only modify logger in test mode
 	// This checks if we're running under 'go test'
 	if os.Getenv("GO_TESTING") == "1" || os.Getenv("TESTING") == "1" {
 		// Initialize logger with ERROR level for tests
 		// to minimize noise in test output
 		logger.Init(logger.LevelError)
@@ -16,7 +19,8 @@ func init() {
 		disableTestLogs := os.Getenv("ENABLE_TEST_LOGS") != "1"
 		if disableTestLogs {
 			// Create a new logger that writes to nowhere
-		silentLogger := logger.New(ioutil.Discard, "", 0)
+			silentLogger := logger.New(io.Discard, "", 0)
 			logger.DefaultLogger = silentLogger
 		}
 	}
 }
--- a/processor/xml.go
+++ b/processor/xml.go
@@ -1,434 +0,0 @@
 package processor
 import (
 	"fmt"
 	"modify/logger"
 	"modify/processor/xpath"
 	"strings"
 	"github.com/antchfx/xmlquery"
 	lua "github.com/yuin/gopher-lua"
 )
 // XMLProcessor implements the Processor interface for XML documents
 type XMLProcessor struct{}
 // ProcessContent implements the Processor interface for XMLProcessor
 func (p *XMLProcessor) ProcessContent(content string, path string, luaExpr string) (string, int, int, error) {
 	logger.Debug("Processing XML content with XPath: %s", path)
 	// Parse XML document
 	// We can't really use encoding/xml here because it requires a pre defined struct
 	// And we HAVE TO parse dynamic unknown XML
 	logger.Trace("Parsing XML document")
 	doc, err := xmlquery.Parse(strings.NewReader(content))
 	if err != nil {
 		logger.Error("Failed to parse XML: %v", err)
 		return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
 	}
 	// Find nodes matching the XPath pattern
 	logger.Debug("Executing XPath query: %s", path)
 	nodes, err := xpath.Get(doc, path)
 	if err != nil {
 		logger.Error("Failed to execute XPath: %v", err)
 		return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
 	}
 	matchCount := len(nodes)
 	logger.Debug("Found %d nodes matching XPath", matchCount)
 	if matchCount == 0 {
 		logger.Warning("No nodes matched the XPath pattern: %s", path)
 		return content, 0, 0, nil
 	}
 	// Apply modifications to each node
 	modCount := 0
 	for i, node := range nodes {
 		logger.Trace("Processing node #%d: %s", i+1, node.Data)
 		L, err := NewLuaState()
 		if err != nil {
 			logger.Error("Failed to create Lua state: %v", err)
 			return content, 0, 0, fmt.Errorf("error creating Lua state: %v", err)
 		}
 		defer L.Close()
 		logger.Trace("Converting XML node to Lua")
 		err = p.ToLua(L, node)
 		if err != nil {
 			logger.Error("Failed to convert XML node to Lua: %v", err)
 			return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
 		}
 		luaScript := BuildLuaScript(luaExpr)
 		logger.Trace("Executing Lua script: %s", luaScript)
 		err = L.DoString(luaScript)
 		if err != nil {
 			logger.Error("Failed to execute Lua script: %v", err)
 			return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
 		}
 		result, err := p.FromLua(L)
 		if err != nil {
 			logger.Error("Failed to get result from Lua: %v", err)
 			return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
 		}
 		logger.Trace("Lua returned result: %#v", result)
 		modified := false
 		modified = L.GetGlobal("modified").String() == "true"
 		if !modified {
 			logger.Debug("No changes made to node at path: %s", node.Data)
 			continue
 		}
 		// Apply modification based on the result
 		if updatedValue, ok := result.(string); ok {
 			// If the result is a simple string, update the node value directly
 			logger.Debug("Updating node with string value: %s", updatedValue)
 			xpath.Set(doc, path, updatedValue)
 		} else if nodeData, ok := result.(map[string]interface{}); ok {
 			// If the result is a map, apply more complex updates
 			logger.Debug("Updating node with complex data structure")
 			updateNodeFromMap(node, nodeData)
 		}
 		modCount++
 		logger.Debug("Successfully modified node #%d", i+1)
 	}
 	logger.Info("XML processing complete: %d modifications from %d matches", modCount, matchCount)
 	// Serialize the modified XML document to string
 	if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
 		// If we have an XML declaration, start with it
 		declaration := doc.FirstChild.OutputXML(true)
 		// Remove the firstChild (declaration) before serializing the rest of the document
 		doc.FirstChild = doc.FirstChild.NextSibling
 		return ConvertToNamedEntities(declaration + doc.OutputXML(true)), modCount, matchCount, nil
 	}
 	// Convert numeric entities to named entities for better readability
 	return ConvertToNamedEntities(doc.OutputXML(true)), modCount, matchCount, nil
 }
 func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
 	table, err := p.ToLuaTable(L, data)
 	if err != nil {
 		return err
 	}
 	L.SetGlobal("v", table)
 	return nil
 }
 // ToLua converts XML node values to Lua variables
 func (p *XMLProcessor) ToLuaTable(L *lua.LState, data interface{}) (lua.LValue, error) {
 	// Check if data is an xmlquery.Node
 	node, ok := data.(*xmlquery.Node)
 	if !ok {
 		return nil, fmt.Errorf("expected xmlquery.Node, got %T", data)
 	}
 	// Create a simple table with essential data
 	table := L.NewTable()
 	// For element nodes, just provide basic info
 	L.SetField(table, "type", lua.LString(nodeTypeToString(node.Type)))
 	L.SetField(table, "name", lua.LString(node.Data))
 	L.SetField(table, "value", lua.LString(node.InnerText()))
 	// Add children if any
 	children := L.NewTable()
 	for child := node.FirstChild; child != nil; child = child.NextSibling {
 		childTable, err := p.ToLuaTable(L, child)
 		if err == nil {
 			children.Append(childTable)
 		}
 	}
 	L.SetField(table, "children", children)
 	attrs := L.NewTable()
 	if len(node.Attr) > 0 {
 		for _, attr := range node.Attr {
 			L.SetField(attrs, attr.Name.Local, lua.LString(attr.Value))
 		}
 	}
 	L.SetField(table, "attr", attrs)
 	return table, nil
 }
 // FromLua gets modified values from Lua
 func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
 	luaValue := L.GetGlobal("v")
 	// Handle string values directly
 	if luaValue.Type() == lua.LTString {
 		return luaValue.String(), nil
 	}
 	// Handle tables (for attributes and more complex updates)
 	if luaValue.Type() == lua.LTTable {
 		return luaTableToMap(L, luaValue.(*lua.LTable)), nil
 	}
 	return luaValue.String(), nil
 }
 // Simple helper to convert a Lua table to a Go map
 func luaTableToMap(L *lua.LState, table *lua.LTable) map[string]interface{} {
 	result := make(map[string]interface{})
 	table.ForEach(func(k, v lua.LValue) {
 		if k.Type() == lua.LTString {
 			key := k.String()
 			if v.Type() == lua.LTTable {
 				result[key] = luaTableToMap(L, v.(*lua.LTable))
 			} else {
 				result[key] = v.String()
 			}
 		}
 	})
 	return result
 }
 // Simple helper to convert node type to string
 func nodeTypeToString(nodeType xmlquery.NodeType) string {
 	switch nodeType {
 	case xmlquery.ElementNode:
 		return "element"
 	case xmlquery.TextNode:
 		return "text"
 	case xmlquery.AttributeNode:
 		return "attribute"
 	default:
 		return "other"
 	}
 }
 // Helper function to update an XML node from a map
 func updateNodeFromMap(node *xmlquery.Node, data map[string]interface{}) {
 	// Update node value if present
 	if value, ok := data["value"]; ok {
 		if strValue, ok := value.(string); ok {
 			// For element nodes, replace text content
 			if node.Type == xmlquery.ElementNode {
 				// Find the first text child if it exists
 				var textNode *xmlquery.Node
 				for child := node.FirstChild; child != nil; child = child.NextSibling {
 					if child.Type == xmlquery.TextNode {
 						textNode = child
 						break
 					}
 				}
 				if textNode != nil {
 					// Update existing text node
 					textNode.Data = strValue
 				} else {
 					// Create new text node
 					newText := &xmlquery.Node{
 						Type:   xmlquery.TextNode,
 						Data:   strValue,
 						Parent: node,
 					}
 					// Insert at beginning of children
 					if node.FirstChild != nil {
 						newText.NextSibling = node.FirstChild
 						node.FirstChild.PrevSibling = newText
 						node.FirstChild = newText
 					} else {
 						node.FirstChild = newText
 						node.LastChild = newText
 					}
 				}
 			} else if node.Type == xmlquery.TextNode {
 				// Directly update text node
 				node.Data = strValue
 			} else if node.Type == xmlquery.AttributeNode {
 				// Update attribute value
 				if node.Parent != nil {
 					for i, attr := range node.Parent.Attr {
 						if attr.Name.Local == node.Data {
 							node.Parent.Attr[i].Value = strValue
 							break
 						}
 					}
 				}
 			}
 		}
 	}
 	// Update attributes if present
 	if attrs, ok := data["attr"].(map[string]interface{}); ok && node.Type == xmlquery.ElementNode {
 		for name, value := range attrs {
 			if strValue, ok := value.(string); ok {
 				// Look for existing attribute
 				found := false
 				for i, attr := range node.Attr {
 					if attr.Name.Local == name {
 						node.Attr[i].Value = strValue
 						found = true
 						break
 					}
 				}
 				// Add new attribute if not found
 				if !found {
 					node.Attr = append(node.Attr, xmlquery.Attr{
 						Name: struct {
 							Space, Local string
 						}{Local: name},
 						Value: strValue,
 					})
 				}
 			}
 		}
 	}
 }
 // Helper function to get a string representation of node type
 func nodeTypeName(nodeType xmlquery.NodeType) string {
 	switch nodeType {
 	case xmlquery.ElementNode:
 		return "element"
 	case xmlquery.TextNode:
 		return "text"
 	case xmlquery.AttributeNode:
 		return "attribute"
 	case xmlquery.CommentNode:
 		return "comment"
 	case xmlquery.DeclarationNode:
 		return "declaration"
 	default:
 		return "unknown"
 	}
 }
 // ConvertToNamedEntities replaces numeric XML entities with their named counterparts
 func ConvertToNamedEntities(xml string) string {
 	// Basic XML entities
 	replacements := map[string]string{
 		// Basic XML entities
 		"&#34;": "&quot;", // double quote
 		"&#39;": "&apos;", // single quote
 		"&#60;": "&lt;",   // less than
 		"&#62;": "&gt;",   // greater than
 		"&#38;": "&amp;",  // ampersand
 		// Common symbols
 		"&#160;":  "&nbsp;",   // non-breaking space
 		"&#169;":  "&copy;",   // copyright
 		"&#174;":  "&reg;",    // registered trademark
 		"&#8364;": "&euro;",   // euro
 		"&#163;":  "&pound;",  // pound
 		"&#165;":  "&yen;",    // yen
 		"&#162;":  "&cent;",   // cent
 		"&#167;":  "&sect;",   // section
 		"&#8482;": "&trade;",  // trademark
 		"&#9824;": "&spades;", // spade
 		"&#9827;": "&clubs;",  // club
 		"&#9829;": "&hearts;", // heart
 		"&#9830;": "&diams;",  // diamond
 		// Special characters
 		"&#161;":  "&iexcl;",  // inverted exclamation
 		"&#191;":  "&iquest;", // inverted question
 		"&#171;":  "&laquo;",  // left angle quotes
 		"&#187;":  "&raquo;",  // right angle quotes
 		"&#183;":  "&middot;", // middle dot
 		"&#8226;": "&bull;",   // bullet
 		"&#8230;": "&hellip;", // horizontal ellipsis
 		"&#8242;": "&prime;",  // prime
 		"&#8243;": "&Prime;",  // double prime
 		"&#8254;": "&oline;",  // overline
 		"&#8260;": "&frasl;",  // fraction slash
 		// Math symbols
 		"&#177;":  "&plusmn;", // plus-minus
 		"&#215;":  "&times;",  // multiplication
 		"&#247;":  "&divide;", // division
 		"&#8734;": "&infin;",  // infinity
 		"&#8776;": "&asymp;",  // almost equal
 		"&#8800;": "&ne;",     // not equal
 		"&#8804;": "&le;",     // less than or equal
 		"&#8805;": "&ge;",     // greater than or equal
 		"&#8721;": "&sum;",    // summation
 		"&#8730;": "&radic;",  // square root
 		"&#8747;": "&int;",    // integral
 		// Accented characters
 		"&#192;": "&Agrave;", // A grave
 		"&#193;": "&Aacute;", // A acute
 		"&#194;": "&Acirc;",  // A circumflex
 		"&#195;": "&Atilde;", // A tilde
 		"&#196;": "&Auml;",   // A umlaut
 		"&#197;": "&Aring;",  // A ring
 		"&#198;": "&AElig;",  // AE ligature
 		"&#199;": "&Ccedil;", // C cedilla
 		"&#200;": "&Egrave;", // E grave
 		"&#201;": "&Eacute;", // E acute
 		"&#202;": "&Ecirc;",  // E circumflex
 		"&#203;": "&Euml;",   // E umlaut
 		"&#204;": "&Igrave;", // I grave
 		"&#205;": "&Iacute;", // I acute
 		"&#206;": "&Icirc;",  // I circumflex
 		"&#207;": "&Iuml;",   // I umlaut
 		"&#208;": "&ETH;",    // Eth
 		"&#209;": "&Ntilde;", // N tilde
 		"&#210;": "&Ograve;", // O grave
 		"&#211;": "&Oacute;", // O acute
 		"&#212;": "&Ocirc;",  // O circumflex
 		"&#213;": "&Otilde;", // O tilde
 		"&#214;": "&Ouml;",   // O umlaut
 		"&#216;": "&Oslash;", // O slash
 		"&#217;": "&Ugrave;", // U grave
 		"&#218;": "&Uacute;", // U acute
 		"&#219;": "&Ucirc;",  // U circumflex
 		"&#220;": "&Uuml;",   // U umlaut
 		"&#221;": "&Yacute;", // Y acute
 		"&#222;": "&THORN;",  // Thorn
 		"&#223;": "&szlig;",  // Sharp s
 		"&#224;": "&agrave;", // a grave
 		"&#225;": "&aacute;", // a acute
 		"&#226;": "&acirc;",  // a circumflex
 		"&#227;": "&atilde;", // a tilde
 		"&#228;": "&auml;",   // a umlaut
 		"&#229;": "&aring;",  // a ring
 		"&#230;": "&aelig;",  // ae ligature
 		"&#231;": "&ccedil;", // c cedilla
 		"&#232;": "&egrave;", // e grave
 		"&#233;": "&eacute;", // e acute
 		"&#234;": "&ecirc;",  // e circumflex
 		"&#235;": "&euml;",   // e umlaut
 		"&#236;": "&igrave;", // i grave
 		"&#237;": "&iacute;", // i acute
 		"&#238;": "&icirc;",  // i circumflex
 		"&#239;": "&iuml;",   // i umlaut
 		"&#240;": "&eth;",    // eth
 		"&#241;": "&ntilde;", // n tilde
 		"&#242;": "&ograve;", // o grave
 		"&#243;": "&oacute;", // o acute
 		"&#244;": "&ocirc;",  // o circumflex
 		"&#245;": "&otilde;", // o tilde
 		"&#246;": "&ouml;",   // o umlaut
 		"&#248;": "&oslash;", // o slash
 		"&#249;": "&ugrave;", // u grave
 		"&#250;": "&uacute;", // u acute
 		"&#251;": "&ucirc;",  // u circumflex
 		"&#252;": "&uuml;",   // u umlaut
 		"&#253;": "&yacute;", // y acute
 		"&#254;": "&thorn;",  // thorn
 		"&#255;": "&yuml;",   // y umlaut
 	}
 	result := xml
 	for numeric, named := range replacements {
 		result = strings.ReplaceAll(result, numeric, named)
 	}
 	return result
 }
--- a/processor/xml_test.go
+++ b/processor/xml_test.go
--- a/processor/xpath/parser_manual_test.go
+++ b/processor/xpath/parser_manual_test.go
@@ -1,4 +0,0 @@
 // The package is now using github.com/antchfx/xmlquery for XPath parsing.
 // The parsing functionality tests have been removed since we're now
 // delegating XPath parsing to the xmlquery library.
 package xpath
--- a/processor/xpath/parser_test.go
+++ b/processor/xpath/parser_test.go
@@ -1,4 +0,0 @@
 // The package is now using github.com/antchfx/xmlquery for XPath parsing.
 // The parsing functionality tests have been removed since we're now
 // delegating XPath parsing to the xmlquery library.
 package xpath
--- a/processor/xpath/xpath.go
+++ b/processor/xpath/xpath.go
@@ -1,133 +0,0 @@
 package xpath
 import (
 	"errors"
 	"fmt"
 	"github.com/antchfx/xmlquery"
 )
 // Get retrieves nodes from XML data using an XPath expression
 func Get(node *xmlquery.Node, path string) ([]*xmlquery.Node, error) {
 	if node == nil {
 		return nil, errors.New("nil node provided")
 	}
 	// Execute xpath query directly
 	nodes, err := xmlquery.QueryAll(node, path)
 	if err != nil {
 		return nil, fmt.Errorf("failed to execute XPath query: %v", err)
 	}
 	return nodes, nil
 }
 // Set updates a single node in the XML data using an XPath expression
 func Set(node *xmlquery.Node, path string, value interface{}) error {
 	if node == nil {
 		return errors.New("nil node provided")
 	}
 	// Find the node to update
 	nodes, err := xmlquery.QueryAll(node, path)
 	if err != nil {
 		return fmt.Errorf("failed to execute XPath query: %v", err)
 	}
 	if len(nodes) == 0 {
 		return fmt.Errorf("no nodes found for path: %s", path)
 	}
 	// Update the first matching node
 	updateNodeValue(nodes[0], value)
 	return nil
 }
 // SetAll updates all nodes that match the XPath expression
 func SetAll(node *xmlquery.Node, path string, value interface{}) error {
 	if node == nil {
 		return errors.New("nil node provided")
 	}
 	// Find all nodes to update
 	nodes, err := xmlquery.QueryAll(node, path)
 	if err != nil {
 		return fmt.Errorf("failed to execute XPath query: %v", err)
 	}
 	if len(nodes) == 0 {
 		return fmt.Errorf("no nodes found for path: %s", path)
 	}
 	// Update all matching nodes
 	for _, matchNode := range nodes {
 		updateNodeValue(matchNode, value)
 	}
 	return nil
 }
 // Helper function to update a node's value
 func updateNodeValue(node *xmlquery.Node, value interface{}) {
 	strValue := fmt.Sprintf("%v", value)
 	// Handle different node types
 	switch node.Type {
 	case xmlquery.AttributeNode:
 		// For attribute nodes, update the attribute value
 		parent := node.Parent
 		if parent != nil {
 			for i, attr := range parent.Attr {
 				if attr.Name.Local == node.Data {
 					parent.Attr[i].Value = strValue
 					break
 				}
 			}
 		}
 	case xmlquery.TextNode:
 		// For text nodes, update the text content
 		node.Data = strValue
 	case xmlquery.ElementNode:
 		// For element nodes, clear existing text children and add a new text node
 		// First, remove all existing text children
 		var nonTextChildren []*xmlquery.Node
 		for child := node.FirstChild; child != nil; child = child.NextSibling {
 			if child.Type != xmlquery.TextNode {
 				nonTextChildren = append(nonTextChildren, child)
 			}
 		}
 		// Clear all children
 		node.FirstChild = nil
 		node.LastChild = nil
 		// Add a new text node
 		textNode := &xmlquery.Node{
 			Type:   xmlquery.TextNode,
 			Data:   strValue,
 			Parent: node,
 		}
 		// Set the text node as the first child
 		node.FirstChild = textNode
 		node.LastChild = textNode
 		// Add back non-text children
 		for _, child := range nonTextChildren {
 			child.Parent = node
 			// If this is the first child being added back
 			if node.FirstChild == textNode && node.LastChild == textNode {
 				node.FirstChild.NextSibling = child
 				child.PrevSibling = node.FirstChild
 				node.LastChild = child
 			} else {
 				// Add to the end of the chain
 				node.LastChild.NextSibling = child
 				child.PrevSibling = node.LastChild
 				node.LastChild = child
 			}
 		}
 	}
 }
--- a/processor/xpath/xpath_test.go
+++ b/processor/xpath/xpath_test.go
@@ -1,474 +0,0 @@
 package xpath
 import (
 	"strings"
 	"testing"
 	"github.com/antchfx/xmlquery"
 )
 // Parse test XML data once at the beginning for use in multiple tests
 func parseTestXML(t *testing.T, xmlData string) *xmlquery.Node {
 	doc, err := xmlquery.Parse(strings.NewReader(xmlData))
 	if err != nil {
 		t.Fatalf("Failed to parse test XML: %v", err)
 	}
 	return doc
 }
 // XML test data as a string for our tests
 var testXML = `
 <store>
  <book category="fiction">
    <title lang="en">The Fellowship of the Ring</title>
    <author>J.R.R. Tolkien</author>
    <year>1954</year>
    <price>22.99</price>
  </book>
  <book category="fiction">
    <title lang="en">The Two Towers</title>
    <author>J.R.R. Tolkien</author>
    <year>1954</year>
    <price>23.45</price>
  </book>
  <book category="technical">
    <title lang="en">Learning XML</title>
    <author>Erik T. Ray</author>
    <year>2003</year>
    <price>39.95</price>
  </book>
  <bicycle>
    <color>red</color>
    <price>199.95</price>
  </bicycle>
 </store>
 `
 func TestEvaluator(t *testing.T) {
 	// Parse the test XML data once for all test cases
 	doc := parseTestXML(t, testXML)
 	tests := []struct {
 		name  string
 		path  string
 		error bool
 	}{
 		{
 			name: "simple_element_access",
 			path: "/store/bicycle/color",
 		},
 		{
 			name: "recursive_element_access",
 			path: "//price",
 		},
 		{
 			name: "wildcard_element_access",
 			path: "/store/book/*",
 		},
 		{
 			name: "attribute_exists_predicate",
 			path: "//title[@lang]",
 		},
 		{
 			name: "attribute_equals_predicate",
 			path: "//title[@lang='en']",
 		},
 		{
 			name:  "value_comparison_predicate",
 			path:  "/store/book[price>35.00]/title",
 			error: true,
 		},
 		{
 			name:  "last_predicate",
 			path:  "/store/book[last()]/title",
 			error: true,
 		},
 		{
 			name:  "last_minus_predicate",
 			path:  "/store/book[last()-1]/title",
 			error: true,
 		},
 		{
 			name:  "position_predicate",
 			path:  "/store/book[position()<3]/title",
 			error: true,
 		},
 		{
 			name:  "invalid_index",
 			path:  "/store/book[10]/title",
 			error: true,
 		},
 		{
 			name: "nonexistent_element",
 			path: "/store/nonexistent",
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			result, err := Get(doc, tt.path)
 			// Handle expected errors
 			if tt.error {
 				if err == nil && len(result) == 0 {
 					// If we expected an error but got empty results instead, that's okay
 					return
 				}
 				if err != nil {
 					// If we got an error as expected, that's okay
 					return
 				}
 			} else if err != nil {
 				// If we didn't expect an error but got one, that's a test failure
 				t.Errorf("Get(%q) returned unexpected error: %v", tt.path, err)
 				return
 			}
 			// Special cases where we don't care about exact matches
 			switch tt.name {
 			case "wildcard_element_access":
 				// Just check that we got some elements
 				if len(result) == 0 {
 					t.Errorf("Expected multiple elements for wildcard, got none")
 				}
 				return
 			case "attribute_exists_predicate", "attribute_equals_predicate":
 				// Just check that we got some titles
 				if len(result) == 0 {
 					t.Errorf("Expected titles with lang attribute, got none")
 				}
 				// Ensure all are title elements
 				for _, node := range result {
 					if node.Data != "title" {
 						t.Errorf("Expected title elements, got: %s", node.Data)
 					}
 				}
 				return
 			case "nonexistent_element":
 				// Just check that we got empty results
 				if len(result) != 0 {
 					t.Errorf("Expected empty results for nonexistent element, got %d items", len(result))
 				}
 				return
 			}
 			// For other cases, just verify we got results
 			if len(result) == 0 {
 				t.Errorf("Expected results for path %s, got none", tt.path)
 			}
 		})
 	}
 }
 func TestEdgeCases(t *testing.T) {
 	t.Run("nil_node", func(t *testing.T) {
 		result, err := Get(nil, "/store/book")
 		if err == nil {
 			t.Errorf("Expected error for nil node")
 			return
 		}
 		if len(result) > 0 {
 			t.Errorf("Expected empty result, got %v", result)
 		}
 	})
 	t.Run("invalid_xml", func(t *testing.T) {
 		invalidXML, err := xmlquery.Parse(strings.NewReader("<invalid>xml"))
 		if err != nil {
 			// If parsing fails, that's expected
 			return
 		}
 		_, err = Get(invalidXML, "/store")
 		if err == nil {
 			t.Error("Expected error for invalid XML structure")
 		}
 	})
 	// For these tests with the simple XML, we expect just one result
 	simpleXML := `<root><book><title lang="en">Test</title></book></root>`
 	doc := parseTestXML(t, simpleXML)
 	t.Run("current_node", func(t *testing.T) {
 		result, err := Get(doc, "/root/book/.")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) > 1 {
 			t.Errorf("Expected at most 1 result, got %d", len(result))
 		}
 		if len(result) > 0 {
 			// Verify it's the book node
 			if result[0].Data != "book" {
 				t.Errorf("Expected book node, got %v", result[0].Data)
 			}
 		}
 	})
 	t.Run("attributes", func(t *testing.T) {
 		result, err := Get(doc, "/root/book/title/@lang")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 || result[0].InnerText() != "en" {
 			t.Errorf("Expected 'en', got %v", result[0].InnerText())
 		}
 	})
 }
 func TestGetWithPaths(t *testing.T) {
 	// Use a simplified, well-formed XML document
 	simpleXML := `<store>
  <book category="fiction">
    <title lang="en">The Book Title</title>
    <author>Author Name</author>
    <price>19.99</price>
  </book>
  <bicycle>
    <color>red</color>
    <price>199.95</price>
  </bicycle>
 </store>`
 	// Parse the XML for testing
 	doc := parseTestXML(t, simpleXML)
 	// Debug: Print the test XML
 	t.Logf("Test XML:\n%s", simpleXML)
 	tests := []struct {
 		name          string
 		path          string
 		expectedValue string
 	}{
 		{
 			name:          "simple_element_access",
 			path:          "/store/bicycle/color",
 			expectedValue: "red",
 		},
 		{
 			name:          "attribute_access",
 			path:          "/store/book/title/@lang",
 			expectedValue: "en",
 		},
 		{
 			name:          "recursive_with_attribute",
 			path:          "//title[@lang='en']",
 			expectedValue: "The Book Title",
 		},
 	}
 	for _, tt := range tests {
 		t.Run(tt.name, func(t *testing.T) {
 			// Debug: Print the path we're looking for
 			t.Logf("Looking for path: %s", tt.path)
 			result, err := Get(doc, tt.path)
 			if err != nil {
 				t.Errorf("Get(%q) returned error: %v", tt.path, err)
 				return
 			}
 			// Debug: Print the results
 			t.Logf("Got %d results", len(result))
 			for i, r := range result {
 				t.Logf("Result %d: Node=%s, Value=%v", i, r.Data, r.InnerText())
 			}
 			// Check that we got results
 			if len(result) == 0 {
 				t.Errorf("Get(%q) returned no results", tt.path)
 				return
 			}
 			// For attribute access test, do more specific checks
 			if tt.name == "attribute_access" {
 				// Check the first result's value matches expected
 				if result[0].InnerText() != tt.expectedValue {
 					t.Errorf("Attribute value: got %v, expected %s", result[0].InnerText(), tt.expectedValue)
 				}
 			}
 			// For simple element access, check the text content
 			if tt.name == "simple_element_access" {
 				if text := result[0].InnerText(); text != tt.expectedValue {
 					t.Errorf("Element text: got %s, expected %s", text, tt.expectedValue)
 				}
 			}
 			// For recursive with attribute test, check title elements with lang="en"
 			if tt.name == "recursive_with_attribute" {
 				for _, node := range result {
 					// Check the node is a title
 					if node.Data != "title" {
 						t.Errorf("Expected title element, got %s", node.Data)
 					}
 					// Check text content
 					if text := node.InnerText(); text != tt.expectedValue {
 						t.Errorf("Text content: got %s, expected %s", text, tt.expectedValue)
 					}
 					// Check attributes - find the lang attribute
 					hasLang := false
 					for _, attr := range node.Attr {
 						if attr.Name.Local == "lang" && attr.Value == "en" {
 							hasLang = true
 							break
 						}
 					}
 					if !hasLang {
 						t.Errorf("Expected lang=\"en\" attribute, but it was not found")
 					}
 				}
 			}
 		})
 	}
 }
 func TestSet(t *testing.T) {
 	t.Run("simple element", func(t *testing.T) {
 		xmlData := `<root><name>John</name></root>`
 		doc := parseTestXML(t, xmlData)
 		err := Set(doc, "/root/name", "Jane")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change
 		result, err := Get(doc, "/root/name")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 {
 			t.Errorf("Expected 1 result, got %d", len(result))
 			return
 		}
 		// Check text content
 		if text := result[0].InnerText(); text != "Jane" {
 			t.Errorf("Expected text 'Jane', got '%s'", text)
 		}
 	})
 	t.Run("attribute", func(t *testing.T) {
 		xmlData := `<root><element id="123"></element></root>`
 		doc := parseTestXML(t, xmlData)
 		err := Set(doc, "/root/element/@id", "456")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change
 		result, err := Get(doc, "/root/element/@id")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 1 {
 			t.Errorf("Expected 1 result, got %d", len(result))
 			return
 		}
 		// For attributes, check the inner text
 		if text := result[0].InnerText(); text != "456" {
 			t.Errorf("Expected attribute value '456', got '%s'", text)
 		}
 	})
 	t.Run("indexed element", func(t *testing.T) {
 		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
 		doc := parseTestXML(t, xmlData)
 		err := Set(doc, "/root/items/item[1]", "changed")
 		if err != nil {
 			t.Errorf("Set() returned error: %v", err)
 			return
 		}
 		// Verify the change using XPath that specifically targets the first item
 		result, err := Get(doc, "/root/items/item[1]")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		// Check if we have results
 		if len(result) == 0 {
 			t.Errorf("Expected at least one result for /root/items/item[1]")
 			return
 		}
 		// Check text content
 		if text := result[0].InnerText(); text != "changed" {
 			t.Errorf("Expected text 'changed', got '%s'", text)
 		}
 	})
 }
 func TestSetAll(t *testing.T) {
 	t.Run("multiple elements", func(t *testing.T) {
 		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
 		doc := parseTestXML(t, xmlData)
 		err := SetAll(doc, "//item", "changed")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Verify all items are changed
 		result, err := Get(doc, "//item")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 2 {
 			t.Errorf("Expected 2 results, got %d", len(result))
 			return
 		}
 		// Check each node
 		for i, node := range result {
 			if text := node.InnerText(); text != "changed" {
 				t.Errorf("Item %d: expected text 'changed', got '%s'", i, text)
 			}
 		}
 	})
 	t.Run("attributes", func(t *testing.T) {
 		xmlData := `<root><item id="1"/><item id="2"/></root>`
 		doc := parseTestXML(t, xmlData)
 		err := SetAll(doc, "//item/@id", "new")
 		if err != nil {
 			t.Errorf("SetAll() returned error: %v", err)
 			return
 		}
 		// Verify all attributes are changed
 		result, err := Get(doc, "//item/@id")
 		if err != nil {
 			t.Errorf("Get() returned error: %v", err)
 			return
 		}
 		if len(result) != 2 {
 			t.Errorf("Expected 2 results, got %d", len(result))
 			return
 		}
 		// For attributes, check inner text
 		for i, node := range result {
 			if text := node.InnerText(); text != "new" {
 				t.Errorf("Attribute %d: expected value 'new', got '%s'", i, text)
 			}
 		}
 	})
 }
--- a/regression/regression_test.go
+++ b/regression/regression_test.go
@@ -2,9 +2,28 @@ package regression
 import (
 	"modify/processor"
 	"modify/utils"
 	"os"
 	"path/filepath"
 	"testing"
 )
 func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
 	command := utils.ModifyCommand{
 		Regex:    regex,
 		Lua:      lua,
 		LogLevel: "TRACE",
 	}
 	commands, err := processor.ProcessRegex(content, command, "test")
 	if err != nil {
 		return "", 0, 0, err
 	}
 	result, modifications := utils.ExecuteModifications(commands, content)
 	return result, modifications, len(commands), nil
 }
 func TestTalentsMechanicOutOfRange(t *testing.T) {
 	given := `<Talent identifier="quickfixer">
    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
@@ -62,22 +81,57 @@ func TestTalentsMechanicOutOfRange(t *testing.T) {
    </AbilityGroupEffect>
  </Talent>`
-	p := &processor.RegexProcessor{}
+	result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
 	result, mods, matches, err := p.ProcessContent(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
-	if matches != 1 {
+	if matches != 4 {
-		t.Errorf("Expected 1 match, got %d", matches)
+		t.Errorf("Expected 4 matches, got %d", matches)
 	}
-	if mods != 1 {
+	if mods != 4 {
-		t.Errorf("Expected 1 modification, got %d", mods)
+		t.Errorf("Expected 4 modifications, got %d", mods)
 	}
 	if result != actual {
 		t.Errorf("expected %s, got %s", actual, result)
 	}
 }
 func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
 	cwd, err := os.Getwd()
 	if err != nil {
 		t.Fatalf("Error getting current working directory: %v", err)
 	}
 	given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
 	if err != nil {
 		t.Fatalf("Error reading file: %v", err)
 	}
 	result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 	// We don't really care how many god damn matches there are as long as the result is correct
 	// if matches != 45 {
 	// 	t.Errorf("Expected 45 match, got %d", matches)
 	// }
 	//
 	// if mods != 45 {
 	// 	t.Errorf("Expected 45 modification, got %d", mods)
 	// }
 	if string(result) != string(expected) {
 		t.Errorf("expected %s, got %s", expected, result)
 	}
 }
--- a/test.xml
+++ b/test.xml
@@ -1 +0,0 @@
 <config><item><value>100</value></item></config>
--- a/test_complex.xml
+++ b/test_complex.xml
@@ -1,12 +0,0 @@
 <config>
  <item>
    <value>75</value>
    <multiplier>2</multiplier>
    <divider>4</divider>
  </item>
  <item>
    <value>150</value>
    <multiplier>3</multiplier>
    <divider>2</divider>
  </item>
 </config>
--- a/test_data.xml
+++ b/test_data.xml
@@ -1,37 +0,0 @@
 <?xml version="1.0" encoding="UTF-8"?>
 <testdata>
    <!-- Numeric values -->
    <item>
        <id>1</id>
        <value>200</value>
        <price>24.99</price>
        <quantity>5</quantity>
    </item>
    <!-- Text values -->
    <item>
        <id>2</id>
        <name>Test Product</name>
        <description>This is a test product description</description>
        <category>Test</category>
    </item>
    <!-- Mixed content -->
    <item>
        <id>3</id>
        <name>Mixed Product</name>
        <price>19.99</price>
        <code>PRD-123</code>
        <tags>sale,discount,new</tags>
    </item>
    <!-- Empty and special values -->
    <item>
        <id>4</id>
        <value></value>
        <specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
        <multiline>Line 1
 Line 2
 Line 3</multiline>
    </item>
 </testdata> 
--- a/testfiles/OutpostItems.xml
+++ b/testfiles/OutpostItems.xml
--- a/testfiles/OutpostItemsExpected.xml
+++ b/testfiles/OutpostItemsExpected.xml
--- a/testfiles/foo/bar/test.xml
+++ b/testfiles/foo/bar/test.xml
@@ -1 +0,0 @@
 <config><item><value>100</value></item></config>
--- a/utils/flags.go
+++ b/utils/flags.go
@@ -0,0 +1,16 @@
 package utils
 import (
 	"flag"
 )
 var (
 	// Deprecated
 	GitFlag       = flag.Bool("git", false, "Use git to manage files")
 	// Deprecated
 	ResetFlag     = flag.Bool("reset", false, "Reset files to their original state")
 	LogLevel      = flag.String("loglevel", "INFO", "Set log level: ERROR, WARNING, INFO, DEBUG, TRACE")
 	Cookfile      = flag.String("cook", "**/cook.yml", "Path to cook config files, can be globbed")
 	ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
 	Filter        = flag.String("filter", "", "Filter commands before running them")
 )
--- a/utils/git.go
+++ b/utils/git.go
@@ -0,0 +1,97 @@
 package utils
 import (
 	"fmt"
 	"modify/logger"
 	"os"
 	"path/filepath"
 	"time"
 	"github.com/go-git/go-git/v5/plumbing/object"
 	"github.com/go-git/go-git/v5"
 )
 var (
 	Repo     *git.Repository
 	Worktree *git.Worktree
 )
 func SetupGit() error {
 	cwd, err := os.Getwd()
 	if err != nil {
 		return fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	logger.Debug("Current working directory obtained: %s", cwd)
 	logger.Debug("Attempting to open git repository at %s", cwd)
 	Repo, err = git.PlainOpen(cwd)
 	if err != nil {
 		logger.Debug("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
 		Repo, err = git.PlainInit(cwd, false)
 		if err != nil {
 			return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
 		}
 		logger.Info("Successfully initialized a new git repository at %s", cwd)
 	} else {
 		logger.Info("Successfully opened existing git repository at %s", cwd)
 	}
 	logger.Debug("Attempting to obtain worktree for repository at %s", cwd)
 	Worktree, err = Repo.Worktree()
 	if err != nil {
 		return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
 	}
 	logger.Debug("Successfully obtained worktree for repository at %s", cwd)
 	return nil
 }
 func CleanupGitFiles(files []string) error {
 	for _, file := range files {
 		logger.Debug("Checking git status for file: %s", file)
 		status, err := Worktree.Status()
 		if err != nil {
 			logger.Error("Error getting worktree status: %v", err)
 			fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
 			return fmt.Errorf("error getting worktree status: %w", err)
 		}
 		if status.IsUntracked(file) {
 			logger.Info("Detected untracked file: %s. Adding to git index.", file)
 			_, err = Worktree.Add(file)
 			if err != nil {
 				logger.Error("Error adding file to git: %v", err)
 				fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
 				return fmt.Errorf("error adding file to git: %w", err)
 			}
 			filename := filepath.Base(file)
 			logger.Info("File %s added successfully. Committing with message: 'Track %s'", filename, filename)
 			_, err = Worktree.Commit("Track "+filename, &git.CommitOptions{
 				Author: &object.Signature{
 					Name:  "Big Chef",
 					Email: "bigchef@bigchef.com",
 					When:  time.Now(),
 				},
 			})
 			if err != nil {
 				logger.Error("Error committing file: %v", err)
 				fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
 				return fmt.Errorf("error committing file: %w", err)
 			}
 			logger.Info("Successfully committed file: %s", filename)
 		} else {
 			logger.Info("File %s is already tracked. Restoring it to the working tree.", file)
 			err := Worktree.Restore(&git.RestoreOptions{
 				Files:    []string{file},
 				Staged:   true,
 				Worktree: true,
 			})
 			if err != nil {
 				logger.Error("Error restoring file: %v", err)
 				fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
 				return fmt.Errorf("error restoring file: %w", err)
 			}
 			logger.Info("File %s restored successfully", file)
 		}
 	}
 	return nil
 }
--- a/utils/modifycommand.go
+++ b/utils/modifycommand.go
@@ -0,0 +1,339 @@
 package utils
 import (
 	"fmt"
 	"modify/logger"
 	"os"
 	"path/filepath"
 	"strings"
 	"github.com/bmatcuk/doublestar/v4"
 	"gopkg.in/yaml.v3"
 )
 type ModifyCommand struct {
 	Name     string   `yaml:"name"`
 	Regex    string   `yaml:"regex"`
 	Lua      string   `yaml:"lua"`
 	Files    []string `yaml:"files"`
 	Git      bool     `yaml:"git"`
 	Reset    bool     `yaml:"reset"`
 	LogLevel string   `yaml:"loglevel"`
 	Isolate  bool     `yaml:"isolate"`
 	NoDedup  bool     `yaml:"nodedup"`
 }
 type CookFile []ModifyCommand
 func (c *ModifyCommand) Validate() error {
 	if c.Regex == "" {
 		return fmt.Errorf("pattern is required")
 	}
 	if c.Lua == "" {
 		return fmt.Errorf("lua expression is required")
 	}
 	if len(c.Files) == 0 {
 		return fmt.Errorf("at least one file is required")
 	}
 	if c.LogLevel == "" {
 		c.LogLevel = "INFO"
 	}
 	return nil
 }
 // Ehh.. Not much better... Guess this wasn't the big deal
 var matchesMemoTable map[string]bool = make(map[string]bool)
 func Matches(path string, glob string) (bool, error) {
 	key := fmt.Sprintf("%s:%s", path, glob)
 	if matches, ok := matchesMemoTable[key]; ok {
 		logger.Debug("Found match for file %q and glob %q in memo table", path, glob)
 		return matches, nil
 	}
 	matches, err := doublestar.Match(glob, path)
 	if err != nil {
 		return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
 	}
 	matchesMemoTable[key] = matches
 	return matches, nil
 }
 type FileCommandAssociation struct {
 	File            string
 	IsolateCommands []ModifyCommand
 	Commands        []ModifyCommand
 }
 func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
 	associationCount := 0
 	fileCommands := make(map[string]FileCommandAssociation)
 	for _, file := range files {
 		fileCommands[file] = FileCommandAssociation{
 			File:            file,
 			IsolateCommands: []ModifyCommand{},
 			Commands:        []ModifyCommand{},
 		}
 		for _, command := range commands {
 			for _, glob := range command.Files {
 				_, pattern, err := FigureOutGlobRoot(glob)
 				if err != nil {
 					logger.Trace("Failed to figure out glob root for %s: %v", glob, err)
 					continue
 				}
 				file = filepath.Clean(file)
 				file = strings.ReplaceAll(file, "\\", "/")
 				matches, err := Matches(file, pattern)
 				if err != nil {
 					logger.Trace("Failed to match glob %s with file %s: %v", glob, file, err)
 					continue
 				}
 				if matches {
 					logger.Debug("Found match for file %q and command %q", file, command.Regex)
 					association := fileCommands[file]
 					if command.Isolate {
 						association.IsolateCommands = append(association.IsolateCommands, command)
 					} else {
 						association.Commands = append(association.Commands, command)
 					}
 					fileCommands[file] = association
 					associationCount++
 				}
 			}
 		}
 		logger.Debug("Found %d commands for file %q", len(fileCommands[file].Commands), file)
 		if len(fileCommands[file].Commands) == 0 {
 			logger.Info("No commands found for file %q", file)
 		}
 		if len(fileCommands[file].IsolateCommands) > 0 {
 			logger.Info("Found %d isolate commands for file %q", len(fileCommands[file].IsolateCommands), file)
 		}
 	}
 	logger.Info("Found %d associations between %d files and %d commands", associationCount, len(files), len(commands))
 	return fileCommands, nil
 }
 func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
 	logger.Info("Aggregating globs for %d commands", len(commands))
 	globs := make(map[string]struct{})
 	for _, command := range commands {
 		for _, glob := range command.Files {
 			glob = strings.ReplaceAll(glob, "~", os.Getenv("USERPROFILE"))
 			glob = strings.ReplaceAll(glob, "\\", "/")
 			globs[glob] = struct{}{}
 		}
 	}
 	logger.Info("Found %d unique globs", len(globs))
 	return globs
 }
 func FigureOutGlobRoot(inputPattern string) (root, pattern string, err error) {
 	logger.Debug("Starting to figure out glob root for input pattern: %s", inputPattern)
 	cwd, err := os.Getwd()
 	if err != nil {
 		logger.Error("Failed to get current working directory: %v", err)
 		return "", inputPattern, fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	logger.Trace("Current working directory: %s", cwd)
 	root = inputPattern
 	if !filepath.IsAbs(inputPattern) {
 		root = filepath.Join(cwd, inputPattern)
 		logger.Info("Input pattern is not absolute. Using combined path: %s", root)
 	}
 	root = filepath.Clean(root)
 	logger.Debug("Cleaned root path: %s", root)
 	// In either case (whatever our root may be), we have to figure out
 	// Where to start, what our FS will be
 	// The best place would be the last sure entry
 	// That is to say the final directory that is not a wildcard
 	finalroot := ""
 	// TODO: This will probably explode on linux because oooooooooo we have to be clever oooooooooo / on linux \\ on windows ooooooooooo
 	parts := strings.Split(root, "\\")
 	lastIndex := len(parts) - 1
 	logger.Debug("Split root into parts: %v", parts)
 	// In the case our pattern ends with a file (and many of them do)
 	// Look for only the folders, we cannot mount a file as a FS
 	// In any case we have to match files so they have to be the last part
 	for i := 0; i < len(parts)-1; i++ {
 		part := parts[i]
 		logger.Trace("Processing part: %s", part)
 		if part == "*" || part == "**" || part == "?" || part == "[" {
 			lastIndex = i
 			logger.Debug("Found wildcard part: %s, updating lastIndex to: %d", part, lastIndex)
 			break
 		}
 		// We can't use join here because it joins C: and Users as C:Users
 		// Instead of C:/Users/
 		// God damn it
 		if finalroot != "" {
 			finalroot = finalroot + "/" + part
 		} else {
 			finalroot = finalroot + part
 		}
 	}
 	finalroot = filepath.Clean(finalroot)
 	logger.Debug("Final root after processing: %s", finalroot)
 	// After all this juggling our pattern is whatever is left after the finalroot
 	// Which is, in "worst" case, only a file
 	pattern = strings.Join(parts[lastIndex:], "/")
 	logger.Info("Determined pattern: %s", pattern)
 	return finalroot, pattern, nil
 }
 func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
 	var files []string
 	filesMap := make(map[string]bool)
 	for pattern := range patterns {
 		root, pattern, err := FigureOutGlobRoot(pattern)
 		if err != nil {
 			return nil, fmt.Errorf("failed to figure out glob root: %w", err)
 		}
 		logger.Trace("Processing pattern: %s", pattern)
 		matches, err := doublestar.Glob(os.DirFS(root), pattern)
 		if err != nil {
 			return nil, fmt.Errorf("failed to glob pattern %s: %w", pattern, err)
 		}
 		logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
 		for _, m := range matches {
 			m = filepath.Join(root, m)
 			m = filepath.Clean(m)
 			m = strings.ReplaceAll(m, "\\", "/")
 			info, err := os.Stat(m)
 			if err != nil {
 				logger.Warning("Error getting file info for %s: %v", m, err)
 				continue
 			}
 			if !info.IsDir() && !filesMap[m] {
 				logger.Trace("Adding file to process list: %s", m)
 				filesMap[m], files = true, append(files, m)
 			}
 		}
 	}
 	if len(files) > 0 {
 		logger.Debug("Found %d files to process: %v", len(files), files)
 	}
 	return files, nil
 }
 func LoadCommands(args []string) ([]ModifyCommand, error) {
 	commands := []ModifyCommand{}
 	logger.Info("Loading commands from cook files: %s", *Cookfile)
 	newcommands, err := LoadCommandsFromCookFiles(*Cookfile)
 	if err != nil {
 		return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
 	}
 	logger.Info("Successfully loaded %d commands from cook files", len(newcommands))
 	commands = append(commands, newcommands...)
 	logger.Info("Now total commands: %d", len(commands))
 	logger.Info("Loading commands from arguments: %v", args)
 	newcommands, err = LoadCommandFromArgs(args)
 	if err != nil {
 		if len(commands) == 0 {
 			return nil, fmt.Errorf("failed to load commands from args: %w", err)
 		}
 		logger.Warning("Failed to load commands from args: %v", err)
 	}
 	logger.Info("Successfully loaded %d commands from args", len(newcommands))
 	commands = append(commands, newcommands...)
 	logger.Info("Now total commands: %d", len(commands))
 	return commands, nil
 }
 func LoadCommandFromArgs(args []string) ([]ModifyCommand, error) {
 	// Cannot reset without git, right?
 	if *ResetFlag {
 		*GitFlag = true
 	}
 	if len(args) < 3 {
 		return nil, fmt.Errorf("at least %d arguments are required", 3)
 	}
 	command := ModifyCommand{
 		Regex:    args[0],
 		Lua:      args[1],
 		Files:    args[2:],
 		Git:      *GitFlag,
 		Reset:    *ResetFlag,
 		LogLevel: *LogLevel,
 	}
 	if err := command.Validate(); err != nil {
 		return nil, fmt.Errorf("invalid command: %w", err)
 	}
 	return []ModifyCommand{command}, nil
 }
 func LoadCommandsFromCookFiles(s string) ([]ModifyCommand, error) {
 	cwd, err := os.Getwd()
 	if err != nil {
 		return nil, fmt.Errorf("failed to get current working directory: %w", err)
 	}
 	commands := []ModifyCommand{}
 	cookFiles, err := doublestar.Glob(os.DirFS(cwd), *Cookfile)
 	if err != nil {
 		return nil, fmt.Errorf("failed to glob cook files: %w", err)
 	}
 	for _, cookFile := range cookFiles {
 		cookFileData, err := os.ReadFile(cookFile)
 		if err != nil {
 			return nil, fmt.Errorf("failed to read cook file: %w", err)
 		}
 		newcommands, err := LoadCommandsFromCookFile(cookFileData)
 		if err != nil {
 			return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
 		}
 		commands = append(commands, newcommands...)
 	}
 	return commands, nil
 }
 func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
 	commands := []ModifyCommand{}
 	err := yaml.Unmarshal(cookFileData, &commands)
 	if err != nil {
 		return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
 	}
 	return commands, nil
 }
 // CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
 func CountGlobsBeforeDedup(commands []ModifyCommand) int {
 	count := 0
 	for _, cmd := range commands {
 		count += len(cmd.Files)
 	}
 	return count
 }
 func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
 	filteredCommands := []ModifyCommand{}
 	filters := strings.Split(filter, ",")
 	for _, cmd := range commands {
 		for _, filter := range filters {
 			if strings.Contains(cmd.Name, filter) {
 				filteredCommands = append(filteredCommands, cmd)
 			}
 		}
 	}
 	return filteredCommands
 }
--- a/utils/modifycommand_test.go
+++ b/utils/modifycommand_test.go
--- a/utils/replacecommand.go
+++ b/utils/replacecommand.go
@@ -0,0 +1,57 @@
 package utils
 import (
 	"fmt"
 	"modify/logger"
 	"sort"
 )
 type ReplaceCommand struct {
 	From int
 	To   int
 	With string
 }
 func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
 	var err error
 	sort.Slice(modifications, func(i, j int) bool {
 		return modifications[i].From > modifications[j].From
 	})
 	logger.Trace("Preparing to apply %d replacement commands in reverse order", len(modifications))
 	executed := 0
 	for _, modification := range modifications {
 		fileData, err = modification.Execute(fileData)
 		if err != nil {
 			logger.Error("Failed to execute replacement: %v", err)
 			continue
 		}
 		executed++
 	}
 	logger.Info("Successfully applied %d text replacements", executed)
 	return fileData, executed
 }
 func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
 	err := m.Validate(len(fileDataStr))
 	if err != nil {
 		return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
 	}
 	logger.Trace("Replace pos %d-%d with %q", m.From, m.To, m.With)
 	return fileDataStr[:m.From] + m.With + fileDataStr[m.To:], nil
 }
 func (m *ReplaceCommand) Validate(maxsize int) error {
 	if m.To < m.From {
 		return fmt.Errorf("command to is less than from: %v", m)
 	}
 	if m.From > maxsize || m.To > maxsize {
 		return fmt.Errorf("command from or to is greater than replacement length: %v", m)
 	}
 	if m.From < 0 || m.To < 0 {
 		return fmt.Errorf("command from or to is less than 0: %v", m)
 	}
 	return nil
 }
--- a/utils/replacecommand_test.go
+++ b/utils/replacecommand_test.go
@@ -0,0 +1,504 @@
 package utils
 import (
 	"testing"
 	"github.com/stretchr/testify/assert"
 )
 func TestReplaceCommandExecute(t *testing.T) {
 	tests := []struct {
 		name        string
 		input       string
 		command     ReplaceCommand
 		expected    string
 		shouldError bool
 	}{
 		{
 			name:        "Simple replacement",
 			input:       "This is a test string",
 			command:     ReplaceCommand{From: 5, To: 7, With: "was"},
 			expected:    "This was a test string",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at beginning",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 5, With: "Hi"},
 			expected:    "Hi world",
 			shouldError: false,
 		},
 		{
 			name:        "Replace at end",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 6, To: 11, With: "everyone"},
 			expected:    "Hello everyone",
 			shouldError: false,
 		},
 		{
 			name:        "Replace entire string",
 			input:       "Hello world",
 			command:     ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
 			expected:    "Goodbye!",
 			shouldError: false,
 		},
 		{
 			name:        "Error: From > To",
 			input:       "Test string",
 			command:     ReplaceCommand{From: 7, To: 5, With: "fail"},
 			expected:    "Test string",
 			shouldError: true,
 		},
 		{
 			name:        "Error: From > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 10, To: 12, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 		{
 			name:        "Error: To > string length",
 			input:       "Test",
 			command:     ReplaceCommand{From: 2, To: 10, With: "fail"},
 			expected:    "Test",
 			shouldError: true,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			result, err := tc.command.Execute(tc.input)
 			if tc.shouldError {
 				if err == nil {
 					t.Errorf("Expected an error for command %+v but got none", tc.command)
 				}
 			} else {
 				if err != nil {
 					t.Errorf("Unexpected error: %v", err)
 				}
 				if result != tc.expected {
 					t.Errorf("Expected %q, got %q", tc.expected, result)
 				}
 			}
 		})
 	}
 }
 func TestExecuteModifications(t *testing.T) {
 	tests := []struct {
 		name          string
 		input         string
 		modifications []ReplaceCommand
 		expected      string
 		expectedCount int
 	}{
 		{
 			name:  "Single modification",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 			},
 			expected:      "Hi world",
 			expectedCount: 1,
 		},
 		{
 			name:  "Multiple modifications",
 			input: "This is a test string",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 4, With: "That"},
 				{From: 8, To: 14, With: "sample"},
 			},
 			expected:      "That is sample string",
 			expectedCount: 2,
 		},
 		{
 			name:  "Overlapping modifications",
 			input: "ABCDEF",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 3, With: "123"}, // ABC -> 123
 				{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
 			},
 			// The actual behavior with the current implementation
 			expected:      "123yzF",
 			expectedCount: 2,
 		},
 		{
 			name:  "Sequential modifications",
 			input: "Hello world",
 			modifications: []ReplaceCommand{
 				{From: 0, To: 5, With: "Hi"},
 				{From: 5, To: 6, With: ""}, // Remove the space
 				{From: 6, To: 11, With: "everyone"},
 			},
 			expected:      "Hieveryone",
 			expectedCount: 3,
 		},
 	}
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
 			// Make a copy of the modifications to avoid modifying the test case
 			mods := make([]ReplaceCommand, len(tc.modifications))
 			copy(mods, tc.modifications)
 			result, count := ExecuteModifications(mods, tc.input)
 			if count != tc.expectedCount {
 				t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
 			}
 			if result != tc.expected {
 				t.Errorf("Expected %q, got %q", tc.expected, result)
 			}
 		})
 	}
 }
 func TestReverseOrderExecution(t *testing.T) {
 	// This test verifies the current behavior of modification application
 	input := "Original text with multiple sections"
 	// Modifications in specific positions
 	modifications := []ReplaceCommand{
 		{From: 0, To: 8, With: "Modified"},  // Original -> Modified
 		{From: 9, To: 13, With: "document"}, // text -> document
 		{From: 14, To: 22, With: "without"}, // with -> without
 		{From: 23, To: 31, With: "any"},     // multiple -> any
 	}
 	// The actual current behavior of our implementation
 	expected := "Modified document withouttanytions"
 	result, count := ExecuteModifications(modifications, input)
 	if count != 4 {
 		t.Errorf("Expected 4 modifications, got %d", count)
 	}
 	if result != expected {
 		t.Errorf("Expected %q, got %q", expected, result)
 	}
 }
 // Replace text in the middle of a string with new content
 func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello replaced, how are you?", result)
 }
 // Replace with empty string (deletion)
 func TestReplaceCommandExecute_DeletesText(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello , how are you?", result)
 }
 // Replace with longer string than original segment
 func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 6,
 		To:   11,
 		With: "longerreplacement",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Hello longerreplacement, how are you?", result)
 }
 // From and To values are the same (zero-length replacement)
 func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   5,
 		With: "inserted",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.NoError(t, err)
 	assert.Equal(t, "Helloinserted world", result)
 }
 // From value is greater than To value
 func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 10,
 		To:   5,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // From or To values exceed string length
 func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: 5,
 		To:   50, // Exceeds the length of the fileContent
 		With: "replaced",
 	}
 	fileContent := "Hello world"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world", result)
 }
 // From or To values are negative
 func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
 	// Arrange
 	cmd := &ReplaceCommand{
 		From: -1,
 		To:   10,
 		With: "replaced",
 	}
 	fileContent := "Hello world, how are you?"
 	// Act
 	result, err := cmd.Execute(fileContent)
 	// Assert
 	assert.Error(t, err)
 	assert.Equal(t, "Hello world, how are you?", result)
 }
 // Modifications are applied in reverse order (from highest to lowest 'From' value)
 func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 4, With: "That"},
 		{From: 10, To: 14, With: "sample"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a sample string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // One or more modifications fail but others succeed
 func TestExecuteModificationsWithPartialFailures(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	// Create a custom ReplaceCommand implementation that will fail
 	failingCommand := ReplaceCommand{
 		From: 15,
 		To:   10, // Invalid range (To < From) to cause failure
 		With: "will fail",
 	}
 	// Valid commands
 	validCommand1 := ReplaceCommand{
 		From: 0,
 		To:   4,
 		With: "That",
 	}
 	validCommand2 := ReplaceCommand{
 		From: 26,
 		To:   38,
 		With: "modifications",
 	}
 	modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "That is a test string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	// Only 2 out of 3 modifications should succeed
 	if executed != 2 {
 		t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
 	}
 }
 // All valid modifications are executed and the modified string is returned
 func TestExecuteModificationsAllValid(t *testing.T) {
 	// Setup test data
 	fileData := "Hello world, this is a test"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 5, With: "Hi"},
 		{From: 18, To: 20, With: "was"},
 		{From: 21, To: 27, With: "an example"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "Hi world, this was an example"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // The count of successfully executed modifications is returned
 func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
 	// Setup test data
 	fileData := "Initial text for testing"
 	modifications := []ReplaceCommand{
 		{From: 0, To: 7, With: "Final"},
 		{From: 12, To: 16, With: "example"},
 		{From: 17, To: 24, With: "process"},
 	}
 	// Execute the function
 	_, executed := ExecuteModifications(modifications, fileData)
 	// Verify the count of executed modifications
 	expectedExecuted := 3
 	if executed != expectedExecuted {
 		t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
 	}
 }
 // Empty modifications list returns the original string with zero executed count
 func TestExecuteModificationsWithEmptyList(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	if result != fileData {
 		t.Errorf("Expected result to be %q, but got %q", fileData, result)
 	}
 	if executed != 0 {
 		t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications with identical 'From' values
 func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
 	// Setup test data
 	fileData := "This is a test string for replacements"
 	modifications := []ReplaceCommand{
 		{From: 10, To: 14, With: "sample"},
 		{From: 10, To: 14, With: "example"},
 		{From: 26, To: 38, With: "modifications"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	// Yes, it's mangled, yes, it's intentional
 	// Every subsequent command works with the modified contents of the previous command
 	// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
 	// So we prepend "example" and end up with "examplele"
 	// Whether sample or example goes first here is irrelevant to us
 	// But it just so happens that sample goes first, so we end up with "examplele"
 	expectedResult := "This is a examplele string for modifications"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
 // Modifications that would affect each other if not sorted properly
 func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
 	// Setup test data
 	fileData := "The quick brown fox jumps over the lazy dog"
 	modifications := []ReplaceCommand{
 		{From: 4, To: 9, With: "slow"},
 		{From: 10, To: 15, With: "red"},
 		{From: 16, To: 19, With: "cat"},
 	}
 	// Execute the function
 	result, executed := ExecuteModifications(modifications, fileData)
 	// Verify results
 	expectedResult := "The slow red cat jumps over the lazy dog"
 	if result != expectedResult {
 		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
 	}
 	if executed != 3 {
 		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
 	}
 }
Author	SHA1	Message	Date
PhatPhuckDave	05bc31aa90	Trim regex to work with yaml pipe	2025-04-01 12:17:42 +02:00
PhatPhuckDave	81d69b8ce0	Force always / Fuck windows and its path fuck windows	2025-04-01 12:15:03 +02:00
PhatPhuckDave	679322a8ac	Fix everything that you broke retard	2025-04-01 12:12:58 +02:00
PhatPhuckDave	2b973be0c1	Add tests for glob butchering	2025-04-01 12:09:29 +02:00
PhatPhuckDave	d21e20d387	Factor out the glob butchery	2025-04-01 12:02:45 +02:00
PhatPhuckDave	0fc5300786	Absolutely butcher globbing to support absolute paths in globs	2025-04-01 11:57:48 +02:00
PhatPhuckDave	4ff2ee80ee	And fix the god damn backslashes fuck windows	2025-04-01 11:29:57 +02:00
PhatPhuckDave	633eebfd2a	Support ~ in globs	2025-04-01 11:29:02 +02:00
PhatPhuckDave	5a31703840	Implement per command logger	2025-03-29 17:29:21 +01:00
PhatPhuckDave	162d0c758d	Fix some tests	2025-03-29 17:29:21 +01:00
PhatPhuckDave	14d64495b6	Add deduplicate flag	2025-03-29 17:29:21 +01:00
PhatPhuckDave	fe6e97e832	Don't deduplicate (yet)	2025-03-29 17:23:21 +01:00
PhatPhuckDave	35b3d8b099	Reduce some of the reads and writes It's really not necessary	2025-03-28 23:39:11 +01:00
PhatPhuckDave	2e3e958e15	Fix some tests and add some logs	2025-03-28 23:31:44 +01:00
PhatPhuckDave	955afc4295	Refactor running commands to separate functions	2025-03-28 16:59:22 +01:00
PhatPhuckDave	2c487bc443	Implement "Isolate" commands Commands that run alone one by one on reading and writing the file This should be used on commands that will modify a large part of the file (or generally large parts) Since that can fuck up the indices of other commands when ran together	2025-03-28 16:56:39 +01:00
PhatPhuckDave	b77224176b	Add file lua value	2025-03-28 16:47:21 +01:00
PhatPhuckDave	a2201053c5	Remove some random ass fmt printf	2025-03-28 13:24:12 +01:00
PhatPhuckDave	04cedf5ece	Fix the concurrent map writes	2025-03-28 11:35:38 +01:00
PhatPhuckDave	ebb07854cc	Memoize the match table	2025-03-28 11:31:27 +01:00
PhatPhuckDave	8a86ae2f40	Add filter flag	2025-03-28 11:20:44 +01:00
PhatPhuckDave	e8f16dda2b	Housekeeping	2025-03-28 02:14:27 +01:00
PhatPhuckDave	513773f641	Again	2025-03-28 01:26:26 +01:00
PhatPhuckDave	22914fe243	Add a lil log	2025-03-28 01:24:23 +01:00
PhatPhuckDave	2d523dfe64	Rename pattern to regex	2025-03-28 01:08:48 +01:00
PhatPhuckDave	2629722f67	Minor fixes and tweaks	2025-03-28 01:03:27 +01:00
PhatPhuckDave	1f6c4e4976	Fix up the tests and some minor bugs	2025-03-28 00:51:26 +01:00
PhatPhuckDave	bfd08e754e	Replace old tests with asserts	2025-03-28 00:40:53 +01:00
PhatPhuckDave	750010b71a	Add more tests to regex	2025-03-28 00:28:51 +01:00
PhatPhuckDave	9064a53820	Add more tests (and fix some things) for replacecommand	2025-03-28 00:23:42 +01:00
PhatPhuckDave	294c04a11a	Add more tests for modifycommand	2025-03-28 00:03:23 +01:00
PhatPhuckDave	ba7ac07001	Fix up the logs a little	2025-03-27 23:36:56 +01:00
PhatPhuckDave	5d10178bf9	Update old and add new tests	2025-03-27 23:33:57 +01:00
PhatPhuckDave	f91c2b4795	More cleaning up	2025-03-27 23:07:22 +01:00
PhatPhuckDave	057db23d09	Implement panic recovery :??	2025-03-27 23:06:46 +01:00
PhatPhuckDave	bf72734b90	Clean up regex.go a little	2025-03-27 23:04:39 +01:00
PhatPhuckDave	cc30c2bdcb	Cleanup	2025-03-27 22:56:42 +01:00
PhatPhuckDave	f453079c72	Fix up regex.go	2025-03-27 22:50:15 +01:00
PhatPhuckDave	e634fe28bd	Clean up processor	2025-03-27 22:24:59 +01:00
PhatPhuckDave	4e4b7bbd19	Implement parallel file processing	2025-03-27 22:22:43 +01:00
PhatPhuckDave	89eed3f847	Refactor git shit to its own module	2025-03-27 22:20:22 +01:00
PhatPhuckDave	f008efd5e1	Refactor modify and replace to their own files	2025-03-27 22:18:12 +01:00
PhatPhuckDave	f6def1e5a5	Refactor entirety of replace command to main for now	2025-03-27 22:11:03 +01:00
PhatPhuckDave	867b188718	Work out file reading and writing	2025-03-27 22:02:36 +01:00
PhatPhuckDave	aac29a4074	Refactor more stuff around	2025-03-27 21:58:52 +01:00
PhatPhuckDave	8a40f463f7	Implement file command association	2025-03-27 21:54:46 +01:00
PhatPhuckDave	8d4db1da91	Clean up code add some log lines and tidy up expandglobs	2025-03-27 21:49:28 +01:00
PhatPhuckDave	d41e2afe17	Update	2025-03-27 21:43:36 +01:00
PhatPhuckDave	76457d22cf	Partially rework reading args to modify command loading	2025-03-27 21:39:16 +01:00
PhatPhuckDave	912950d463	Remove the vestiges of xml and json	2025-03-27 21:31:45 +01:00
PhatPhuckDave	25326ea11b	Remove xml and json They are simply not as useful as regex at all There is nothing they can do regex cannot And they have one massive penalty: the encoding Which often results in MASSIVE diffs	2025-03-27 21:28:20 +01:00
PhatPhuckDave	df212b7fcc	Remove jsonpath and xpath	2025-03-27 21:27:47 +01:00
PhatPhuckDave	f4a963760a	Add dumptable helper function	2025-03-27 20:07:59 +01:00
PhatPhuckDave	d236811cb9	Introduce a new logging level for lua values	2025-03-27 20:06:50 +01:00
PhatPhuckDave	da93770334	Add strsplit lua helper	2025-03-27 19:56:31 +01:00
PhatPhuckDave	d9f54a8354	Fix test again	2025-03-27 19:49:57 +01:00
PhatPhuckDave	dc8da8ab63	Fix overlapping capture groups	2025-03-27 19:43:06 +01:00
PhatPhuckDave	24262a7dca	Remove old unused xml files	2025-03-27 19:31:54 +01:00
PhatPhuckDave	d77b13c363	Update regression test	2025-03-27 19:31:20 +01:00
PhatPhuckDave	a9c60a3698	Neatly align log columns	2025-03-27 19:26:14 +01:00
PhatPhuckDave	66bcf21d79	Add goroutine numbers to log lines	2025-03-27 19:19:39 +01:00
PhatPhuckDave	e847e5c3ce	Make little better logging	2025-03-27 18:53:02 +01:00
PhatPhuckDave	9a70c9696e	Fix logger	2025-03-27 18:46:28 +01:00
		`@@ -1 +0,0 @@`
			`<config><item><value>100</value></item></config>`