Create example yml even when no args are provided

ie. invalid usage

.gitignore

@@ -1 +1,3 @@
 *.exe
+.qodo
+*.sqlite

.vscode/launch.json

@@ -5,16 +5,87 @@
 	"version": "0.2.0",
 	"configurations": [
 		{
-			"name": "Launch Package",
+			"name": "Launch Package (Barotrauma)",
 			"type": "go",
 			"request": "launch",
 			"mode": "auto",
 			"program": "${workspaceFolder}",
 			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
 			"args": [
-				"LightComponent!anyrange=\"(!num)\"",
-				"*4",
-				"**/*.xml"
+				"-loglevel",
+				"trace",
+				"-cook",
+				"*.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Payday 2)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
+			"args": [
+				"-loglevel",
+				"trace",
+				"*.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Barotrauma cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
+			"args": [
+				"-loglevel",
+				"trace",
+				"-cook",
+				"cookassistant.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Quasimorph cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
+			"args": [
+				"cook.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Rimworld cookfile)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
+			"args": [
+				"cookVehicles.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Workspace)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"args": [
+				"tester.yml",
+			]
+		},
+		{
+			"name": "Launch Package (Avorion)",
+			"type": "go",
+			"request": "launch",
+			"mode": "auto",
+			"program": "${workspaceFolder}",
+			"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
+			"args": [
+				"*.yml",
 			]
 		}
 	]

TalentsMechanic.xml

@@ -1,651 +0,0 @@
-<?xml version="1.0" encoding="utf-8"?>
-<Talents>
-  <Talent identifier="powerarmor">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.powerarmor">
-      <Replace tag="[bonusmovement]" value="25" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionHasItem tags="deepdivinglarge" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AddedRecipe itemidentifier="exosuit"/>
-  </Talent>
-  
-  <Talent identifier="foolhardy">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.lowhealthstatboost">
-      <Replace tag="[health]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
-              <Affliction identifier="foolhardy" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-
-  <Talent identifier="berserker">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.lowhealthstatboost">
-      <Replace tag="[health]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
-              <Affliction identifier="berserker" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="mudraptorwrestler">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.mudraptorwrestler">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattypeself">
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData weapontype="NoWeapon,Melee" />
-        <AbilityConditionCharacter>
-          <Conditional group="eq mudraptor" />
-        </AbilityConditionCharacter>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="heavylifting">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.heavylifting">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionHoldingItem tags="alienartifact,crate"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-
-  <Talent identifier="iamthatguy">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.iamthatguy">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.skillbonus">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
-      <Abilities>
-        <CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="heavywrench"/>
-  </Talent>
-  
-  <Talent identifier="robotics">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.robotics"/>
-    <Description tag="talentdescription.roboticsreminder">
-      <Replace tag="[amount]" value="2" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="defensebotspawner"/>
-    <AddedRecipe itemidentifier="defensebotammobox"/>
-  </Talent>
-  
-  <Talent identifier="ironstorm">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.ironstorm">
-      <Replace tag="[chance]" value="10" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="scrapcannon"/>
-  </Talent>
-  
-  <Talent identifier="residualwaste">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.residualwaste">
-      <Replace tag="[chance]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionServerRandom randomChance="0.2"/>
-        <!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
-        <AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="massproduction">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.massproduction">
-      <Replace tag="[chance]" value="40" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
-      <Conditions>
-        <AbilityConditionServerRandom randomChance="0.4" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityRemoveRandomIngredient>
-          <AbilityConditionItem category="Material"/>
-        </CharacterAbilityRemoveRandomIngredient>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="toolmaintenance">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.toolmaintenance">
-      <Replace tag="[amount]" value="1" color="gui.green"/>
-    </Description>
-    <!-- Give once when unlocking the talent -->
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <!-- Give every 60 seconds for late comers -->
-    <AbilityGroupInterval interval="60">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="miner">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
-    <Description tag="talentdescription.miner">
-      <Replace tag="[probability]" value="320" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.gainoredetachspeed">
-      <Replace tag="[amount]" value="1600" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionServerRandom randomchance="12.8"/>
-        <AbilityConditionItem tags="ore"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="retrofit">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.retrofit" />
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="ironman">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="ironhelmet"/>
-    <AddedRecipe itemidentifier="makeshiftarmor"/>
-  </Talent>
-  
-  <Talent identifier="oiledmachinery">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.oiledmachinery">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupInterval interval="60">
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
-        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
-        <CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="pumpndump">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.pumpndump">
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <conditions>
-        <AbilityConditionItem tags="pump"/>
-      </conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="ballastdenizen">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.ballastdenizen">
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="engineengineer">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.engineengineer">
-      <Replace tag="[amount]" value="2.5" color="gui.green"/>
-      <Replace tag="[max]" value="5" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.doesnotstack" />
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="1" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="2" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="3" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="4" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="5" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="6" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel levelequals="7" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
-      </Abilities>
-    </AbilityGroupInterval>
-    <AbilityGroupInterval interval="60">
-      <Conditions>
-        <AbilityConditionHasLevel minlevel="8" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="multifunctional">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.multifunctional">
-      <Replace tag="[powerincrease]" value="50" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData tags="wrenchitem"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnAttack">
-      <Conditions>
-        <AbilityConditionAttackData tags="crowbaritem"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-  
-  <Talent identifier="salvagecrew">
-    <Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.bonusxponmission">
-      <Replace tag="[xpbonus]" value="30" color="gui.green"/>
-      <Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.salvagecrew">
-      <Replace tag="[swimbonus]" value="50" color="gui.green"/>
-      <Replace tag="[resistanceamount]" value="10" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
-      <Conditions>
-        <AbilityConditionMission missiontype="Salvage"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="1.3"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupInterval interval="0.9">
-      <Conditions>
-        <AbilityConditionInSubmarine submarinetype="Wreck" />
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="This" disabledeltatime="true">
-              <Affliction identifier="salvagecrew" amount="1.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupInterval>
-  </Talent>
-  
-  <Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.machinemaniac">
-      <Replace tag="[bonus]" value="80" color="gui.green"/>
-      <Replace tag="[amount]" value="3" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.30">
-      <Replace tag="[requirement]" value="12" color="gui.green"/>
-      <Replace tag="[amount]" value="10" color="gui.green"/>
-      <Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
-      <Replace tag="[xpamount]" value="500" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.50">
-      <Replace tag="[requirement]" value="20" color="gui.green"/>
-      <Replace tag="[level]" value="1" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.machinemaniac.100">
-      <Replace tag="[requirement]" value="40" color="gui.green"/>
-      <Replace tag="[amount]" value="50" color="gui.green"/>
-    </Description>
-
-    <!-- Give the player stats that tracks if the rewards should be given -->
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGiveExperience amount="2000"/>
-        <CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
-        <AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
-        <CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="tinkerer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.increasemaxrepairmechanical">
-      <Replace tag="[percentage]" value="40" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="modularrepairs">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.freeupgrade">
-      <Replace tag="[level]" value="1" color="gui.green"/>
-      <Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="repairpack"/>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
-        <CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
-      </Abilities>
-    </AbilityGroupEffect>
-
-  </Talent>
-
-  <Talent identifier="hullfixer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
-    </Description>
-    <Description tag="talentdescription.additionalstattype">
-      <Replace tag="[amount]" value="25" color="gui.green"/>
-      <Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="fixfoamgrenade"/>
-    <AddedRecipe itemidentifier="handheldstatusmonitor"/>
-  </Talent>
-
-  <Talent identifier="letitdrain">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.letitdrain"/>
-    <Description tag="talentdescription.letitdrainreminder">
-      <Replace tag="[itemcount]" value="2" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
-      </Abilities>
-    </AbilityGroupEffect>
-    <AddedRecipe itemidentifier="portablepump"/>
-  </Talent>
-
-  <Talent identifier="quickfixer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.quickfixer">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[duration]" value="10" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
-              <Affliction identifier="quickfixer" amount="10.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="scrapsavant">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.doublescrapoutput" />
-    <Description tag="talentdescription.findadditionalscrap">
-      <Replace tag="[probability]" value="20" color="gui.green"/>
-    </Description>
-    <AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
-      <Conditions>
-        <AbilityConditionItem tags="scrap"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityModifyValue multiplyvalue="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
-      <Conditions>
-        <AbilityConditionItemInSubmarine submarinetype="Wreck"/>
-        <AbilityConditionItem tags="container"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="UseTarget" >
-              <SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilitySpawnItemsToContainer>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>
-
-  <Talent identifier="safetyfirst">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.unlockrecipe">
-      <Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
-    </Description>
-    <AddedRecipe itemidentifier="safetyharness"/>
-  </Talent>
-
-</Talents>

cmd/log_format_test/main.go

@@ -1,8 +1,9 @@
 package main
 
 import (
-	"modify/logger"
 	"time"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 
 func main() {

glob_test.go

@@ -1,6 +1,7 @@
 package main
 
 import (
+	"cook/utils"
 	"os"
 	"path/filepath"
 	"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
 
 	for _, tc := range tests {
 		t.Run(tc.name, func(t *testing.T) {
-			files, err := expandFilePatterns(tc.patterns)
+			// Convert string patterns to map[string]struct{} for ExpandGLobs
+			patternMap := make(map[string]struct{})
+			for _, pattern := range tc.patterns {
+				patternMap[pattern] = struct{}{}
+			}
+			files, err := utils.ExpandGLobs(patternMap)
 			if err != nil {
-				t.Fatalf("expandFilePatterns failed: %v", err)
+				t.Fatalf("ExpandGLobs failed: %v", err)
 			}
 
 			if len(files) != tc.expected {

go.mod

@@ -1,39 +1,32 @@
-module modify
+module cook
 
-go 1.24.1
+go 1.23.2
 
 require (
-	github.com/PaesslerAG/jsonpath v0.1.1
-	github.com/antchfx/xmlquery v1.4.4
+	git.site.quack-lab.dev/dave/cylogger v1.3.0
 	github.com/bmatcuk/doublestar/v4 v4.8.1
+	github.com/stretchr/testify v1.10.0
 	github.com/yuin/gopher-lua v1.1.1
+	gopkg.in/yaml.v3 v3.0.1
+	gorm.io/gorm v1.30.0
 )
 
 require (
-	dario.cat/mergo v1.0.0 // indirect
-	github.com/Microsoft/go-winio v0.6.2 // indirect
-	github.com/ProtonMail/go-crypto v1.1.5 // indirect
-	github.com/cloudflare/circl v1.6.0 // indirect
-	github.com/cyphar/filepath-securejoin v0.4.1 // indirect
-	github.com/emirpasic/gods v1.18.1 // indirect
-	github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
-	github.com/go-git/go-billy/v5 v5.6.2 // indirect
-	github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect
-	github.com/kevinburke/ssh_config v1.2.0 // indirect
-	github.com/pjbgf/sha1cd v0.3.2 // indirect
-	github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect
-	github.com/skeema/knownhosts v1.3.1 // indirect
-	github.com/xanzy/ssh-agent v0.3.3 // indirect
-	golang.org/x/crypto v0.35.0 // indirect
-	golang.org/x/sys v0.30.0 // indirect
-	gopkg.in/warnings.v0 v0.1.2 // indirect
-)
-
-require (
-	github.com/PaesslerAG/gval v1.0.0 // indirect
-	github.com/antchfx/xpath v1.3.3 // indirect
-	github.com/go-git/go-git/v5 v5.14.0
-	github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect
-	golang.org/x/net v0.35.0 // indirect
+	github.com/davecgh/go-spew v1.1.1 // indirect
+	github.com/google/go-cmp v0.6.0 // indirect
+	github.com/hexops/valast v1.5.0 // indirect
+	github.com/jinzhu/inflection v1.0.0 // indirect
+	github.com/jinzhu/now v1.1.5 // indirect
+	github.com/kr/pretty v0.3.1 // indirect
+	github.com/mattn/go-sqlite3 v1.14.22 // indirect
+	github.com/pmezard/go-difflib v1.0.0 // indirect
+	github.com/rogpeppe/go-internal v1.14.1 // indirect
+	golang.org/x/mod v0.21.0 // indirect
+	golang.org/x/sync v0.11.0 // indirect
 	golang.org/x/text v0.22.0 // indirect
+	golang.org/x/tools v0.26.0 // indirect
+	gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
+	mvdan.cc/gofumpt v0.4.0 // indirect
 )
+
+require gorm.io/driver/sqlite v1.6.0

go.sum

@@ -1,177 +1,59 @@
-dario.cat/mergo v1.0.0 h1:AGCNq9Evsj31mOgNPcLyXc+4PNABt905YmuqPYYpBWk=
-dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk=
-github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY=
-github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY=
-github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU=
-github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
-github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
-github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
-github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
-github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
-github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4=
-github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE=
-github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8=
-github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4=
-github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
-github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
-github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
-github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
-github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio=
-github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs=
+git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw=
+git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk=
 github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
 github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
-github.com/cloudflare/circl v1.6.0 h1:cr5JKic4HI+LkINy2lg3W2jF8sHCVTBncJr5gIIq7qk=
-github.com/cloudflare/circl v1.6.0/go.mod h1:uddAzsPgqdMAYatqJ0lsjX1oECcQLIlRpzZh3pJrofs=
-github.com/cyphar/filepath-securejoin v0.4.1 h1:JyxxyPEaktOD+GAnqIqTf9A8tHyAG22rowi7HkoSU1s=
-github.com/cyphar/filepath-securejoin v0.4.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI=
-github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
+github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
 github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
 github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
-github.com/elazarl/goproxy v1.7.2 h1:Y2o6urb7Eule09PjlhQRGNsqRfPmYI3KKQLFpCAV3+o=
-github.com/elazarl/goproxy v1.7.2/go.mod h1:82vkLNir0ALaW14Rc399OTTjyNREgmdL2cVoIbS6XaE=
-github.com/emirpasic/gods v1.18.1 h1:FXtiHYKDGKCW2KzwZKx0iC0PQmdlorYgdFG9jPXJ1Bc=
-github.com/emirpasic/gods v1.18.1/go.mod h1:8tpGGwCnJ5H4r6BWwaV6OrWmMoPhUl5jm/FMNAnJvWQ=
-github.com/gliderlabs/ssh v0.3.8 h1:a4YXD1V7xMF9g5nTkdfnja3Sxy1PVDCj1Zg4Wb8vY6c=
-github.com/gliderlabs/ssh v0.3.8/go.mod h1:xYoytBv1sV0aL3CavoDuJIQNURXkkfPA/wxQ1pL1fAU=
-github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI=
-github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic=
-github.com/go-git/go-billy/v5 v5.6.2 h1:6Q86EsPXMa7c3YZ3aLAQsMA0VlWmy43r6FHqa/UNbRM=
-github.com/go-git/go-billy/v5 v5.6.2/go.mod h1:rcFC2rAsp/erv7CMz9GczHcuD0D32fWzH+MJAU+jaUU=
-github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4=
-github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
-github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60=
-github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k=
-github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
-github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ=
-github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw=
+github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE=
+github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps=
+github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
 github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
-github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8=
-github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU=
-github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A=
-github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99/go.mod h1:1lJo3i6rXxKeerYnT8Nvf0QmHCRC1n8sfWVwXF2Frvo=
-github.com/kevinburke/ssh_config v1.2.0 h1:x584FjTGwHzMwvHx18PXxbBVzfnxogHaAReU4gf13a4=
-github.com/kevinburke/ssh_config v1.2.0/go.mod h1:CT57kijsi8u/K/BOFA39wgDQJ9CxiF4nAY/ojJ6r6mM=
-github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
+github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM=
+github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
+github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
+github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
+github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
+github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
+github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
+github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
+github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
+github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
+github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
 github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
 github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
 github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
 github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
 github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
 github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
-github.com/onsi/gomega v1.34.1 h1:EUMJIKUjM8sKjYbtxQI9A4z2o+rruxnzNvpknOXie6k=
-github.com/onsi/gomega v1.34.1/go.mod h1:kU1QgUvBDLXBJq618Xvm2LUX6rSAfRaFRTcdOeDLwwY=
-github.com/pjbgf/sha1cd v0.3.2 h1:a9wb0bp1oC2TGwStyn0Umc/IGKQnEgF0vVaZ8QF8eo4=
-github.com/pjbgf/sha1cd v0.3.2/go.mod h1:zQWigSxVmsHEZow5qaLtPYxpcKMMQpa09ixqBxuCS6A=
-github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
-github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
+github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
+github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
+github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
 github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
 github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
+github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs=
 github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
 github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
-github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 h1:n661drycOFuPLCN3Uc8sB6B/s6Z4t2xvBgU1htSHuq8=
-github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3/go.mod h1:A0bzQcvG0E7Rwjx0REVgAGH58e96+X0MeOfepqsbeW4=
-github.com/sirupsen/logrus v1.7.0/go.mod h1:yWOB1SBYBC5VeMP7gHvWumXLIWorT60ONWic61uBYv0=
-github.com/skeema/knownhosts v1.3.1 h1:X2osQ+RAjK76shCbvhHHHVl3ZlgDm8apHEHFqRjnBY8=
-github.com/skeema/knownhosts v1.3.1/go.mod h1:r7KTdC8l4uxWRyK2TpQZ/1o5HaSzh06ePQNxPwTcfiY=
-github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
-github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
-github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
 github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
 github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
-github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM=
-github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw=
-github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
 github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
 github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
-golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
-golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
-golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
-golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
-golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
-golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
-golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
-golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs=
-golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ=
-golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8=
-golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY=
-golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
-golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
-golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
-golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
-golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
-golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
-golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
-golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
-golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
-golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
-golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
-golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
-golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
-golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
-golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
-golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
-golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
-golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
-golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
-golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
-golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
-golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
-golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
-golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
-golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
-golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
-golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
-golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
-golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
-golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc=
-golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
-golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
-golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
-golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
-golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
-golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
-golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
-golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
-golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
-golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
-golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU=
-golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s=
-golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
-golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
-golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
-golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
-golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
-golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
-golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
-golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
-golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
-golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
+golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0=
+golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY=
+golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w=
+golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
 golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
 golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
-golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
-golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
-golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
-golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
-golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
-golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
-golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
+golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ=
+golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0=
 gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
-gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
 gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
 gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
-gopkg.in/warnings.v0 v0.1.2 h1:wFXVbFY8DY5/xOe1ECiWdKCzZlxgshcYVNkBHstARME=
-gopkg.in/warnings.v0 v0.1.2/go.mod h1:jksf8JmL6Qr/oQM2OXTHunEvvTAsrWBLb6OOjuVWRNI=
-gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
-gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
 gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
 gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
+gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
+gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
+gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
+gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
+mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
+mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=

logger/logger.go

@@ -1,445 +0,0 @@
-package logger
-
-import (
-	"bytes"
-	"fmt"
-	"io"
-	"log"
-	"os"
-	"path/filepath"
-	"runtime"
-	"strconv"
-	"strings"
-	"sync"
-	"time"
-)
-
-// LogLevel defines the severity of log messages
-type LogLevel int
-
-const (
-	// LevelError is for critical errors that should always be displayed
-	LevelError LogLevel = iota
-	// LevelWarning is for important warnings
-	LevelWarning
-	// LevelInfo is for informational messages
-	LevelInfo
-	// LevelDebug is for detailed debugging information
-	LevelDebug
-	// LevelTrace is for very detailed tracing information
-	LevelTrace
-)
-
-var levelNames = map[LogLevel]string{
-	LevelError:   "ERROR",
-	LevelWarning: "WARNING",
-	LevelInfo:    "INFO",
-	LevelDebug:   "DEBUG",
-	LevelTrace:   "TRACE",
-}
-
-var levelColors = map[LogLevel]string{
-	LevelError:   "\033[1;31m", // Bold Red
-	LevelWarning: "\033[1;33m", // Bold Yellow
-	LevelInfo:    "\033[1;32m", // Bold Green
-	LevelDebug:   "\033[1;36m", // Bold Cyan
-	LevelTrace:   "\033[1;35m", // Bold Magenta
-}
-
-// ResetColor is the ANSI code to reset text color
-const ResetColor = "\033[0m"
-
-// Logger is our custom logger with level support
-type Logger struct {
-	mu            sync.Mutex
-	out           io.Writer
-	currentLevel  LogLevel
-	prefix        string
-	flag          int
-	useColors     bool
-	callerOffset  int
-	defaultFields map[string]interface{}
-	showGoroutine bool
-}
-
-var (
-	// DefaultLogger is the global logger instance
-	DefaultLogger *Logger
-	// defaultLogLevel is the default log level if not specified
-	defaultLogLevel = LevelInfo
-	// Global mutex for DefaultLogger initialization
-	initMutex sync.Mutex
-)
-
-// ParseLevel converts a string log level to LogLevel
-func ParseLevel(levelStr string) LogLevel {
-	switch strings.ToUpper(levelStr) {
-	case "ERROR":
-		return LevelError
-	case "WARNING", "WARN":
-		return LevelWarning
-	case "INFO":
-		return LevelInfo
-	case "DEBUG":
-		return LevelDebug
-	case "TRACE":
-		return LevelTrace
-	default:
-		return defaultLogLevel
-	}
-}
-
-// String returns the string representation of the log level
-func (l LogLevel) String() string {
-	if name, ok := levelNames[l]; ok {
-		return name
-	}
-	return fmt.Sprintf("Level(%d)", l)
-}
-
-// New creates a new Logger instance
-func New(out io.Writer, prefix string, flag int) *Logger {
-	return &Logger{
-		out:           out,
-		currentLevel:  defaultLogLevel,
-		prefix:        prefix,
-		flag:          flag,
-		useColors:     true,
-		callerOffset:  0,
-		defaultFields: make(map[string]interface{}),
-		showGoroutine: true,
-	}
-}
-
-// Init initializes the DefaultLogger
-func Init(level LogLevel) {
-	initMutex.Lock()
-	defer initMutex.Unlock()
-
-	if DefaultLogger == nil {
-		DefaultLogger = New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
-	}
-	DefaultLogger.SetLevel(level)
-}
-
-// SetLevel sets the current log level
-func (l *Logger) SetLevel(level LogLevel) {
-	l.mu.Lock()
-	defer l.mu.Unlock()
-	l.currentLevel = level
-}
-
-// GetLevel returns the current log level
-func (l *Logger) GetLevel() LogLevel {
-	l.mu.Lock()
-	defer l.mu.Unlock()
-	return l.currentLevel
-}
-
-// SetCallerOffset sets the caller offset for correct file and line reporting
-func (l *Logger) SetCallerOffset(offset int) {
-	l.mu.Lock()
-	defer l.mu.Unlock()
-	l.callerOffset = offset
-}
-
-// SetShowGoroutine sets whether to include goroutine ID in log messages
-func (l *Logger) SetShowGoroutine(show bool) {
-	l.mu.Lock()
-	defer l.mu.Unlock()
-	l.showGoroutine = show
-}
-
-// ShowGoroutine returns whether goroutine ID is included in log messages
-func (l *Logger) ShowGoroutine() bool {
-	l.mu.Lock()
-	defer l.mu.Unlock()
-	return l.showGoroutine
-}
-
-// WithField adds a field to the logger's context
-func (l *Logger) WithField(key string, value interface{}) *Logger {
-	newLogger := &Logger{
-		out:           l.out,
-		currentLevel:  l.currentLevel,
-		prefix:        l.prefix,
-		flag:          l.flag,
-		useColors:     l.useColors,
-		callerOffset:  l.callerOffset,
-		defaultFields: make(map[string]interface{}),
-		showGoroutine: l.showGoroutine,
-	}
-
-	// Copy existing fields
-	for k, v := range l.defaultFields {
-		newLogger.defaultFields[k] = v
-	}
-
-	// Add new field
-	newLogger.defaultFields[key] = value
-	return newLogger
-}
-
-// WithFields adds multiple fields to the logger's context
-func (l *Logger) WithFields(fields map[string]interface{}) *Logger {
-	newLogger := &Logger{
-		out:           l.out,
-		currentLevel:  l.currentLevel,
-		prefix:        l.prefix,
-		flag:          l.flag,
-		useColors:     l.useColors,
-		callerOffset:  l.callerOffset,
-		defaultFields: make(map[string]interface{}),
-		showGoroutine: l.showGoroutine,
-	}
-
-	// Copy existing fields
-	for k, v := range l.defaultFields {
-		newLogger.defaultFields[k] = v
-	}
-
-	// Add new fields
-	for k, v := range fields {
-		newLogger.defaultFields[k] = v
-	}
-	return newLogger
-}
-
-// GetGoroutineID extracts the goroutine ID from the runtime stack
-func GetGoroutineID() string {
-	buf := make([]byte, 64)
-	n := runtime.Stack(buf, false)
-	// Format of first line is "goroutine N [state]:"
-	// We only need the N part
-	buf = buf[:n]
-	idField := bytes.Fields(bytes.Split(buf, []byte{':'})[0])[1]
-	return string(idField)
-}
-
-// formatMessage formats a log message with level, time, file, and line information
-func (l *Logger) formatMessage(level LogLevel, format string, args ...interface{}) string {
-	var msg string
-	if len(args) > 0 {
-		msg = fmt.Sprintf(format, args...)
-	} else {
-		msg = format
-	}
-
-	// Format default fields if any
-	var fields string
-	if len(l.defaultFields) > 0 {
-		var pairs []string
-		for k, v := range l.defaultFields {
-			pairs = append(pairs, fmt.Sprintf("%s=%v", k, v))
-		}
-		fields = " " + strings.Join(pairs, " ")
-	}
-
-	var levelColor, resetColor string
-	if l.useColors {
-		levelColor = levelColors[level]
-		resetColor = ResetColor
-	}
-
-	var caller string
-	if l.flag&log.Lshortfile != 0 || l.flag&log.Llongfile != 0 {
-		// Find the actual caller by scanning up the stack
-		// until we find a function outside the logger package
-		var file string
-		var line int
-		var ok bool
-
-		// Start at a reasonable depth and scan up to 10 frames
-		for depth := 4; depth < 15; depth++ {
-			_, file, line, ok = runtime.Caller(depth)
-			if !ok {
-				break
-			}
-
-			// If the caller is not in the logger package, we found our caller
-			if !strings.Contains(file, "logger/logger.go") {
-				break
-			}
-		}
-
-		if !ok {
-			file = "???"
-			line = 0
-		}
-
-		if l.flag&log.Lshortfile != 0 {
-			file = filepath.Base(file)
-		}
-		caller = fmt.Sprintf("%-25s ", file+":"+strconv.Itoa(line))
-	}
-
-	// Format the timestamp with fixed width
-	var timeStr string
-	if l.flag&(log.Ldate|log.Ltime|log.Lmicroseconds) != 0 {
-		t := time.Now()
-		if l.flag&log.Ldate != 0 {
-			timeStr += fmt.Sprintf("%04d/%02d/%02d ", t.Year(), t.Month(), t.Day())
-		}
-		if l.flag&(log.Ltime|log.Lmicroseconds) != 0 {
-			timeStr += fmt.Sprintf("%02d:%02d:%02d", t.Hour(), t.Minute(), t.Second())
-			if l.flag&log.Lmicroseconds != 0 {
-				timeStr += fmt.Sprintf(".%06d", t.Nanosecond()/1000)
-			}
-		}
-		timeStr = fmt.Sprintf("%-15s ", timeStr)
-	}
-
-	// Add goroutine ID if enabled, with fixed width
-	var goroutineStr string
-	if l.showGoroutine {
-		goroutineID := GetGoroutineID()
-		goroutineStr = fmt.Sprintf("[g:%-4s] ", goroutineID)
-	}
-
-	// Create a colored level indicator with both brackets colored
-	levelStr := fmt.Sprintf("%s[%s]%s", levelColor, levelNames[level], levelColor)
-	// Add a space after the level and before the reset color
-	levelColumn := fmt.Sprintf("%s %s", levelStr, resetColor)
-
-	return fmt.Sprintf("%s%s%s%s%s%s%s\n",
-		l.prefix, timeStr, caller, goroutineStr, levelColumn, msg, fields)
-}
-
-// log logs a message at the specified level
-func (l *Logger) log(level LogLevel, format string, args ...interface{}) {
-	if level > l.currentLevel {
-		return
-	}
-
-	l.mu.Lock()
-	defer l.mu.Unlock()
-
-	msg := l.formatMessage(level, format, args...)
-	fmt.Fprint(l.out, msg)
-}
-
-// Error logs an error message
-func (l *Logger) Error(format string, args ...interface{}) {
-	l.log(LevelError, format, args...)
-}
-
-// Warning logs a warning message
-func (l *Logger) Warning(format string, args ...interface{}) {
-	l.log(LevelWarning, format, args...)
-}
-
-// Info logs an informational message
-func (l *Logger) Info(format string, args ...interface{}) {
-	l.log(LevelInfo, format, args...)
-}
-
-// Debug logs a debug message
-func (l *Logger) Debug(format string, args ...interface{}) {
-	l.log(LevelDebug, format, args...)
-}
-
-// Trace logs a trace message
-func (l *Logger) Trace(format string, args ...interface{}) {
-	l.log(LevelTrace, format, args...)
-}
-
-// Global log functions that use DefaultLogger
-
-// Error logs an error message using the default logger
-func Error(format string, args ...interface{}) {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	DefaultLogger.Error(format, args...)
-}
-
-// Warning logs a warning message using the default logger
-func Warning(format string, args ...interface{}) {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	DefaultLogger.Warning(format, args...)
-}
-
-// Info logs an informational message using the default logger
-func Info(format string, args ...interface{}) {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	DefaultLogger.Info(format, args...)
-}
-
-// Debug logs a debug message using the default logger
-func Debug(format string, args ...interface{}) {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	DefaultLogger.Debug(format, args...)
-}
-
-// Trace logs a trace message using the default logger
-func Trace(format string, args ...interface{}) {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	DefaultLogger.Trace(format, args...)
-}
-
-// LogPanic logs a panic error and its stack trace
-func LogPanic(r interface{}) {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	stack := make([]byte, 4096)
-	n := runtime.Stack(stack, false)
-	DefaultLogger.Error("PANIC: %v\n%s", r, stack[:n])
-}
-
-// SetLevel sets the log level for the default logger
-func SetLevel(level LogLevel) {
-	if DefaultLogger == nil {
-		Init(level)
-		return
-	}
-	DefaultLogger.SetLevel(level)
-}
-
-// GetLevel gets the log level for the default logger
-func GetLevel() LogLevel {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	return DefaultLogger.GetLevel()
-}
-
-// WithField returns a new logger with the field added to the default logger's context
-func WithField(key string, value interface{}) *Logger {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	return DefaultLogger.WithField(key, value)
-}
-
-// WithFields returns a new logger with the fields added to the default logger's context
-func WithFields(fields map[string]interface{}) *Logger {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	return DefaultLogger.WithFields(fields)
-}
-
-// SetShowGoroutine enables or disables goroutine ID display in the default logger
-func SetShowGoroutine(show bool) {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	DefaultLogger.SetShowGoroutine(show)
-}
-
-// ShowGoroutine returns whether goroutine ID is included in default logger's messages
-func ShowGoroutine() bool {
-	if DefaultLogger == nil {
-		Init(defaultLogLevel)
-	}
-	return DefaultLogger.ShowGoroutine()
-}

logger/panic_handler.go

@@ -1,49 +0,0 @@
-package logger
-
-import (
-	"fmt"
-	"runtime/debug"
-)
-
-// PanicHandler handles a panic and logs it
-func PanicHandler() {
-	if r := recover(); r != nil {
-		goroutineID := GetGoroutineID()
-		stackTrace := debug.Stack()
-		Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
-	}
-}
-
-// SafeGo launches a goroutine with panic recovery
-// Usage: logger.SafeGo(func() { ... your code ... })
-func SafeGo(f func()) {
-	go func() {
-		defer PanicHandler()
-		f()
-	}()
-}
-
-// SafeGoWithArgs launches a goroutine with panic recovery and passes arguments
-// Usage: logger.SafeGoWithArgs(func(arg1, arg2 interface{}) { ... }, "value1", 42)
-func SafeGoWithArgs(f func(...interface{}), args ...interface{}) {
-	go func() {
-		defer PanicHandler()
-		f(args...)
-	}()
-}
-
-// SafeExec executes a function with panic recovery
-// Useful for code that should not panic
-func SafeExec(f func()) (err error) {
-	defer func() {
-		if r := recover(); r != nil {
-			goroutineID := GetGoroutineID()
-			stackTrace := debug.Stack()
-			Error("PANIC in goroutine %s: %v\n%s", goroutineID, r, stackTrace)
-			err = fmt.Errorf("panic recovered: %v", r)
-		}
-	}()
-
-	f()
-	return nil
-}

main.go

@@ -3,337 +3,419 @@ package main
 import (
 	"flag"
 	"fmt"
-	"log"
 	"os"
-	"path/filepath"
+	"sort"
 	"sync"
 	"time"
 
-	"github.com/bmatcuk/doublestar/v4"
-	"github.com/go-git/go-git/v5"
-	"github.com/go-git/go-git/v5/plumbing/object"
+	"cook/processor"
+	"cook/utils"
 
-	"modify/logger"
-	"modify/processor"
+	"gopkg.in/yaml.v3"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 
 type GlobalStats struct {
-	TotalMatches       int
-	TotalModifications int
-	ProcessedFiles     int
-	FailedFiles        int
+	TotalMatches            int
+	TotalModifications      int
+	ProcessedFiles          int
+	FailedFiles             int
+	ModificationsPerCommand sync.Map
 }
 
-var stats GlobalStats
-var stdLogger *log.Logger // Legacy logger for compatibility
-
 var (
-	jsonFlag  = flag.Bool("json", false, "Process JSON files")
-	xmlFlag   = flag.Bool("xml", false, "Process XML files")
-	gitFlag   = flag.Bool("git", false, "Use git to manage files")
-	resetFlag = flag.Bool("reset", false, "Reset files to their original state")
-	logLevel  = flag.String("loglevel", "INFO", "Set log level: ERROR, WARNING, INFO, DEBUG, TRACE")
-	repo      *git.Repository
-	worktree  *git.Worktree
+	stats GlobalStats = GlobalStats{
+		ModificationsPerCommand: sync.Map{},
+	}
 )
 
-func init() {
-	// Keep standard logger setup for compatibility with legacy code
-	log.SetFlags(log.Lmicroseconds | log.Lshortfile)
-	stdLogger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
-
-	stats = GlobalStats{}
-}
-
 func main() {
-	// TODO: Implement some sort of git integration
-	// Maybe use go-git
-	// Specify a -git flag
-	// If we are operating with git then:
-	// Inmitialize a repo if one doesn't exist (try to open right?)
-	// For each file matched by glob first figure out if it's already tracked
-	// If not tracked then track it and commit (either it alone or maybe multiple together somehow)
-	// Then reset the file (to undo previous modifications)
-	// THEN change the file
-	// In addition add a -undo flag that will ONLY reset the files without changing them
-	// Only for the ones matched by glob
-	// ^ important because binary files would fuck us up
 	flag.Usage = func() {
+		CreateExampleConfig()
 		fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nOptions:\n")
-		fmt.Fprintf(os.Stderr, "  -json\n")
-		fmt.Fprintf(os.Stderr, "        Process JSON files\n")
-		fmt.Fprintf(os.Stderr, "  -xml\n")
-		fmt.Fprintf(os.Stderr, "        Process XML files\n")
-		fmt.Fprintf(os.Stderr, "  -git\n")
-		fmt.Fprintf(os.Stderr, "        Use git to manage files\n")
 		fmt.Fprintf(os.Stderr, "  -reset\n")
 		fmt.Fprintf(os.Stderr, "        Reset files to their original state\n")
 		fmt.Fprintf(os.Stderr, "  -loglevel string\n")
 		fmt.Fprintf(os.Stderr, "        Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE (default \"INFO\")\n")
-		fmt.Fprintf(os.Stderr, "  -mode string\n")
-		fmt.Fprintf(os.Stderr, "        Processing mode: regex, xml, json (default \"regex\")\n")
 		fmt.Fprintf(os.Stderr, "\nExamples:\n")
 		fmt.Fprintf(os.Stderr, "  Regex mode (default):\n")
 		fmt.Fprintf(os.Stderr, "    %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
-		fmt.Fprintf(os.Stderr, "  XML mode:\n")
-		fmt.Fprintf(os.Stderr, "    %s -xml \"//value\" \"*1.5\" data.xml\n", os.Args[0])
-		fmt.Fprintf(os.Stderr, "  JSON mode:\n")
-		fmt.Fprintf(os.Stderr, "    %s -json \"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
 		fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
 		fmt.Fprintf(os.Stderr, "      s1, s2, etc. are used to refer to capture groups as strings.\n")
 		fmt.Fprintf(os.Stderr, "      Helper functions: num(str) converts string to number, str(num) converts number to string\n")
 		fmt.Fprintf(os.Stderr, "      is_number(str) checks if a string is numeric\n")
-		fmt.Fprintf(os.Stderr, "      For XML and JSON, the captured values are exposed as 'v', which can be of any type we capture (string, number, table).\n")
 		fmt.Fprintf(os.Stderr, "      If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n")
 		fmt.Fprintf(os.Stderr, "      You can use any valid Lua code, including if statements, loops, etc.\n")
 		fmt.Fprintf(os.Stderr, "      Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
 	}
-
+	// TODO: Fix bed shitting when doing *.yml in barotrauma directory
 	flag.Parse()
-
-	// Initialize logger with the specified log level
-	level := logger.ParseLevel(*logLevel)
-	logger.Init(level)
-	logger.Info("Initializing with log level: %s", level.String())
-
 	args := flag.Args()
-	if *resetFlag {
-		*gitFlag = true
-	}
 
-	if len(args) < 3 {
-		logger.Error("At least %d arguments are required", 3)
+	logger.InitFlag()
+	logger.Info("Initializing with log level: %s", logger.GetLevel().String())
+
+	if flag.NArg() == 0 {
 		flag.Usage()
 		return
 	}
 
-	// Get the appropriate pattern and expression based on mode
-	var pattern, luaExpr string
-	var filePatterns []string
-
-	pattern = args[0]
-	luaExpr = args[1]
-	filePatterns = args[2:]
-
-	// Prepare the Lua expression
-	originalLuaExpr := luaExpr
-	luaExpr = processor.BuildLuaScript(luaExpr)
-	if originalLuaExpr != luaExpr {
-		logger.Debug("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
+	db, err := utils.GetDB()
+	if err != nil {
+		logger.Error("Failed to get database: %v", err)
+		return
 	}
 
-	if *gitFlag {
-		logger.Info("Git integration enabled, setting up git repository")
-		err := setupGit()
-		if err != nil {
-			logger.Error("Failed to setup git: %v", err)
-			fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
-			return
-		}
+	workdone, err := HandleSpecialArgs(args, err, db)
+	if err != nil {
+		logger.Error("Failed to handle special args: %v", err)
+		return
+	}
+	if workdone {
+		return
 	}
 
-	// Expand file patterns with glob support
-	logger.Debug("Expanding file patterns: %v", filePatterns)
-	files, err := expandFilePatterns(filePatterns)
+	// The plan is:
+	// Load all commands
+	commands, err := utils.LoadCommands(args)
+	if err != nil || len(commands) == 0 {
+		logger.Error("Failed to load commands: %v", err)
+		flag.Usage()
+		return
+	}
+
+	if *utils.Filter != "" {
+		logger.Info("Filtering commands by name: %s", *utils.Filter)
+		commands = utils.FilterCommands(commands, *utils.Filter)
+		logger.Info("Filtered %d commands", len(commands))
+	}
+
+	// Then aggregate all the globs and deduplicate them
+	globs := utils.AggregateGlobs(commands)
+	logger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
+
+	for _, command := range commands {
+		logger.Trace("Command: %s", command.Name)
+		logger.Trace("Regex: %s", command.Regex)
+		logger.Trace("Files: %v", command.Files)
+		logger.Trace("Lua: %s", command.Lua)
+		logger.Trace("Reset: %t", command.Reset)
+		logger.Trace("Isolate: %t", command.Isolate)
+		logger.Trace("LogLevel: %s", command.LogLevel)
+	}
+
+	// Resolve all the files for all the globs
+	logger.Info("Found %d unique file patterns", len(globs))
+	files, err := utils.ExpandGLobs(globs)
 	if err != nil {
 		logger.Error("Failed to expand file patterns: %v", err)
-		fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
+		return
+	}
+	logger.Info("Found %d files to process", len(files))
+
+	// Somehow connect files to commands via globs..
+	// For each file check every glob of every command
+	// Maybe memoize this part
+	// That way we know what commands affect what files
+	associations, err := utils.AssociateFilesWithCommands(files, commands)
+	if err != nil {
+		logger.Error("Failed to associate files with commands: %v", err)
 		return
 	}
 
-	if len(files) == 0 {
-		logger.Warning("No files found matching the specified patterns")
-		fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
+	err = utils.ResetWhereNecessary(associations, db)
+	if err != nil {
+		logger.Error("Failed to reset files where necessary: %v", err)
 		return
 	}
 
-	if *gitFlag {
-		logger.Info("Cleaning up git files before processing")
-		err := cleanupGitFiles(files)
-		if err != nil {
-			logger.Error("Failed to cleanup git files: %v", err)
-			fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
-			return
+	// Then for each file run all commands associated with the file
+	workers := make(chan struct{}, *utils.ParallelFiles)
+	wg := sync.WaitGroup{}
+
+	// Add performance tracking
+	startTime := time.Now()
+	var fileMutex sync.Mutex
+
+	// Create a map to store loggers for each command
+	commandLoggers := make(map[string]*logger.Logger)
+	for _, command := range commands {
+		// Create a named logger for each command
+		cmdName := command.Name
+		if cmdName == "" {
+			// If no name is provided, use a short version of the regex pattern
+			if len(command.Regex) > 20 {
+				cmdName = command.Regex[:17] + "..."
+			} else {
+				cmdName = command.Regex
+			}
 		}
-	}
-	if *resetFlag {
-		logger.Info("Files reset to their original state, nothing more to do")
-		log.Printf("Files reset to their original state, nothing more to do")
-		return
+
+		// Parse the log level for this specific command
+		cmdLogLevel := logger.ParseLevel(command.LogLevel)
+
+		// Create a logger with the command name as a field
+		commandLoggers[command.Name] = logger.WithField("command", cmdName)
+		commandLoggers[command.Name].SetLevel(cmdLogLevel)
+
+		logger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
 	}
 
-	// Create the processor based on mode
-	var proc processor.Processor
-	switch {
-	case *xmlFlag:
-		proc = &processor.XMLProcessor{}
-		logger.Info("Starting XML modifier with XPath %q, expression %q on %d files",
-			pattern, luaExpr, len(files))
-	case *jsonFlag:
-		proc = &processor.JSONProcessor{}
-		logger.Info("Starting JSON modifier with JSONPath %q, expression %q on %d files",
-			pattern, luaExpr, len(files))
-	default:
-		proc = &processor.RegexProcessor{}
-		logger.Info("Starting regex modifier with pattern %q, expression %q on %d files",
-			pattern, luaExpr, len(files))
-	}
-
-	var wg sync.WaitGroup
-	// Process each file
-	for _, file := range files {
+	for file, association := range associations {
+		workers <- struct{}{}
 		wg.Add(1)
 		logger.SafeGoWithArgs(func(args ...interface{}) {
+			defer func() { <-workers }()
 			defer wg.Done()
-			fileToProcess := args[0].(string)
-			logger.Debug("Processing file: %s", fileToProcess)
+			// Track per-file processing time
+			fileStartTime := time.Now()
 
-			// It's a bit fucked, maybe I could do better to call it from proc... But it'll do for now
-			modCount, matchCount, err := processor.Process(proc, fileToProcess, pattern, luaExpr)
+			logger.Debug("Reading file %q", file)
+			fileData, err := os.ReadFile(file)
 			if err != nil {
-				logger.Error("Failed to process file %s: %v", fileToProcess, err)
-				fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", fileToProcess, err)
-				stats.FailedFiles++
-			} else {
-				if modCount > 0 {
-					logger.Info("Successfully processed file %s: %d modifications from %d matches",
-						fileToProcess, modCount, matchCount)
-				} else if matchCount > 0 {
-					logger.Info("Found %d matches in file %s but made no modifications",
-						matchCount, fileToProcess)
-				} else {
-					logger.Debug("No matches found in file: %s", fileToProcess)
-				}
-				stats.ProcessedFiles++
-				stats.TotalMatches += matchCount
-				stats.TotalModifications += modCount
+				logger.Error("Failed to read file %q: %v", file, err)
+				return
 			}
-		}, file)
+			fileDataStr := string(fileData)
+
+			logger.Debug("Saving file %q to database", file)
+			err = db.SaveFile(file, fileData)
+			if err != nil {
+				logger.Error("Failed to save file %q to database: %v", file, err)
+				return
+			}
+
+			logger.Debug("Running isolate commands for file %q", file)
+			fileDataStr, err = RunIsolateCommands(association, file, fileDataStr, &fileMutex)
+			if err != nil {
+				logger.Error("Failed to run isolate commands for file %q: %v", file, err)
+				return
+			}
+
+			logger.Debug("Running other commands for file %q", file)
+			fileDataStr, err = RunOtherCommands(file, fileDataStr, association, &fileMutex, commandLoggers)
+			if err != nil {
+				logger.Error("Failed to run other commands for file %q: %v", file, err)
+				return
+			}
+
+			logger.Debug("Writing file %q", file)
+			err = os.WriteFile(file, []byte(fileDataStr), 0644)
+			if err != nil {
+				logger.Error("Failed to write file %q: %v", file, err)
+				return
+			}
+
+			logger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
+		}, file, commands)
 	}
 	wg.Wait()
 
+	processingTime := time.Since(startTime)
+	logger.Info("Processing completed in %v", processingTime)
+	if stats.ProcessedFiles > 0 {
+		logger.Info("Average time per file: %v", processingTime/time.Duration(stats.ProcessedFiles))
+	}
+
+	// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
+	// Do that with logger.WithField("loglevel", level.String())
+	// Since each command also has its own log level
+	// TODO: Maybe even figure out how to run individual commands...?
+	// TODO: What to do with git? Figure it out ....
+
+	// if *gitFlag {
+	// 	logger.Info("Git integration enabled, setting up git repository")
+	// 	err := setupGit()
+	// 	if err != nil {
+	// 		logger.Error("Failed to setup git: %v", err)
+	// 		fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
+	// 		return
+	// 	}
+	// }
+
+	// logger.Debug("Expanding file patterns")
+	// files, err := expandFilePatterns(filePatterns)
+	// if err != nil {
+	// 	logger.Error("Failed to expand file patterns: %v", err)
+	// 	fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
+	// 	return
+	// }
+
+	// if *gitFlag {
+	// 	logger.Info("Cleaning up git files before processing")
+	// 	err := cleanupGitFiles(files)
+	// 	if err != nil {
+	// 		logger.Error("Failed to cleanup git files: %v", err)
+	// 		fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
+	// 		return
+	// 	}
+	// }
+	// if *resetFlag {
+	// 	logger.Info("Files reset to their original state, nothing more to do")
+	// 	log.Printf("Files reset to their original state, nothing more to do")
+	// 	return
+	// }
+
 	// Print summary
 	if stats.TotalModifications == 0 {
 		logger.Warning("No modifications were made in any files")
-		fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
 	} else {
 		logger.Info("Operation complete! Modified %d values in %d/%d files",
 			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
-		fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
-			stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
+		sortedCommands := []string{}
+		stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
+			sortedCommands = append(sortedCommands, key.(string))
+			return true
+		})
+		sort.Strings(sortedCommands)
+
+		for _, command := range sortedCommands {
+			count, _ := stats.ModificationsPerCommand.Load(command)
+			if count.(int) > 0 {
+				logger.Info("\tCommand %q made %d modifications", command, count)
+			} else {
+				logger.Warning("\tCommand %q made no modifications", command)
+			}
+		}
 	}
 }
 
-func setupGit() error {
-	cwd, err := os.Getwd()
-	if err != nil {
-		return fmt.Errorf("failed to get current working directory: %w", err)
-	}
-	logger.Debug("Current working directory obtained: %s", cwd)
-
-	logger.Debug("Attempting to open git repository at %s", cwd)
-	repo, err = git.PlainOpen(cwd)
-	if err != nil {
-		logger.Debug("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
-		repo, err = git.PlainInit(cwd, false)
+func HandleSpecialArgs(args []string, err error, db utils.DB) (bool, error) {
+	switch args[0] {
+	case "reset":
+		err = utils.ResetAllFiles(db)
 		if err != nil {
-			return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
+			logger.Error("Failed to reset all files: %v", err)
+			return true, err
 		}
-		logger.Info("Successfully initialized a new git repository at %s", cwd)
-	} else {
-		logger.Info("Successfully opened existing git repository at %s", cwd)
-	}
-
-	logger.Debug("Attempting to obtain worktree for repository at %s", cwd)
-	worktree, err = repo.Worktree()
-	if err != nil {
-		return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
-	}
-	logger.Debug("Successfully obtained worktree for repository at %s", cwd)
-	return nil
-}
-
-func expandFilePatterns(patterns []string) ([]string, error) {
-	var files []string
-	filesMap := make(map[string]bool)
-
-	cwd, err := os.Getwd()
-	if err != nil {
-		return nil, fmt.Errorf("failed to get current working directory: %w", err)
-	}
-
-	logger.Debug("Expanding patterns from directory: %s", cwd)
-	for _, pattern := range patterns {
-		logger.Trace("Processing pattern: %s", pattern)
-		matches, _ := doublestar.Glob(os.DirFS(cwd), pattern)
-		logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
-		for _, m := range matches {
-			info, err := os.Stat(m)
-			if err != nil {
-				logger.Warning("Error getting file info for %s: %v", m, err)
-				continue
-			}
-			if !info.IsDir() && !filesMap[m] {
-				logger.Trace("Adding file to process list: %s", m)
-				filesMap[m], files = true, append(files, m)
-			}
-		}
-	}
-
-	if len(files) > 0 {
-		logger.Debug("Found %d files to process: %v", len(files), files)
-	}
-	return files, nil
-}
-
-func cleanupGitFiles(files []string) error {
-	for _, file := range files {
-		logger.Debug("Checking git status for file: %s", file)
-		status, err := worktree.Status()
+		logger.Info("All files reset")
+		return true, nil
+	case "dump":
+		err = db.RemoveAllFiles()
 		if err != nil {
-			logger.Error("Error getting worktree status: %v", err)
-			fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
-			return fmt.Errorf("error getting worktree status: %w", err)
-		}
-		if status.IsUntracked(file) {
-			logger.Info("Detected untracked file: %s. Adding to git index.", file)
-			_, err = worktree.Add(file)
-			if err != nil {
-				logger.Error("Error adding file to git: %v", err)
-				fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
-				return fmt.Errorf("error adding file to git: %w", err)
-			}
-
-			filename := filepath.Base(file)
-			logger.Info("File %s added successfully. Committing with message: 'Track %s'", filename, filename)
-			_, err = worktree.Commit("Track "+filename, &git.CommitOptions{
-				Author: &object.Signature{
-					Name:  "Big Chef",
-					Email: "bigchef@bigchef.com",
-					When:  time.Now(),
-				},
-			})
-			if err != nil {
-				logger.Error("Error committing file: %v", err)
-				fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
-				return fmt.Errorf("error committing file: %w", err)
-			}
-			logger.Info("Successfully committed file: %s", filename)
-		} else {
-			logger.Info("File %s is already tracked. Restoring it to the working tree.", file)
-			err := worktree.Restore(&git.RestoreOptions{
-				Files:    []string{file},
-				Staged:   true,
-				Worktree: true,
-			})
-			if err != nil {
-				logger.Error("Error restoring file: %v", err)
-				fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
-				return fmt.Errorf("error restoring file: %w", err)
-			}
-			logger.Info("File %s restored successfully", file)
+			logger.Error("Failed to remove all files from database: %v", err)
+			return true, err
 		}
+		logger.Info("All files removed from database")
+		return true, nil
 	}
-	return nil
+	return false, nil
+}
+
+func CreateExampleConfig() {
+	commands := []utils.ModifyCommand{
+		{
+			Name:     "DoubleNumericValues",
+			Regex:    "<value>(\\d+)</value>",
+			Lua:      "v1 * 2",
+			Files:    []string{"data/*.xml"},
+			LogLevel: "INFO",
+		},
+		{
+			Name:     "UpdatePrices",
+			Regex:    "price=\"(\\d+)\"",
+			Lua:      "if num(v1) < 100 then return v1 * 1.5 else return v1 end",
+			Files:    []string{"items/*.xml", "shop/*.xml"},
+			LogLevel: "DEBUG",
+		},
+		{
+			Name:     "IsolatedTagUpdate",
+			Regex:    "<tag>(.*?)</tag>",
+			Lua:      "string.upper(s1)",
+			Files:    []string{"config.xml"},
+			Isolate:  true,
+			NoDedup:  true,
+			LogLevel: "TRACE",
+		},
+	}
+
+	data, err := yaml.Marshal(commands)
+	if err != nil {
+		logger.Error("Failed to marshal example config: %v", err)
+		return
+	}
+
+	err = os.WriteFile("example_cook.yml", data, 0644)
+	if err != nil {
+		logger.Error("Failed to write example_cook.yml: %v", err)
+		return
+	}
+
+	logger.Info("Wrote example_cook.yml")
+}
+
+func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, fileMutex *sync.Mutex, commandLoggers map[string]*logger.Logger) (string, error) {
+	// Aggregate all the modifications and execute them
+	modifications := []utils.ReplaceCommand{}
+	for _, command := range association.Commands {
+		// Use command-specific logger if available, otherwise fall back to default logger
+		cmdLogger := logger.Default
+		if cmdLog, ok := commandLoggers[command.Name]; ok {
+			cmdLogger = cmdLog
+		}
+
+		cmdLogger.Info("Processing file %q with command %q", file, command.Regex)
+		newModifications, err := processor.ProcessRegex(fileDataStr, command, file)
+		if err != nil {
+			logger.Error("Failed to process file %q with command %q: %v", file, command.Regex, err)
+			continue
+		}
+		modifications = append(modifications, newModifications...)
+		// It is not guranteed that all the commands will be executed...
+		// TODO: Make this better
+		// We'd have to pass the map to executemodifications or something...
+		count, ok := stats.ModificationsPerCommand.Load(command.Name)
+		if !ok {
+			count = 0
+		}
+		stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
+
+		cmdLogger.Debug("Command %q generated %d modifications", command.Name, len(newModifications))
+	}
+
+	if len(modifications) == 0 {
+		logger.Warning("No modifications found for file %q", file)
+		return fileDataStr, nil
+	}
+
+	// Sort commands in reverse order for safe replacements
+	var count int
+	fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
+
+	fileMutex.Lock()
+	stats.ProcessedFiles++
+	stats.TotalModifications += count
+	fileMutex.Unlock()
+
+	logger.Info("Executed %d modifications for file %q", count, file)
+	return fileDataStr, nil
+}
+
+func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string, fileMutex *sync.Mutex) (string, error) {
+	for _, isolateCommand := range association.IsolateCommands {
+		logger.Info("Processing file %q with isolate command %q", file, isolateCommand.Regex)
+		modifications, err := processor.ProcessRegex(fileDataStr, isolateCommand, file)
+		if err != nil {
+			logger.Error("Failed to process file %q with isolate command %q: %v", file, isolateCommand.Regex, err)
+			continue
+		}
+
+		if len(modifications) == 0 {
+			logger.Warning("No modifications found for file %q", file)
+			continue
+		}
+
+		var count int
+		fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
+
+		fileMutex.Lock()
+		stats.ProcessedFiles++
+		stats.TotalModifications += count
+		fileMutex.Unlock()
+
+		logger.Info("Executed %d isolate modifications for file %q", count, file)
+	}
+	return fileDataStr, nil
 }

processor/json.go

@@ -1,194 +0,0 @@
-package processor
-
-import (
-	"encoding/json"
-	"fmt"
-	"modify/logger"
-	"modify/processor/jsonpath"
-
-	lua "github.com/yuin/gopher-lua"
-)
-
-// JSONProcessor implements the Processor interface for JSON documents
-type JSONProcessor struct{}
-
-// ProcessContent implements the Processor interface for JSONProcessor
-func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
-	logger.Debug("Processing JSON content with JSONPath: %s", pattern)
-
-	// Parse JSON document
-	logger.Trace("Parsing JSON document")
-	var jsonData interface{}
-	err := json.Unmarshal([]byte(content), &jsonData)
-	if err != nil {
-		logger.Error("Failed to parse JSON: %v", err)
-		return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
-	}
-
-	// Find nodes matching the JSONPath pattern
-	logger.Debug("Executing JSONPath query: %s", pattern)
-	nodes, err := jsonpath.Get(jsonData, pattern)
-	if err != nil {
-		logger.Error("Failed to execute JSONPath: %v", err)
-		return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
-	}
-
-	matchCount := len(nodes)
-	logger.Debug("Found %d nodes matching JSONPath", matchCount)
-	if matchCount == 0 {
-		logger.Warning("No nodes matched the JSONPath pattern: %s", pattern)
-		return content, 0, 0, nil
-	}
-
-	modCount := 0
-	for i, node := range nodes {
-		logger.Trace("Processing node #%d at path: %s with value: %v", i+1, node.Path, node.Value)
-
-		// Initialize Lua
-		L, err := NewLuaState()
-		if err != nil {
-			logger.Error("Failed to create Lua state: %v", err)
-			return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
-		}
-		defer L.Close()
-		logger.Trace("Lua state initialized successfully")
-
-		err = p.ToLua(L, node.Value)
-		if err != nil {
-			logger.Error("Failed to convert value to Lua: %v", err)
-			return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
-		}
-		logger.Trace("Converted node value to Lua: %v", node.Value)
-
-		originalScript := luaExpr
-		fullScript := BuildLuaScript(luaExpr)
-		logger.Debug("Original script: %q, Full script: %q", originalScript, fullScript)
-
-		// Execute Lua script
-		logger.Trace("Executing Lua script: %q", fullScript)
-		if err := L.DoString(fullScript); err != nil {
-			logger.Error("Failed to execute Lua script: %v", err)
-			return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
-		}
-		logger.Trace("Lua script executed successfully")
-
-		// Get modified value
-		result, err := p.FromLua(L)
-		if err != nil {
-			logger.Error("Failed to get result from Lua: %v", err)
-			return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
-		}
-		logger.Trace("Retrieved modified value from Lua: %v", result)
-
-		modified := false
-		modified = L.GetGlobal("modified").String() == "true"
-		if !modified {
-			logger.Debug("No changes made to node at path: %s", node.Path)
-			continue
-		}
-
-		// Apply the modification to the JSON data
-		logger.Debug("Updating JSON at path: %s with new value: %v", node.Path, result)
-		err = p.updateJSONValue(jsonData, node.Path, result)
-		if err != nil {
-			logger.Error("Failed to update JSON at path %s: %v", node.Path, err)
-			return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
-		}
-		logger.Debug("Updated JSON at path: %s successfully", node.Path)
-		modCount++
-	}
-
-	logger.Info("JSON processing complete: %d modifications from %d matches", modCount, matchCount)
-
-	// Convert the modified JSON back to a string with same formatting
-	logger.Trace("Marshalling JSON data back to string")
-	var jsonBytes []byte
-	jsonBytes, err = json.MarshalIndent(jsonData, "", "  ")
-	if err != nil {
-		logger.Error("Failed to marshal JSON: %v", err)
-		return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
-	}
-	return string(jsonBytes), modCount, matchCount, nil
-}
-
-// updateJSONValue updates a value in the JSON structure based on its JSONPath
-func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
-	logger.Trace("Updating JSON value at path: %s", path)
-
-	// Special handling for root node
-	if path == "$" {
-		logger.Debug("Handling special case for root node update")
-		// For the root node, we'll copy the value to the jsonData reference
-		// This is a special case since we can't directly replace the interface{} variable
-
-		// We need to handle different types of root elements
-		switch rootValue := newValue.(type) {
-		case map[string]interface{}:
-			// For objects, we need to copy over all keys
-			rootMap, ok := jsonData.(map[string]interface{})
-			if !ok {
-				// If the original wasn't a map, completely replace it with the new map
-				// This is handled by the jsonpath.Set function
-				logger.Debug("Root was not a map, replacing entire root")
-				return jsonpath.Set(jsonData, path, newValue)
-			}
-
-			// Clear the original map
-			logger.Trace("Clearing original root map")
-			for k := range rootMap {
-				delete(rootMap, k)
-			}
-
-			// Copy all keys from the new map
-			logger.Trace("Copying keys to root map")
-			for k, v := range rootValue {
-				rootMap[k] = v
-			}
-			return nil
-
-		case []interface{}:
-			// For arrays, we need to handle similarly
-			rootArray, ok := jsonData.([]interface{})
-			if !ok {
-				// If the original wasn't an array, use jsonpath.Set
-				logger.Debug("Root was not an array, replacing entire root")
-				return jsonpath.Set(jsonData, path, newValue)
-			}
-
-			// Clear and recreate the array
-			logger.Trace("Replacing root array")
-			*&rootArray = rootValue
-			return nil
-
-		default:
-			// For other types, use jsonpath.Set
-			logger.Debug("Replacing root with primitive value")
-			return jsonpath.Set(jsonData, path, newValue)
-		}
-	}
-
-	// For non-root paths, use the regular Set method
-	logger.Trace("Using regular Set method for non-root path")
-	err := jsonpath.Set(jsonData, path, newValue)
-	if err != nil {
-		logger.Error("Failed to set JSON value at path %s: %v", path, err)
-		return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
-	}
-	return nil
-}
-
-// ToLua converts JSON values to Lua variables
-func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
-	table, err := ToLua(L, data)
-	if err != nil {
-		return err
-	}
-	L.SetGlobal("v", table)
-	return nil
-}
-
-// FromLua retrieves values from Lua
-func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
-	luaValue := L.GetGlobal("v")
-	return FromLua(L, luaValue)
-}

processor/jsonpath/jsonpath.go

@@ -1,490 +0,0 @@
-package jsonpath
-
-import (
-	"fmt"
-	"strconv"
-)
-
-// JSONStep represents a single step in a JSONPath query
-type JSONStep struct {
-	Type  StepType
-	Key   string // For Child/RecursiveDescent
-	Index int    // For Index (use -1 for wildcard "*")
-}
-
-// JSONNode represents a value in the JSON data with its path
-type JSONNode struct {
-	Value interface{} // The value found at the path
-	Path  string      // The exact JSONPath where the value was found
-}
-
-// StepType defines the types of steps in a JSONPath
-type StepType int
-
-const (
-	RootStep             StepType = iota // $ - The root element
-	ChildStep                            // .key - Direct child access
-	RecursiveDescentStep                 // ..key - Recursive search for key
-	WildcardStep                         // .* - All children of an object
-	IndexStep                            // [n] - Array index access (or [*] for all elements)
-)
-
-// TraversalMode determines how the traversal behaves
-type TraversalMode int
-
-const (
-	CollectMode     TraversalMode = iota // Just collect matched nodes
-	ModifyFirstMode                      // Modify first matching node
-	ModifyAllMode                        // Modify all matching nodes
-)
-
-// ParseJSONPath parses a JSONPath string into a sequence of steps
-func ParseJSONPath(path string) ([]JSONStep, error) {
-	if len(path) == 0 || path[0] != '$' {
-		return nil, fmt.Errorf("path must start with $; received: %q", path)
-	}
-
-	steps := []JSONStep{}
-	i := 0
-
-	for i < len(path) {
-		switch path[i] {
-		case '$':
-			steps = append(steps, JSONStep{Type: RootStep})
-			i++
-		case '.':
-			i++
-			if i < len(path) && path[i] == '.' {
-				// Recursive descent
-				i++
-				key, nextPos := readKey(path, i)
-				steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
-				i = nextPos
-			} else {
-				// Child step or wildcard
-				key, nextPos := readKey(path, i)
-				if key == "*" {
-					steps = append(steps, JSONStep{Type: WildcardStep})
-				} else {
-					steps = append(steps, JSONStep{Type: ChildStep, Key: key})
-				}
-				i = nextPos
-			}
-		case '[':
-			// Index step
-			i++
-			indexStr, nextPos := readIndex(path, i)
-			if indexStr == "*" {
-				steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
-			} else {
-				index, err := strconv.Atoi(indexStr)
-				if err != nil {
-					return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
-				}
-				steps = append(steps, JSONStep{Type: IndexStep, Index: index})
-			}
-			i = nextPos + 1 // Skip closing ]
-		default:
-			return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
-		}
-	}
-
-	return steps, nil
-}
-
-// readKey extracts a key name from the path
-func readKey(path string, start int) (string, int) {
-	i := start
-	for ; i < len(path); i++ {
-		if path[i] == '.' || path[i] == '[' {
-			break
-		}
-	}
-	return path[start:i], i
-}
-
-// readIndex extracts an array index or wildcard from the path
-func readIndex(path string, start int) (string, int) {
-	i := start
-	for ; i < len(path); i++ {
-		if path[i] == ']' {
-			break
-		}
-	}
-	return path[start:i], i
-}
-
-// Get retrieves values with their paths from data at the specified JSONPath
-// Each returned JSONNode contains both the value and its exact path in the data structure
-func Get(data interface{}, path string) ([]JSONNode, error) {
-	steps, err := ParseJSONPath(path)
-	if err != nil {
-		return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
-	}
-
-	results := []JSONNode{}
-	err = traverseWithPaths(data, steps, &results, "$")
-	if err != nil {
-		return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
-	}
-	return results, nil
-}
-
-// Set updates the value at the specified JSONPath in the original data structure.
-// It only modifies the first matching node.
-func Set(data interface{}, path string, value interface{}) error {
-	steps, err := ParseJSONPath(path)
-	if err != nil {
-		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
-	}
-
-	success := false
-	err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
-	if err != nil {
-		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
-	}
-	return nil
-}
-
-// SetAll updates all matching values at the specified JSONPath.
-func SetAll(data interface{}, path string, value interface{}) error {
-	steps, err := ParseJSONPath(path)
-	if err != nil {
-		return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
-	}
-
-	success := false
-	err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
-	if err != nil {
-		return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
-	}
-	return nil
-}
-
-// setWithPath modifies values while tracking paths
-func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
-	if node == nil || *success && mode == ModifyFirstMode {
-		return nil
-	}
-
-	// Skip root step
-	actualSteps := steps
-	if len(steps) > 0 && steps[0].Type == RootStep {
-		actualSteps = steps[1:]
-	}
-
-	// If we have no steps left, we're setting the root value
-	if len(actualSteps) == 0 {
-		// For the root node, we need to handle it differently depending on what's passed in
-		// since we can't directly replace the interface{} variable
-
-		// We'll signal success and let the JSONProcessor handle updating the root
-		*success = true
-		return nil
-	}
-
-	// Process the first step
-	step := actualSteps[0]
-	remainingSteps := actualSteps[1:]
-	isLastStep := len(remainingSteps) == 0
-
-	switch step.Type {
-	case ChildStep:
-		m, ok := node.(map[string]interface{})
-		if !ok {
-			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
-		}
-
-		childPath := currentPath + "." + step.Key
-
-		if isLastStep {
-			// We've reached the target, set the value
-			m[step.Key] = value
-			*success = true
-			return nil
-		}
-
-		// Create intermediate nodes if necessary
-		child, exists := m[step.Key]
-		if !exists {
-			// Create missing intermediate node
-			if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
-				child = []interface{}{}
-			} else {
-				child = map[string]interface{}{}
-			}
-			m[step.Key] = child
-		}
-
-		err := setWithPath(child, remainingSteps, success, value, childPath, mode)
-		if err != nil {
-			return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
-		}
-
-	case IndexStep:
-		arr, ok := node.([]interface{})
-		if !ok {
-			return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
-		}
-
-		// Handle wildcard index
-		if step.Index == -1 {
-			for i, item := range arr {
-				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
-				if isLastStep {
-					arr[i] = value
-					*success = true
-					if mode == ModifyFirstMode {
-						return nil
-					}
-				} else {
-					err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
-					if err != nil {
-						return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
-					}
-					if *success && mode == ModifyFirstMode {
-						return nil
-					}
-				}
-			}
-			return nil
-		}
-
-		// Handle specific index
-		if step.Index >= 0 && step.Index < len(arr) {
-			item := arr[step.Index]
-			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
-			if isLastStep {
-				arr[step.Index] = value
-				*success = true
-			} else {
-				err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
-				if err != nil {
-					return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
-				}
-			}
-		}
-
-	case RecursiveDescentStep:
-		// For recursive descent, first check direct match at this level
-		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
-			if val, exists := m[step.Key]; exists {
-				directPath := currentPath + "." + step.Key
-				if isLastStep {
-					m[step.Key] = value
-					*success = true
-					if mode == ModifyFirstMode {
-						return nil
-					}
-				} else {
-					err := setWithPath(val, remainingSteps, success, value, directPath, mode)
-					if err != nil {
-						return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
-					}
-					if *success && mode == ModifyFirstMode {
-						return nil
-					}
-				}
-			}
-		}
-
-		// Then continue recursion to all children
-		switch n := node.(type) {
-		case map[string]interface{}:
-			for k, v := range n {
-				childPath := currentPath + "." + k
-				// Skip keys we've already processed directly
-				if step.Key != "*" && k == step.Key {
-					continue
-				}
-				err := setWithPath(v, steps, success, value, childPath, mode)
-				if err != nil {
-					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
-				}
-				if *success && mode == ModifyFirstMode {
-					return nil
-				}
-			}
-		case []interface{}:
-			for i, v := range n {
-				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
-				err := setWithPath(v, steps, success, value, childPath, mode)
-				if err != nil {
-					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
-				}
-				if *success && mode == ModifyFirstMode {
-					return nil
-				}
-			}
-		}
-
-	case WildcardStep:
-		m, ok := node.(map[string]interface{})
-		if !ok {
-			return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
-		}
-
-		for k, v := range m {
-			childPath := currentPath + "." + k
-			if isLastStep {
-				m[k] = value
-				*success = true
-				if mode == ModifyFirstMode {
-					return nil
-				}
-			} else {
-				err := setWithPath(v, remainingSteps, success, value, childPath, mode)
-				if err != nil {
-					return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
-				}
-				if *success && mode == ModifyFirstMode {
-					return nil
-				}
-			}
-		}
-	}
-	return nil
-}
-
-// traverseWithPaths tracks both nodes and their paths during traversal
-func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
-	if len(steps) == 0 || node == nil {
-		return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
-	}
-
-	// Skip root step
-	actualSteps := steps
-	if steps[0].Type == RootStep {
-		if len(steps) == 1 {
-			*results = append(*results, JSONNode{Value: node, Path: currentPath})
-			return nil
-		}
-		actualSteps = steps[1:]
-	}
-
-	// Process the first step
-	step := actualSteps[0]
-	remainingSteps := actualSteps[1:]
-	isLastStep := len(remainingSteps) == 0
-
-	switch step.Type {
-	case ChildStep:
-		m, ok := node.(map[string]interface{})
-		if !ok {
-			return fmt.Errorf("node is not a map; actual type: %T", node)
-		}
-
-		child, exists := m[step.Key]
-		if !exists {
-			return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
-		}
-
-		childPath := currentPath + "." + step.Key
-		if isLastStep {
-			*results = append(*results, JSONNode{Value: child, Path: childPath})
-		} else {
-			err := traverseWithPaths(child, remainingSteps, results, childPath)
-			if err != nil {
-				return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
-			}
-		}
-
-	case IndexStep:
-		arr, ok := node.([]interface{})
-		if !ok {
-			return fmt.Errorf("node is not an array; actual type: %T", node)
-		}
-
-		// Handle wildcard index
-		if step.Index == -1 {
-			for i, item := range arr {
-				itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
-				if isLastStep {
-					*results = append(*results, JSONNode{Value: item, Path: itemPath})
-				} else {
-					err := traverseWithPaths(item, remainingSteps, results, itemPath)
-					if err != nil {
-						return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
-					}
-				}
-			}
-			return nil
-		}
-
-		// Handle specific index
-		if step.Index >= 0 && step.Index < len(arr) {
-			item := arr[step.Index]
-			itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
-			if isLastStep {
-				*results = append(*results, JSONNode{Value: item, Path: itemPath})
-			} else {
-				err := traverseWithPaths(item, remainingSteps, results, itemPath)
-				if err != nil {
-					return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
-				}
-			}
-		} else {
-			return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
-		}
-
-	case RecursiveDescentStep:
-		// For recursive descent, first check direct match at this level
-		if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
-			if val, exists := m[step.Key]; exists {
-				directPath := currentPath + "." + step.Key
-				if isLastStep {
-					*results = append(*results, JSONNode{Value: val, Path: directPath})
-				} else {
-					err := traverseWithPaths(val, remainingSteps, results, directPath)
-					if err != nil {
-						return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
-					}
-				}
-			}
-		}
-
-		// For wildcard, collect this node
-		if step.Key == "*" && isLastStep {
-			*results = append(*results, JSONNode{Value: node, Path: currentPath})
-		}
-
-		// Then continue recursion to all children
-		switch n := node.(type) {
-		case map[string]interface{}:
-			for k, v := range n {
-				childPath := currentPath + "." + k
-				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
-				if err != nil {
-					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
-				}
-			}
-		case []interface{}:
-			for i, v := range n {
-				childPath := fmt.Sprintf("%s[%d]", currentPath, i)
-				err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
-				if err != nil {
-					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
-				}
-			}
-		}
-
-	case WildcardStep:
-		m, ok := node.(map[string]interface{})
-		if !ok {
-			return fmt.Errorf("node is not a map; actual type: %T", node)
-		}
-
-		for k, v := range m {
-			childPath := currentPath + "." + k
-			if isLastStep {
-				*results = append(*results, JSONNode{Value: v, Path: childPath})
-			} else {
-				err := traverseWithPaths(v, remainingSteps, results, childPath)
-				if err != nil {
-					return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
-				}
-			}
-		}
-	}
-	return nil
-}

processor/jsonpath/jsonpath_get_set_test.go

@@ -1,577 +0,0 @@
-package jsonpath
-
-import (
-	"reflect"
-	"testing"
-)
-
-func TestGetWithPathsBasic(t *testing.T) {
-	tests := []struct {
-		name     string
-		data     map[string]interface{}
-		path     string
-		expected []JSONNode
-		error    bool
-	}{
-		{
-			name: "simple property",
-			data: map[string]interface{}{
-				"name": "John",
-				"age":  30,
-			},
-			path: "$.name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.name"},
-			},
-		},
-		{
-			name: "nested property",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-					"age":  30,
-				},
-			},
-			path: "$.user.name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.user.name"},
-			},
-		},
-		{
-			name: "array access",
-			data: map[string]interface{}{
-				"users": []interface{}{
-					map[string]interface{}{"name": "John", "age": 30},
-					map[string]interface{}{"name": "Jane", "age": 25},
-				},
-			},
-			path: "$.users[1].name",
-			expected: []JSONNode{
-				{Value: "Jane", Path: "$.users[1].name"},
-			},
-		},
-		{
-			name: "wildcard",
-			data: map[string]interface{}{
-				"users": []interface{}{
-					map[string]interface{}{"name": "John", "age": 30},
-					map[string]interface{}{"name": "Jane", "age": 25},
-				},
-			},
-			path: "$.users[*].name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.users[0].name"},
-				{Value: "Jane", Path: "$.users[1].name"},
-			},
-		},
-		{
-			name: "recursive descent",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-					"profile": map[string]interface{}{
-						"email": "john@example.com",
-					},
-				},
-				"admin": map[string]interface{}{
-					"email": "admin@example.com",
-				},
-			},
-			path: "$..email",
-			expected: []JSONNode{
-				{Value: "john@example.com", Path: "$.user.profile.email"},
-				{Value: "admin@example.com", Path: "$.admin.email"},
-			},
-		},
-		{
-			name: "nonexistent path",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-				},
-			},
-			path:     "$.user.email",
-			expected: []JSONNode{},
-			error:    true,
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(tt.data, tt.path)
-			if err != nil {
-				if !tt.error {
-					t.Errorf("GetWithPaths() returned error: %v", err)
-				}
-				return
-			}
-
-			// For nonexistent path, we expect empty slice
-			if tt.name == "nonexistent path" {
-				if len(result) > 0 {
-					t.Errorf("GetWithPaths() returned %v, expected empty result", result)
-				}
-				return
-			}
-
-			// Check if lengths match
-			if len(result) != len(tt.expected) {
-				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
-				return
-			}
-
-			// For wildcard results, we need to check containment rather than exact order
-			if tt.name == "wildcard" || tt.name == "recursive descent" {
-				// For each expected item, check if it exists in the results by both value and path
-				for _, expected := range tt.expected {
-					found := false
-					for _, r := range result {
-						if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
-							found = true
-							break
-						}
-					}
-					if !found {
-						t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
-					}
-				}
-			} else {
-				// Otherwise check exact equality of both values and paths
-				for i, expected := range tt.expected {
-					if !reflect.DeepEqual(result[i].Value, expected.Value) {
-						t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
-					}
-					if result[i].Path != expected.Path {
-						t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
-					}
-				}
-			}
-		})
-	}
-}
-
-func TestSet(t *testing.T) {
-	t.Run("simple property", func(t *testing.T) {
-		data := map[string]interface{}{
-			"name": "John",
-			"age":  30,
-		}
-		 err := Set(data, "$.name", "Jane")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		if data["name"] != "Jane" {
-			t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
-		}
-	})
-
-	t.Run("nested property", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-				"age":  30,
-			},
-		}
-		err := Set(data, "$.user.name", "Jane")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		user, ok := data["user"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-		if user["name"] != "Jane" {
-			t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
-		}
-	})
-
-	t.Run("array element", func(t *testing.T) {
-		data := map[string]interface{}{
-			"users": []interface{}{
-				map[string]interface{}{"name": "John", "age": 30},
-				map[string]interface{}{"name": "Jane", "age": 25},
-			},
-		}
-		err := Set(data, "$.users[0].name", "Bob")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-		users, ok := data["users"].([]interface{})
-		if !ok {
-			t.Fatalf("Users is not a slice")
-		}
-		user0, ok := users[0].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-		if user0["name"] != "Bob" {
-			t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
-		}
-	})
-
-	t.Run("complex value", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-				"profile": map[string]interface{}{
-					"email": "john@example.com",
-				},
-			},
-		}
-
-		newProfile := map[string]interface{}{
-			"email": "john.doe@example.com",
-			"phone": "123-456-7890",
-		}
-
-		err := Set(data, "$.user.profile", newProfile)
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		userMap, ok := data["user"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-
-		profile, ok := userMap["profile"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("Profile is not a map")
-		}
-
-		if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
-			t.Errorf("Set() failed: expected profile to be updated with new values")
-		}
-	})
-
-	t.Run("create new property", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-			},
-		}
-
-		err := Set(data, "$.user.email", "john@example.com")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-		userMap, ok := data["user"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-
-		if email, exists := userMap["email"]; !exists || email != "john@example.com" {
-			t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
-		}
-	})
-
-	t.Run("create nested properties", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-			},
-		}
-
-		err := Set(data, "$.user.contact.email", "john@example.com")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-		userMap, ok := data["user"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User is not a map")
-		}
-
-		contact, ok := userMap["contact"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("Contact is not a map")
-		}
-
-		if email, exists := contact["email"]; !exists || email != "john@example.com" {
-			t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
-		}
-	})
-
-	t.Run("create array and element", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"name": "John",
-			},
-		}
-
-		// This should create an empty addresses array, but won't be able to set index 0
-		// since the array is empty
-		err := Set(data, "$.user.addresses[0].street", "123 Main St")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-	})
-
-	t.Run("multiple targets (should only update first)", func(t *testing.T) {
-		data := map[string]interface{}{
-			"users": []interface{}{
-				map[string]interface{}{"active": true},
-				map[string]interface{}{"active": true},
-			},
-		}
-
-		err := Set(data, "$.users[*].active", false)
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		users, ok := data["users"].([]interface{})
-		if !ok {
-			t.Fatalf("Users is not a slice")
-		}
-
-		user0, ok := users[0].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User0 is not a map")
-		}
-
-		user1, ok := users[1].(map[string]interface{})
-		if !ok {
-			t.Fatalf("User1 is not a map")
-		}
-
-		// Only the first one should be changed
-		if active, exists := user0["active"]; !exists || active != false {
-			t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
-		}
-
-		// The second one should remain unchanged
-		if active, exists := user1["active"]; !exists || active != true {
-			t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
-		}
-	})
-
-	t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
-		data := map[string]interface{}{
-			"name": "John",
-		}
-
-		err := Set(data, "$", "Jane")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		// Data should be unchanged
-		if data["name"] != "John" {
-			t.Errorf("Data was modified when setting on root")
-		}
-	})
-}
-
-func TestSetAll(t *testing.T) {
-	t.Run("simple property", func(t *testing.T) {
-		data := map[string]interface{}{
-			"name": "John",
-			"age":  30,
-		}
-		err := SetAll(data, "$.name", "Jane")
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-		if data["name"] != "Jane" {
-			t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
-		}
-	})
-
-	t.Run("all array elements", func(t *testing.T) {
-		data := map[string]interface{}{
-			"users": []interface{}{
-				map[string]interface{}{"active": true},
-				map[string]interface{}{"active": true},
-			},
-		}
-
-		err := SetAll(data, "$.users[*].active", false)
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-
-		users, ok := data["users"].([]interface{})
-		if !ok {
-			t.Fatalf("Users is not a slice")
-		}
-
-		// Both elements should be updated
-		for i, user := range users {
-			userMap, ok := user.(map[string]interface{})
-			if !ok {
-				t.Fatalf("User%d is not a map", i)
-			}
-
-			if active, exists := userMap["active"]; !exists || active != false {
-				t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
-			}
-		}
-	})
-
-	t.Run("recursive descent", func(t *testing.T) {
-		data := map[string]interface{}{
-			"user": map[string]interface{}{
-				"profile": map[string]interface{}{
-					"active": true,
-				},
-			},
-			"admin": map[string]interface{}{
-				"profile": map[string]interface{}{
-					"active": true,
-				},
-			},
-		}
-
-		err := SetAll(data, "$..active", false)
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-
-		// Check user profile
-		userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("Failed to access user.profile")
-		}
-		if active, exists := userProfile["active"]; !exists || active != false {
-			t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
-		}
-
-		// Check admin profile
-		adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
-		if !ok {
-			t.Fatalf("Failed to access admin.profile")
-		}
-		if active, exists := adminProfile["active"]; !exists || active != false {
-			t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
-		}
-	})
-}
-
-func TestGetWithPathsExtended(t *testing.T) {
-	tests := []struct {
-		name     string
-		data     map[string]interface{}
-		path     string
-		expected []JSONNode
-	}{
-		{
-			name: "simple property",
-			data: map[string]interface{}{
-				"name": "John",
-				"age":  30,
-			},
-			path: "$.name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.name"},
-			},
-		},
-		{
-			name: "nested property",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-					"age":  30,
-				},
-			},
-			path: "$.user.name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.user.name"},
-			},
-		},
-		{
-			name: "array access",
-			data: map[string]interface{}{
-				"users": []interface{}{
-					map[string]interface{}{"name": "John", "age": 30},
-					map[string]interface{}{"name": "Jane", "age": 25},
-				},
-			},
-			path: "$.users[1].name",
-			expected: []JSONNode{
-				{Value: "Jane", Path: "$.users[1].name"},
-			},
-		},
-		{
-			name: "wildcard",
-			data: map[string]interface{}{
-				"users": []interface{}{
-					map[string]interface{}{"name": "John", "age": 30},
-					map[string]interface{}{"name": "Jane", "age": 25},
-				},
-			},
-			path: "$.users[*].name",
-			expected: []JSONNode{
-				{Value: "John", Path: "$.users[0].name"},
-				{Value: "Jane", Path: "$.users[1].name"},
-			},
-		},
-		{
-			name: "recursive descent",
-			data: map[string]interface{}{
-				"user": map[string]interface{}{
-					"name": "John",
-					"profile": map[string]interface{}{
-						"email": "john@example.com",
-					},
-				},
-				"admin": map[string]interface{}{
-					"email": "admin@example.com",
-				},
-			},
-			path: "$..email",
-			expected: []JSONNode{
-				{Value: "john@example.com", Path: "$.user.profile.email"},
-				{Value: "admin@example.com", Path: "$.admin.email"},
-			},
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(tt.data, tt.path)
-			if err != nil {
-				t.Errorf("GetWithPaths() returned error: %v", err)
-				return
-			}
-
-			// Check if lengths match
-			if len(result) != len(tt.expected) {
-				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
-				return
-			}
-
-			// For each expected item, find its match in the results and verify both value and path
-			for _, expected := range tt.expected {
-				found := false
-				for _, r := range result {
-					// Check if value matches
-					if reflect.DeepEqual(r.Value, expected.Value) {
-						found = true
-						// Check if path matches
-						if r.Path != expected.Path {
-							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
-						}
-						break
-					}
-				}
-				if !found {
-					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
-				}
-			}
-		})
-	}
-}

processor/jsonpath/jsonpath_test.go

@@ -1,318 +0,0 @@
-package jsonpath
-
-import (
-	"reflect"
-	"testing"
-)
-
-var testData = map[string]interface{}{
-	"store": map[string]interface{}{
-		"book": []interface{}{
-			map[string]interface{}{
-				"title": "The Fellowship of the Ring",
-				"price": 22.99,
-			},
-			map[string]interface{}{
-				"title": "The Two Towers",
-				"price": 23.45,
-			},
-		},
-		"bicycle": map[string]interface{}{
-			"color": "red",
-			"price": 199.95,
-		},
-	},
-}
-
-func TestParser(t *testing.T) {
-	tests := []struct {
-		path    string
-		steps   []JSONStep
-		wantErr bool
-	}{
-		{
-			path: "$.store.bicycle.color",
-			steps: []JSONStep{
-				{Type: RootStep},
-				{Type: ChildStep, Key: "store"},
-				{Type: ChildStep, Key: "bicycle"},
-				{Type: ChildStep, Key: "color"},
-			},
-		},
-		{
-			path: "$..price",
-			steps: []JSONStep{
-				{Type: RootStep},
-				{Type: RecursiveDescentStep, Key: "price"},
-			},
-		},
-		{
-			path: "$.store.book[*].title",
-			steps: []JSONStep{
-				{Type: RootStep},
-				{Type: ChildStep, Key: "store"},
-				{Type: ChildStep, Key: "book"},
-				{Type: IndexStep, Index: -1}, // Wildcard
-				{Type: ChildStep, Key: "title"},
-			},
-		},
-		{
-			path: "$.store.book[0]",
-			steps: []JSONStep{
-				{Type: RootStep},
-				{Type: ChildStep, Key: "store"},
-				{Type: ChildStep, Key: "book"},
-				{Type: IndexStep, Index: 0},
-			},
-		},
-		{
-			path:    "invalid.path",
-			wantErr: true,
-		},
-		{
-			path:    "$.store.book[abc]",
-			wantErr: true,
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.path, func(t *testing.T) {
-			steps, err := ParseJSONPath(tt.path)
-			if (err != nil) != tt.wantErr {
-				t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
-			}
-			if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
-				t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
-			}
-		})
-	}
-}
-
-func TestEvaluator(t *testing.T) {
-	tests := []struct {
-		name     string
-		path     string
-		expected []JSONNode
-		error    bool
-	}{
-		{
-			name: "simple_property_access",
-			path: "$.store.bicycle.color",
-			expected: []JSONNode{
-				{Value: "red", Path: "$.store.bicycle.color"},
-			},
-		},
-		{
-			name: "array_index_access",
-			path: "$.store.book[0].title",
-			expected: []JSONNode{
-				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
-			},
-		},
-		{
-			name: "wildcard_array_access",
-			path: "$.store.book[*].title",
-			expected: []JSONNode{
-				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
-				{Value: "The Two Towers", Path: "$.store.book[1].title"},
-			},
-		},
-		{
-			name: "recursive_price_search",
-			path: "$..price",
-			expected: []JSONNode{
-				{Value: 22.99, Path: "$.store.book[0].price"},
-				{Value: 23.45, Path: "$.store.book[1].price"},
-				{Value: 199.95, Path: "$.store.bicycle.price"},
-			},
-		},
-		{
-			name: "wildcard_recursive",
-			path: "$..*",
-			expected: []JSONNode{
-				// These will be compared by value only, paths will be validated separately
-				{Value: testData["store"].(map[string]interface{})["book"]},
-				{Value: testData["store"].(map[string]interface{})["bicycle"]},
-				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
-				{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
-				{Value: "The Fellowship of the Ring"},
-				{Value: 22.99},
-				{Value: "The Two Towers"},
-				{Value: 23.45},
-				{Value: "red"},
-				{Value: 199.95},
-			},
-		},
-		{
-			name:     "invalid_index",
-			path:     "$.store.book[5]",
-			expected: []JSONNode{},
-			error:    true,
-		},
-		{
-			name:     "nonexistent_property",
-			path:     "$.store.nonexistent",
-			expected: []JSONNode{},
-			error:    true,
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			// Use GetWithPaths directly
-			result, err := Get(testData, tt.path)
-			if err != nil {
-				if !tt.error {
-					t.Errorf("Get() returned error: %v", err)
-				}
-				return
-			}
-
-			// Special handling for wildcard recursive test
-			if tt.name == "wildcard_recursive" {
-				// Skip length check for wildcard recursive since it might vary
-				// Just verify that each expected item is in the results
-
-				// Validate values match and paths are filled in
-				for _, e := range tt.expected {
-					found := false
-					for _, r := range result {
-						if reflect.DeepEqual(r.Value, e.Value) {
-							found = true
-							break
-						}
-					}
-					if !found {
-						t.Errorf("Expected value %v not found in results", e.Value)
-					}
-				}
-				return
-			}
-
-			if len(result) != len(tt.expected) {
-				t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
-			}
-
-			// Validate both values and paths
-			for i, e := range tt.expected {
-				if i < len(result) {
-					if !reflect.DeepEqual(result[i].Value, e.Value) {
-						t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
-					}
-					if result[i].Path != e.Path {
-						t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
-					}
-				}
-			}
-		})
-	}
-}
-
-func TestEdgeCases(t *testing.T) {
-	t.Run("empty_data", func(t *testing.T) {
-		result, err := Get(nil, "$.a.b")
-		if err == nil {
-			t.Errorf("Expected error for empty data")
-			return
-		}
-		if len(result) > 0 {
-			t.Errorf("Expected empty result, got %v", result)
-		}
-	})
-
-	t.Run("empty_path", func(t *testing.T) {
-		_, err := ParseJSONPath("")
-		if err == nil {
-			t.Error("Expected error for empty path")
-		}
-	})
-
-	t.Run("numeric_keys", func(t *testing.T) {
-		data := map[string]interface{}{
-			"42": "answer",
-		}
-		result, err := Get(data, "$.42")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) == 0 || result[0].Value != "answer" {
-			t.Errorf("Expected 'answer', got %v", result)
-		}
-	})
-}
-
-func TestGetWithPaths(t *testing.T) {
-	tests := []struct {
-		name     string
-		path     string
-		expected []JSONNode
-	}{
-		{
-			name: "simple_property_access",
-			path: "$.store.bicycle.color",
-			expected: []JSONNode{
-				{Value: "red", Path: "$.store.bicycle.color"},
-			},
-		},
-		{
-			name: "array_index_access",
-			path: "$.store.book[0].title",
-			expected: []JSONNode{
-				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
-			},
-		},
-		{
-			name: "wildcard_array_access",
-			path: "$.store.book[*].title",
-			expected: []JSONNode{
-				{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
-				{Value: "The Two Towers", Path: "$.store.book[1].title"},
-			},
-		},
-		{
-			name: "recursive_price_search",
-			path: "$..price",
-			expected: []JSONNode{
-				{Value: 22.99, Path: "$.store.book[0].price"},
-				{Value: 23.45, Path: "$.store.book[1].price"},
-				{Value: 199.95, Path: "$.store.bicycle.price"},
-			},
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(testData, tt.path)
-			if err != nil {
-				t.Errorf("Get() returned error: %v", err)
-				return
-			}
-
-			// Check if lengths match
-			if len(result) != len(tt.expected) {
-				t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
-				return
-			}
-
-			// For each expected item, find its match in the results and verify both value and path
-			for _, expected := range tt.expected {
-				found := false
-				for _, r := range result {
-					// First verify the value matches
-					if reflect.DeepEqual(r.Value, expected.Value) {
-						found = true
-						// Then verify the path matches
-						if r.Path != expected.Path {
-							t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
-						}
-						break
-					}
-				}
-				if !found {
-					t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
-				}
-			}
-		})
-	}
-}

processor/processor.go

@@ -1,44 +1,17 @@
 package processor
 
 import (
-	"crypto/md5"
 	"fmt"
-	"os"
-	"path/filepath"
+	"io"
+	"net/http"
 	"strings"
-	"time"
 
-	"github.com/antchfx/xmlquery"
+	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
-
-	"modify/logger"
 )
 
-// Processor defines the interface for all file processors
-type Processor interface {
-	// Process handles processing a file with the given pattern and Lua expression
-	// Now implemented as a base function in processor.go
-	// Process(filename string, pattern string, luaExpr string) (int, int, error)
-
-	// ProcessContent handles processing a string content directly with the given pattern and Lua expression
-	// Returns the modified content, modification count, match count, and any error
-	ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
-
-	// ToLua converts processor-specific data to Lua variables
-	ToLua(L *lua.LState, data interface{}) error
-
-	// FromLua retrieves modified data from Lua
-	FromLua(L *lua.LState) (interface{}, error)
-}
-
-// ModificationRecord tracks a single value modification
-type ModificationRecord struct {
-	File      string
-	OldValue  string
-	NewValue  string
-	Operation string
-	Context   string
-}
+// Maybe we make this an interface again for the shits and giggles
+// We will see, it could easily be...
 
 func NewLuaState() (*lua.LState, error) {
 	L := lua.NewState()
@@ -63,180 +36,73 @@ func NewLuaState() (*lua.LState, error) {
 	return L, nil
 }
 
-func Process(p Processor, filename string, pattern string, luaExpr string) (int, int, error) {
-	logger.Debug("Processing file %q with pattern %q", filename, pattern)
-
-	// Read file content
-	cwd, err := os.Getwd()
-	if err != nil {
-		logger.Error("Failed to get current working directory: %v", err)
-		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
-	}
-
-	fullPath := filepath.Join(cwd, filename)
-	logger.Trace("Reading file from: %s", fullPath)
-
-	stat, err := os.Stat(fullPath)
-	if err != nil {
-		logger.Error("Failed to stat file %s: %v", fullPath, err)
-		return 0, 0, fmt.Errorf("error getting file info: %v", err)
-	}
-	logger.Debug("File size: %d bytes, modified: %s", stat.Size(), stat.ModTime().Format(time.RFC3339))
-
-	content, err := os.ReadFile(fullPath)
-	if err != nil {
-		logger.Error("Failed to read file %s: %v", fullPath, err)
-		return 0, 0, fmt.Errorf("error reading file: %v", err)
-	}
-
-	fileContent := string(content)
-	logger.Trace("File read successfully: %d bytes, hash: %x", len(content), md5sum(content))
-
-	// Detect and log file type
-	fileType := detectFileType(filename, fileContent)
-	if fileType != "" {
-		logger.Debug("Detected file type: %s", fileType)
-	}
-
-	// Process the content
-	logger.Debug("Starting content processing with %s processor", getProcessorType(p))
-	modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
-	if err != nil {
-		logger.Error("Processing error: %v", err)
-		return 0, 0, err
-	}
-
-	logger.Debug("Processing results: %d matches, %d modifications", matchCount, modCount)
-
-	// If we made modifications, save the file
-	if modCount > 0 {
-		// Calculate changes summary
-		changePercent := float64(len(modifiedContent)) / float64(len(fileContent)) * 100
-		logger.Info("File size change: %d → %d bytes (%.1f%%)",
-			len(fileContent), len(modifiedContent), changePercent)
-
-		logger.Debug("Writing modified content to %s", fullPath)
-		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
-		if err != nil {
-			logger.Error("Failed to write to file %s: %v", fullPath, err)
-			return 0, 0, fmt.Errorf("error writing file: %v", err)
-		}
-		logger.Debug("File written successfully, new hash: %x", md5sum([]byte(modifiedContent)))
-	} else if matchCount > 0 {
-		logger.Debug("No content modifications needed for %d matches", matchCount)
-	} else {
-		logger.Debug("No matches found in file")
-	}
-
-	return modCount, matchCount, nil
-}
-
-// Helper function to get a short MD5 hash of content for logging
-func md5sum(data []byte) []byte {
-	h := md5.New()
-	h.Write(data)
-	return h.Sum(nil)[:4] // Just use first 4 bytes for brevity
-}
-
-// Helper function to detect basic file type from extension and content
-func detectFileType(filename string, content string) string {
-	ext := strings.ToLower(filepath.Ext(filename))
-
-	switch ext {
-	case ".xml":
-		return "XML"
-	case ".json":
-		return "JSON"
-	case ".html", ".htm":
-		return "HTML"
-	case ".txt":
-		return "Text"
-	case ".go":
-		return "Go"
-	case ".js":
-		return "JavaScript"
-	case ".py":
-		return "Python"
-	case ".java":
-		return "Java"
-	case ".c", ".cpp", ".h":
-		return "C/C++"
-	default:
-		// Try content-based detection for common formats
-		if strings.HasPrefix(strings.TrimSpace(content), "<?xml") {
-			return "XML"
-		}
-		if strings.HasPrefix(strings.TrimSpace(content), "{") ||
-			strings.HasPrefix(strings.TrimSpace(content), "[") {
-			return "JSON"
-		}
-		if strings.HasPrefix(strings.TrimSpace(content), "<!DOCTYPE html") ||
-			strings.HasPrefix(strings.TrimSpace(content), "<html") {
-			return "HTML"
-		}
-		return ""
-	}
-}
-
-// Helper function to get processor type name
-func getProcessorType(p Processor) string {
-	switch p.(type) {
-	case *RegexProcessor:
-		return "Regex"
-	case *XMLProcessor:
-		return "XML"
-	case *JSONProcessor:
-		return "JSON"
-	default:
-		return "Unknown"
-	}
-}
-
-// ToLua converts a struct or map to a Lua table recursively
-func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
-	switch v := data.(type) {
-	case *xmlquery.Node:
-		luaTable := L.NewTable()
-		luaTable.RawSetString("text", lua.LString(v.Data))
-		// Should be a map, simple key value pairs
-		attr, err := ToLua(L, v.Attr)
-		if err != nil {
-			return nil, err
-		}
-		luaTable.RawSetString("attr", attr)
-		return luaTable, nil
-	case map[string]interface{}:
-		luaTable := L.NewTable()
-		for key, value := range v {
-			luaValue, err := ToLua(L, value)
-			if err != nil {
-				return nil, err
-			}
-			luaTable.RawSetString(key, luaValue)
-		}
-		return luaTable, nil
-	case []interface{}:
-		luaTable := L.NewTable()
-		for i, value := range v {
-			luaValue, err := ToLua(L, value)
-			if err != nil {
-				return nil, err
-			}
-			luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
-		}
-		return luaTable, nil
-	case string:
-		return lua.LString(v), nil
-	case bool:
-		return lua.LBool(v), nil
-	case float64:
-		return lua.LNumber(v), nil
-	case nil:
-		return lua.LNil, nil
-	default:
-		return nil, fmt.Errorf("unsupported data type: %T", data)
-	}
-}
+// func Process(filename string, pattern string, luaExpr string) (int, int, error) {
+// 	logger.Debug("Processing file %q with pattern %q", filename, pattern)
+//
+// 	// Read file content
+// 	cwd, err := os.Getwd()
+// 	if err != nil {
+// 		logger.Error("Failed to get current working directory: %v", err)
+// 		return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
+// 	}
+//
+// 	fullPath := filepath.Join(cwd, filename)
+// 	logger.Trace("Reading file from: %s", fullPath)
+//
+// 	stat, err := os.Stat(fullPath)
+// 	if err != nil {
+// 		logger.Error("Failed to stat file %s: %v", fullPath, err)
+// 		return 0, 0, fmt.Errorf("error getting file info: %v", err)
+// 	}
+// 	logger.Debug("File size: %d bytes, modified: %s", stat.Size(), stat.ModTime().Format(time.RFC3339))
+//
+// 	content, err := os.ReadFile(fullPath)
+// 	if err != nil {
+// 		logger.Error("Failed to read file %s: %v", fullPath, err)
+// 		return 0, 0, fmt.Errorf("error reading file: %v", err)
+// 	}
+//
+// 	fileContent := string(content)
+// 	logger.Trace("File read successfully: %d bytes, hash: %x", len(content), md5sum(content))
+//
+// 	// Detect and log file type
+// 	fileType := detectFileType(filename, fileContent)
+// 	if fileType != "" {
+// 		logger.Debug("Detected file type: %s", fileType)
+// 	}
+//
+// 	// Process the content
+// 	logger.Debug("Starting content processing")
+// 	modifiedContent, modCount, matchCount, err := ProcessContent(fileContent, pattern, luaExpr)
+// 	if err != nil {
+// 		logger.Error("Processing error: %v", err)
+// 		return 0, 0, err
+// 	}
+//
+// 	logger.Debug("Processing results: %d matches, %d modifications", matchCount, modCount)
+//
+// 	// If we made modifications, save the file
+// 	if modCount > 0 {
+// 		// Calculate changes summary
+// 		changePercent := float64(len(modifiedContent)) / float64(len(fileContent)) * 100
+// 		logger.Info("File size change: %d → %d bytes (%.1f%%)",
+// 			len(fileContent), len(modifiedContent), changePercent)
+//
+// 		logger.Debug("Writing modified content to %s", fullPath)
+// 		err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
+// 		if err != nil {
+// 			logger.Error("Failed to write to file %s: %v", fullPath, err)
+// 			return 0, 0, fmt.Errorf("error writing file: %v", err)
+// 		}
+// 		logger.Debug("File written successfully, new hash: %x", md5sum([]byte(modifiedContent)))
+// 	} else if matchCount > 0 {
+// 		logger.Debug("No content modifications needed for %d matches", matchCount)
+// 	} else {
+// 		logger.Debug("No matches found in file")
+// 	}
+//
+// 	return modCount, matchCount, nil
+// }
 
 // FromLua converts a Lua table to a struct or map recursively
 func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
@@ -313,6 +179,39 @@ function ceil(x) return math.ceil(x) end
 function upper(s) return string.upper(s) end
 function lower(s) return string.lower(s) end
 function format(s, ...) return string.format(s, ...) end
+function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
+
+-- String split helper
+function strsplit(inputstr, sep)
+  if sep == nil then
+    sep = "%s"
+  end
+  local t = {}
+  for str in string.gmatch(inputstr, "([^"..sep.."]+)") do
+    table.insert(t, str)
+  end
+  return t
+end
+
+---@param table table
+---@param depth number?
+function DumpTable(table, depth)
+	if depth == nil then
+		depth = 0
+	end
+	if (depth > 200) then
+		print("Error: Depth > 200 in dumpTable()")
+		return
+	end
+	for k, v in pairs(table) do
+		if (type(v) == "table") then
+			print(string.rep("  ", depth) .. k .. ":")
+			DumpTable(v, depth + 1)
+		else
+			print(string.rep("  ", depth) .. k .. ": ", v)
+		end
+	end
+end
 
 -- String to number conversion helper
 function num(str)
@@ -352,11 +251,10 @@ modified = false
 
 	logger.Debug("Setting up Lua print function to Go")
 	L.SetGlobal("print", L.NewFunction(printToGo))
+	L.SetGlobal("fetch", L.NewFunction(fetch))
 	return nil
 }
 
-// Helper utility functions
-
 // LimitString truncates a string to maxLen and adds "..." if truncated
 func LimitString(s string, maxLen int) string {
 	s = strings.ReplaceAll(s, "\n", "\\n")
@@ -412,27 +310,107 @@ func BuildLuaScript(luaExpr string) string {
 
 func printToGo(L *lua.LState) int {
 	top := L.GetTop()
+
 	args := make([]interface{}, top)
 	for i := 1; i <= top; i++ {
 		args[i-1] = L.Get(i)
 	}
-	message := fmt.Sprint(args...)
-	logger.Info("[Lua] %s", message)
+
+	// Format the message with proper spacing between arguments
+	var parts []string
+	for _, arg := range args {
+		parts = append(parts, fmt.Sprintf("%v", arg))
+	}
+	message := strings.Join(parts, " ")
+
+	// Use the LUA log level with a script tag
+	logger.Lua("%s", message)
 	return 0
 }
 
-// Max returns the maximum of two integers
-func Max(a, b int) int {
-	if a > b {
-		return a
+func fetch(L *lua.LState) int {
+	// Get URL from first argument
+	url := L.ToString(1)
+	if url == "" {
+		L.Push(lua.LNil)
+		L.Push(lua.LString("URL is required"))
+		return 2
 	}
-	return b
-}
 
-// Min returns the minimum of two integers
-func Min(a, b int) int {
-	if a < b {
-		return a
+	// Get options from second argument if provided
+	var method string = "GET"
+	var headers map[string]string = make(map[string]string)
+	var body string = ""
+
+	if L.GetTop() > 1 {
+		options := L.ToTable(2)
+		if options != nil {
+			// Get method
+			if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
+				method = methodVal.String()
+			}
+
+			// Get headers
+			if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
+				if headersTable, ok := headersVal.(*lua.LTable); ok {
+					headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
+						headers[key.String()] = value.String()
+					})
+				}
+			}
+
+			// Get body
+			if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
+				body = bodyVal.String()
+			}
+		}
 	}
-	return b
+
+	// Create HTTP request
+	req, err := http.NewRequest(method, url, strings.NewReader(body))
+	if err != nil {
+		L.Push(lua.LNil)
+		L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
+		return 2
+	}
+
+	// Set headers
+	for key, value := range headers {
+		req.Header.Set(key, value)
+	}
+
+	// Make request
+	client := &http.Client{}
+	resp, err := client.Do(req)
+	if err != nil {
+		L.Push(lua.LNil)
+		L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
+		return 2
+	}
+	defer resp.Body.Close()
+
+	// Read response body
+	bodyBytes, err := io.ReadAll(resp.Body)
+	if err != nil {
+		L.Push(lua.LNil)
+		L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
+		return 2
+	}
+
+	// Create response table
+	responseTable := L.NewTable()
+	responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
+	responseTable.RawSetString("statusText", lua.LString(resp.Status))
+	responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
+	responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
+
+	// Set headers in response
+	headersTable := L.NewTable()
+	for key, values := range resp.Header {
+		headersTable.RawSetString(key, lua.LString(values[0]))
+	}
+	responseTable.RawSetString("headers", headersTable)
+
+	L.Push(responseTable)
+	return 1
 }

processor/regex.go

@@ -1,145 +1,97 @@
 package processor
 
 import (
+	"cook/utils"
 	"fmt"
 	"regexp"
-	"sort"
 	"strconv"
 	"strings"
+	"time"
 
+	logger "git.site.quack-lab.dev/dave/cylogger"
 	lua "github.com/yuin/gopher-lua"
-
-	"modify/logger"
 )
 
-// RegexProcessor implements the Processor interface using regex patterns
-type RegexProcessor struct{}
-
-// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
-func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
-	captureGroups, ok := data.([]*CaptureGroup)
-	if !ok {
-		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
-	}
-
-	groupindex := 0
-	for _, capture := range captureGroups {
-		if capture.Name == "" {
-			// We don't want to change the name of the capture group
-			// Even if it's empty
-			tempName := fmt.Sprintf("%d", groupindex+1)
-			groupindex++
-
-			L.SetGlobal("s"+tempName, lua.LString(capture.Value))
-
-			val, err := strconv.ParseFloat(capture.Value, 64)
-			if err == nil {
-				L.SetGlobal("v"+tempName, lua.LNumber(val))
-			}
-		} else {
-			val, err := strconv.ParseFloat(capture.Value, 64)
-			if err == nil {
-				L.SetGlobal(capture.Name, lua.LNumber(val))
-			} else {
-				L.SetGlobal(capture.Name, lua.LString(capture.Value))
-			}
-		}
-	}
-
-	return nil
-}
-
-func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
-	// Stub to satisfy interface
-	return nil, nil
-}
-
-// FromLua implements the Processor interface for RegexProcessor
-func (p *RegexProcessor) FromLuaCustom(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
-	captureIndex := 0
-	for _, capture := range captureGroups {
-		if capture.Name == "" {
-			capture.Name = fmt.Sprintf("%d", captureIndex+1)
-
-			vVarName := fmt.Sprintf("v%s", capture.Name)
-			sVarName := fmt.Sprintf("s%s", capture.Name)
-			captureIndex++
-
-			vLuaVal := L.GetGlobal(vVarName)
-			sLuaVal := L.GetGlobal(sVarName)
-
-			if sLuaVal.Type() == lua.LTString {
-				capture.Updated = sLuaVal.String()
-			}
-			// Numbers have priority
-			if vLuaVal.Type() == lua.LTNumber {
-				capture.Updated = vLuaVal.String()
-			}
-		} else {
-			// Easy shit
-			capture.Updated = L.GetGlobal(capture.Name).String()
-		}
-	}
-
-	return captureGroups, nil
-}
-
 type CaptureGroup struct {
 	Name    string
 	Value   string
 	Updated string
 	Range   [2]int
 }
-type ReplaceCommand struct {
-	From int
-	To   int
-	With string
-}
 
 // ProcessContent applies regex replacement with Lua processing
-func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
-	pattern = ResolveRegexPlaceholders(pattern)
+// The filename here exists ONLY so we can pass it to the lua environment
+// It's not used for anything else
+func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
+	var commands []utils.ReplaceCommand
+	logger.Trace("Processing regex: %q", command.Regex)
+
+	// Start timing the regex processing
+	startTime := time.Now()
+
+	// We don't HAVE to do this multiple times for a pattern
+	// But it's quick enough for us to not care
+	pattern := resolveRegexPlaceholders(command.Regex)
+	// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
+	// But it's a compromise that allows us to use | in yaml
+	// Otherwise we would have to escape every god damn pair of quotation marks
+	// And a bunch of other shit
+	pattern = strings.TrimSpace(pattern)
 	logger.Debug("Compiling regex pattern: %s", pattern)
+
+	patternCompileStart := time.Now()
 	compiledPattern, err := regexp.Compile(pattern)
 	if err != nil {
 		logger.Error("Error compiling pattern: %v", err)
-		return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
+		return commands, fmt.Errorf("error compiling pattern: %v", err)
 	}
-	logger.Debug("Compiled pattern successfully: %s", pattern)
+	logger.Debug("Compiled pattern successfully in %v: %s", time.Since(patternCompileStart), pattern)
 
-	previous := luaExpr
-	luaExpr = BuildLuaScript(luaExpr)
+	// Same here, it's just string concatenation, it won't kill us
+	// More important is that we don't fuck up the command
+	// But we shouldn't be able to since it's passed by value
+	previous := command.Lua
+	luaExpr := BuildLuaScript(command.Lua)
 	logger.Debug("Transformed Lua expression: %q → %q", previous, luaExpr)
 
-	// Initialize Lua environment
-	modificationCount := 0
-
 	// Process all regex matches
-	result := content
+	matchFindStart := time.Now()
 	indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
-	logger.Debug("Found %d matches in content of length %d", len(indices), len(content))
+	matchFindDuration := time.Since(matchFindStart)
+
+	logger.Debug("Found %d matches in content of length %d (search took %v)",
+		len(indices), len(content), matchFindDuration)
+
+	// Log pattern complexity metrics
+	patternComplexity := estimatePatternComplexity(pattern)
+	logger.Debug("Pattern complexity estimate: %d", patternComplexity)
+
+	if len(indices) == 0 {
+		logger.Warning("No matches found for regex: %q", pattern)
+		logger.Debug("Total regex processing time: %v", time.Since(startTime))
+		return commands, nil
+	}
 
 	// We walk backwards because we're replacing something with something else that might be longer
 	// And in the case it is longer than the original all indicces past that change will be fucked up
 	// By going backwards we fuck up all the indices to the end of the file that we don't care about
 	// Because there either aren't any (last match) or they're already modified (subsequent matches)
-	for i := len(indices) - 1; i >= 0; i-- {
+	for i, matchIndices := range indices {
 		logger.Debug("Processing match %d of %d", i+1, len(indices))
+		logger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
 
 		L, err := NewLuaState()
 		if err != nil {
 			logger.Error("Error creating Lua state: %v", err)
-			return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
+			return commands, fmt.Errorf("error creating Lua state: %v", err)
 		}
+		L.SetGlobal("file", lua.LString(filename))
 		// Hmm... Maybe we don't want to defer this..
 		// Maybe we want to close them every iteration
 		// We'll leave it as is for now
 		defer L.Close()
 		logger.Trace("Lua state created successfully for match %d", i+1)
 
-		matchIndices := indices[i]
-		logger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
-
 		// Why we're doing this whole song and dance of indices is to properly handle empty matches
 		// Plus it's a little cleaner to surgically replace our matches
 		// If we were to use string.replace and encountered an empty match there'd be nothing to replace
@@ -208,7 +160,13 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
 			}
 		}
 
-		if err := p.ToLua(L, captureGroups); err != nil {
+		// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
+		if !command.NoDedup {
+			logger.Debug("Deduplicating capture groups as specified in command settings")
+			captureGroups = deduplicateGroups(captureGroups)
+		}
+
+		if err := toLua(L, captureGroups); err != nil {
 			logger.Error("Failed to set Lua variables: %v", err)
 			continue
 		}
@@ -222,7 +180,7 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
 		logger.Trace("Lua script executed successfully")
 
 		// Get modifications from Lua
-		captureGroups, err = p.FromLuaCustom(L, captureGroups)
+		captureGroups, err = fromLua(L, captureGroups)
 		if err != nil {
 			logger.Error("Failed to retrieve modifications from Lua: %v", err)
 			continue
@@ -244,7 +202,6 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
 		}
 
 		if replacement == "" {
-			commands := make([]ReplaceCommand, 0, len(captureGroups))
 			// Apply the modifications to the original match
 			replacement = match
 
@@ -255,54 +212,62 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
 					modifiedGroups++
 				}
 			}
-			logger.Debug("%d of %d capture groups were modified", modifiedGroups, len(captureGroups))
+			logger.Info("%d of %d capture groups identified for modification", modifiedGroups, len(captureGroups))
 
 			for _, capture := range captureGroups {
 				if capture.Value == capture.Updated {
-					logger.Trace("Capture group unchanged: %s", capture.Value)
+					logger.Info("Capture group unchanged: %s", LimitString(capture.Value, 50))
 					continue
 				}
 
 				// Log what changed with context
-				logger.Debug("Modifying group %s: %q → %q",
+				logger.Debug("Capture group %s scheduled for modification: %q → %q",
 					capture.Name, capture.Value, capture.Updated)
 
 				// Indices of the group are relative to content
 				// To relate them to match we have to subtract the match start index
 				// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
-				commands = append(commands, ReplaceCommand{
-					From: capture.Range[0] - matchIndices[0],
-					To:   capture.Range[1] - matchIndices[0],
+				commands = append(commands, utils.ReplaceCommand{
+					From: capture.Range[0],
+					To:   capture.Range[1],
 					With: capture.Updated,
 				})
 			}
-
-			// Sort commands in reverse order for safe replacements
-			sort.Slice(commands, func(i, j int) bool {
-				return commands[i].From > commands[j].From
+		} else {
+			commands = append(commands, utils.ReplaceCommand{
+				From: matchIndices[0],
+				To:   matchIndices[1],
+				With: replacement,
 			})
-			logger.Trace("Applying %d replacement commands in reverse order", len(commands))
-
-			for _, command := range commands {
-				logger.Trace("Replace pos %d-%d with %q", command.From, command.To, command.With)
-				replacement = replacement[:command.From] + command.With + replacement[command.To:]
-			}
 		}
-
-		// Preview the replacement for logging
-		replacementPreview := replacement
-		if len(replacement) > 50 {
-			replacementPreview = replacement[:47] + "..."
-		}
-		logger.Debug("Replacing match %q with %q", matchPreview, replacementPreview)
-
-		modificationCount++
-		result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
-		logger.Debug("Match #%d processed, running modification count: %d", i+1, modificationCount)
 	}
 
-	logger.Info("Regex processing complete: %d modifications from %d matches", modificationCount, len(indices))
-	return result, modificationCount, len(indices), nil
+	logger.Debug("Total regex processing time: %v", time.Since(startTime))
+	return commands, nil
+}
+
+func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
+	deduplicatedGroups := make([]*CaptureGroup, 0)
+	for _, group := range captureGroups {
+		overlaps := false
+		logger.Debug("Checking capture group: %s with range %v", group.Name, group.Range)
+		for _, existingGroup := range deduplicatedGroups {
+			logger.Debug("Comparing with existing group: %s with range %v", existingGroup.Name, existingGroup.Range)
+			if group.Range[0] < existingGroup.Range[1] && group.Range[1] > existingGroup.Range[0] {
+				overlaps = true
+				logger.Warning("Detected overlap between capture group '%s' and existing group '%s' in range %v-%v and %v-%v", group.Name, existingGroup.Name, group.Range[0], group.Range[1], existingGroup.Range[0], existingGroup.Range[1])
+				break
+			}
+		}
+		if overlaps {
+			// We CAN just continue despite this fuckup
+			logger.Warning("Overlapping capture group: %s", group.Name)
+			continue
+		}
+		logger.Debug("No overlap detected for capture group: %s. Adding to deduplicated groups.", group.Name)
+		deduplicatedGroups = append(deduplicatedGroups, group)
+	}
+	return deduplicatedGroups
 }
 
 // The order of these replaces is important
@@ -310,12 +275,10 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
 // If it were not here our !num in a named capture group would
 // Expand to another capture group in the capture group
 // We really only want one (our named) capture group
-func ResolveRegexPlaceholders(pattern string) string {
+func resolveRegexPlaceholders(pattern string) string {
 	// Handle special pattern modifications
 	if !strings.HasPrefix(pattern, "(?s)") {
 		pattern = "(?s)" + pattern
-		// Use fmt.Printf for test compatibility
-		fmt.Printf("Pattern modified to include (?s): %s\n", pattern)
 	}
 
 	namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
@@ -327,7 +290,7 @@ func ResolveRegexPlaceholders(pattern string) string {
 		replacement := `-?\d*\.?\d+`
 		return parts[1] + replacement
 	})
-	pattern = strings.ReplaceAll(pattern, "!num", `"?(-?\d*\.?\d+)"?`)
+	pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
 	pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
 	repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
 	// !rep(pattern, count) repeats the pattern n times
@@ -344,3 +307,85 @@ func ResolveRegexPlaceholders(pattern string) string {
 	})
 	return pattern
 }
+
+// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
+func toLua(L *lua.LState, data interface{}) error {
+	captureGroups, ok := data.([]*CaptureGroup)
+	if !ok {
+		return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
+	}
+
+	groupindex := 0
+	for _, capture := range captureGroups {
+		if capture.Name == "" {
+			// We don't want to change the name of the capture group
+			// Even if it's empty
+			tempName := fmt.Sprintf("%d", groupindex+1)
+			groupindex++
+
+			L.SetGlobal("s"+tempName, lua.LString(capture.Value))
+
+			val, err := strconv.ParseFloat(capture.Value, 64)
+			if err == nil {
+				L.SetGlobal("v"+tempName, lua.LNumber(val))
+			}
+		} else {
+			val, err := strconv.ParseFloat(capture.Value, 64)
+			if err == nil {
+				L.SetGlobal(capture.Name, lua.LNumber(val))
+			} else {
+				L.SetGlobal(capture.Name, lua.LString(capture.Value))
+			}
+		}
+	}
+
+	return nil
+}
+
+// FromLua implements the Processor interface for RegexProcessor
+func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
+	captureIndex := 0
+	for _, capture := range captureGroups {
+		if capture.Name == "" {
+			capture.Name = fmt.Sprintf("%d", captureIndex+1)
+
+			vVarName := fmt.Sprintf("v%s", capture.Name)
+			sVarName := fmt.Sprintf("s%s", capture.Name)
+			captureIndex++
+
+			vLuaVal := L.GetGlobal(vVarName)
+			sLuaVal := L.GetGlobal(sVarName)
+
+			if sLuaVal.Type() == lua.LTString {
+				capture.Updated = sLuaVal.String()
+			}
+			// Numbers have priority
+			if vLuaVal.Type() == lua.LTNumber {
+				capture.Updated = vLuaVal.String()
+			}
+		} else {
+			// Easy shit
+			capture.Updated = L.GetGlobal(capture.Name).String()
+		}
+	}
+
+	return captureGroups, nil
+}
+
+// estimatePatternComplexity gives a rough estimate of regex pattern complexity
+// This can help identify potentially problematic patterns
+func estimatePatternComplexity(pattern string) int {
+	complexity := len(pattern)
+
+	// Add complexity for potentially expensive operations
+	complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
+	complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
+	complexity += strings.Count(pattern, "[^") * 3  // Negated character class
+	complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
+	complexity += strings.Count(pattern, "(") * 2   // Capture groups
+	complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
+	complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
+	complexity += strings.Count(pattern, "{") * 2   // Counted repetition
+
+	return complexity
+}

processor/test_helper.go

@@ -2,8 +2,9 @@ package processor
 
 import (
 	"io"
-	"modify/logger"
 	"os"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
 )
 
 func init() {
@@ -20,7 +21,7 @@ func init() {
 		if disableTestLogs {
 			// Create a new logger that writes to nowhere
 			silentLogger := logger.New(io.Discard, "", 0)
-			logger.DefaultLogger = silentLogger
+			logger.Default = silentLogger
 		}
 	}
 }

processor/xml.go

@@ -1,434 +0,0 @@
-package processor
-
-import (
-	"fmt"
-	"modify/logger"
-	"modify/processor/xpath"
-	"strings"
-
-	"github.com/antchfx/xmlquery"
-	lua "github.com/yuin/gopher-lua"
-)
-
-// XMLProcessor implements the Processor interface for XML documents
-type XMLProcessor struct{}
-
-// ProcessContent implements the Processor interface for XMLProcessor
-func (p *XMLProcessor) ProcessContent(content string, path string, luaExpr string) (string, int, int, error) {
-	logger.Debug("Processing XML content with XPath: %s", path)
-
-	// Parse XML document
-	// We can't really use encoding/xml here because it requires a pre defined struct
-	// And we HAVE TO parse dynamic unknown XML
-	logger.Trace("Parsing XML document")
-	doc, err := xmlquery.Parse(strings.NewReader(content))
-	if err != nil {
-		logger.Error("Failed to parse XML: %v", err)
-		return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
-	}
-
-	// Find nodes matching the XPath pattern
-	logger.Debug("Executing XPath query: %s", path)
-	nodes, err := xpath.Get(doc, path)
-	if err != nil {
-		logger.Error("Failed to execute XPath: %v", err)
-		return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
-	}
-
-	matchCount := len(nodes)
-	logger.Debug("Found %d nodes matching XPath", matchCount)
-	if matchCount == 0 {
-		logger.Warning("No nodes matched the XPath pattern: %s", path)
-		return content, 0, 0, nil
-	}
-
-	// Apply modifications to each node
-	modCount := 0
-	for i, node := range nodes {
-		logger.Trace("Processing node #%d: %s", i+1, node.Data)
-
-		L, err := NewLuaState()
-		if err != nil {
-			logger.Error("Failed to create Lua state: %v", err)
-			return content, 0, 0, fmt.Errorf("error creating Lua state: %v", err)
-		}
-		defer L.Close()
-
-		logger.Trace("Converting XML node to Lua")
-		err = p.ToLua(L, node)
-		if err != nil {
-			logger.Error("Failed to convert XML node to Lua: %v", err)
-			return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
-		}
-
-		luaScript := BuildLuaScript(luaExpr)
-		logger.Trace("Executing Lua script: %s", luaScript)
-		err = L.DoString(luaScript)
-		if err != nil {
-			logger.Error("Failed to execute Lua script: %v", err)
-			return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
-		}
-
-		result, err := p.FromLua(L)
-		if err != nil {
-			logger.Error("Failed to get result from Lua: %v", err)
-			return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
-		}
-		logger.Trace("Lua returned result: %#v", result)
-
-		modified := false
-		modified = L.GetGlobal("modified").String() == "true"
-		if !modified {
-			logger.Debug("No changes made to node at path: %s", node.Data)
-			continue
-		}
-
-		// Apply modification based on the result
-		if updatedValue, ok := result.(string); ok {
-			// If the result is a simple string, update the node value directly
-			logger.Debug("Updating node with string value: %s", updatedValue)
-			xpath.Set(doc, path, updatedValue)
-		} else if nodeData, ok := result.(map[string]interface{}); ok {
-			// If the result is a map, apply more complex updates
-			logger.Debug("Updating node with complex data structure")
-			updateNodeFromMap(node, nodeData)
-		}
-
-		modCount++
-		logger.Debug("Successfully modified node #%d", i+1)
-	}
-
-	logger.Info("XML processing complete: %d modifications from %d matches", modCount, matchCount)
-
-	// Serialize the modified XML document to string
-	if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
-		// If we have an XML declaration, start with it
-		declaration := doc.FirstChild.OutputXML(true)
-		// Remove the firstChild (declaration) before serializing the rest of the document
-		doc.FirstChild = doc.FirstChild.NextSibling
-		return ConvertToNamedEntities(declaration + doc.OutputXML(true)), modCount, matchCount, nil
-	}
-
-	// Convert numeric entities to named entities for better readability
-	return ConvertToNamedEntities(doc.OutputXML(true)), modCount, matchCount, nil
-}
-
-func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
-	table, err := p.ToLuaTable(L, data)
-	if err != nil {
-		return err
-	}
-	L.SetGlobal("v", table)
-	return nil
-}
-
-// ToLua converts XML node values to Lua variables
-func (p *XMLProcessor) ToLuaTable(L *lua.LState, data interface{}) (lua.LValue, error) {
-	// Check if data is an xmlquery.Node
-	node, ok := data.(*xmlquery.Node)
-	if !ok {
-		return nil, fmt.Errorf("expected xmlquery.Node, got %T", data)
-	}
-
-	// Create a simple table with essential data
-	table := L.NewTable()
-
-	// For element nodes, just provide basic info
-	L.SetField(table, "type", lua.LString(nodeTypeToString(node.Type)))
-	L.SetField(table, "name", lua.LString(node.Data))
-	L.SetField(table, "value", lua.LString(node.InnerText()))
-
-	// Add children if any
-	children := L.NewTable()
-	for child := node.FirstChild; child != nil; child = child.NextSibling {
-		childTable, err := p.ToLuaTable(L, child)
-		if err == nil {
-			children.Append(childTable)
-		}
-	}
-	L.SetField(table, "children", children)
-
-	attrs := L.NewTable()
-	if len(node.Attr) > 0 {
-		for _, attr := range node.Attr {
-			L.SetField(attrs, attr.Name.Local, lua.LString(attr.Value))
-		}
-	}
-	L.SetField(table, "attr", attrs)
-
-	return table, nil
-}
-
-// FromLua gets modified values from Lua
-func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
-	luaValue := L.GetGlobal("v")
-
-	// Handle string values directly
-	if luaValue.Type() == lua.LTString {
-		return luaValue.String(), nil
-	}
-
-	// Handle tables (for attributes and more complex updates)
-	if luaValue.Type() == lua.LTTable {
-		return luaTableToMap(L, luaValue.(*lua.LTable)), nil
-	}
-
-	return luaValue.String(), nil
-}
-
-// Simple helper to convert a Lua table to a Go map
-func luaTableToMap(L *lua.LState, table *lua.LTable) map[string]interface{} {
-	result := make(map[string]interface{})
-
-	table.ForEach(func(k, v lua.LValue) {
-		if k.Type() == lua.LTString {
-			key := k.String()
-
-			if v.Type() == lua.LTTable {
-				result[key] = luaTableToMap(L, v.(*lua.LTable))
-			} else {
-				result[key] = v.String()
-			}
-		}
-	})
-
-	return result
-}
-
-// Simple helper to convert node type to string
-func nodeTypeToString(nodeType xmlquery.NodeType) string {
-	switch nodeType {
-	case xmlquery.ElementNode:
-		return "element"
-	case xmlquery.TextNode:
-		return "text"
-	case xmlquery.AttributeNode:
-		return "attribute"
-	default:
-		return "other"
-	}
-}
-
-// Helper function to update an XML node from a map
-func updateNodeFromMap(node *xmlquery.Node, data map[string]interface{}) {
-	// Update node value if present
-	if value, ok := data["value"]; ok {
-		if strValue, ok := value.(string); ok {
-			// For element nodes, replace text content
-			if node.Type == xmlquery.ElementNode {
-				// Find the first text child if it exists
-				var textNode *xmlquery.Node
-				for child := node.FirstChild; child != nil; child = child.NextSibling {
-					if child.Type == xmlquery.TextNode {
-						textNode = child
-						break
-					}
-				}
-
-				if textNode != nil {
-					// Update existing text node
-					textNode.Data = strValue
-				} else {
-					// Create new text node
-					newText := &xmlquery.Node{
-						Type:   xmlquery.TextNode,
-						Data:   strValue,
-						Parent: node,
-					}
-
-					// Insert at beginning of children
-					if node.FirstChild != nil {
-						newText.NextSibling = node.FirstChild
-						node.FirstChild.PrevSibling = newText
-						node.FirstChild = newText
-					} else {
-						node.FirstChild = newText
-						node.LastChild = newText
-					}
-				}
-			} else if node.Type == xmlquery.TextNode {
-				// Directly update text node
-				node.Data = strValue
-			} else if node.Type == xmlquery.AttributeNode {
-				// Update attribute value
-				if node.Parent != nil {
-					for i, attr := range node.Parent.Attr {
-						if attr.Name.Local == node.Data {
-							node.Parent.Attr[i].Value = strValue
-							break
-						}
-					}
-				}
-			}
-		}
-	}
-
-	// Update attributes if present
-	if attrs, ok := data["attr"].(map[string]interface{}); ok && node.Type == xmlquery.ElementNode {
-		for name, value := range attrs {
-			if strValue, ok := value.(string); ok {
-				// Look for existing attribute
-				found := false
-				for i, attr := range node.Attr {
-					if attr.Name.Local == name {
-						node.Attr[i].Value = strValue
-						found = true
-						break
-					}
-				}
-
-				// Add new attribute if not found
-				if !found {
-					node.Attr = append(node.Attr, xmlquery.Attr{
-						Name: struct {
-							Space, Local string
-						}{Local: name},
-						Value: strValue,
-					})
-				}
-			}
-		}
-	}
-}
-
-// Helper function to get a string representation of node type
-func nodeTypeName(nodeType xmlquery.NodeType) string {
-	switch nodeType {
-	case xmlquery.ElementNode:
-		return "element"
-	case xmlquery.TextNode:
-		return "text"
-	case xmlquery.AttributeNode:
-		return "attribute"
-	case xmlquery.CommentNode:
-		return "comment"
-	case xmlquery.DeclarationNode:
-		return "declaration"
-	default:
-		return "unknown"
-	}
-}
-
-// ConvertToNamedEntities replaces numeric XML entities with their named counterparts
-func ConvertToNamedEntities(xml string) string {
-	// Basic XML entities
-	replacements := map[string]string{
-		// Basic XML entities
-		""": """, // double quote
-		"'": "'", // single quote
-		"<": "<",   // less than
-		">": ">",   // greater than
-		"&": "&",  // ampersand
-
-		// Common symbols
-		" ":  " ",   // non-breaking space
-		"©":  "©",   // copyright
-		"®":  "®",    // registered trademark
-		"€": "€",   // euro
-		"£":  "£",  // pound
-		"¥":  "¥",    // yen
-		"¢":  "¢",   // cent
-		"§":  "§",   // section
-		"™": "™",  // trademark
-		"♠": "♠", // spade
-		"♣": "♣",  // club
-		"♥": "♥", // heart
-		"♦": "♦",  // diamond
-
-		// Special characters
-		"¡":  "¡",  // inverted exclamation
-		"¿":  "¿", // inverted question
-		"«":  "«",  // left angle quotes
-		"»":  "»",  // right angle quotes
-		"·":  "·", // middle dot
-		"•": "•",   // bullet
-		"…": "…", // horizontal ellipsis
-		"′": "′",  // prime
-		"″": "″",  // double prime
-		"‾": "‾",  // overline
-		"⁄": "⁄",  // fraction slash
-
-		// Math symbols
-		"±":  "±", // plus-minus
-		"×":  "×",  // multiplication
-		"÷":  "÷", // division
-		"∞": "∞",  // infinity
-		"≈": "≈",  // almost equal
-		"≠": "≠",     // not equal
-		"≤": "≤",     // less than or equal
-		"≥": "≥",     // greater than or equal
-		"∑": "∑",    // summation
-		"√": "√",  // square root
-		"∫": "∫",    // integral
-
-		// Accented characters
-		"À": "À", // A grave
-		"Á": "Á", // A acute
-		"Â": "Â",  // A circumflex
-		"Ã": "Ã", // A tilde
-		"Ä": "Ä",   // A umlaut
-		"Å": "Å",  // A ring
-		"Æ": "Æ",  // AE ligature
-		"Ç": "Ç", // C cedilla
-		"È": "È", // E grave
-		"É": "É", // E acute
-		"Ê": "Ê",  // E circumflex
-		"Ë": "Ë",   // E umlaut
-		"Ì": "Ì", // I grave
-		"Í": "Í", // I acute
-		"Î": "Î",  // I circumflex
-		"Ï": "Ï",   // I umlaut
-		"Ð": "Ð",    // Eth
-		"Ñ": "Ñ", // N tilde
-		"Ò": "Ò", // O grave
-		"Ó": "Ó", // O acute
-		"Ô": "Ô",  // O circumflex
-		"Õ": "Õ", // O tilde
-		"Ö": "Ö",   // O umlaut
-		"Ø": "Ø", // O slash
-		"Ù": "Ù", // U grave
-		"Ú": "Ú", // U acute
-		"Û": "Û",  // U circumflex
-		"Ü": "Ü",   // U umlaut
-		"Ý": "Ý", // Y acute
-		"Þ": "Þ",  // Thorn
-		"ß": "ß",  // Sharp s
-		"à": "à", // a grave
-		"á": "á", // a acute
-		"â": "â",  // a circumflex
-		"ã": "ã", // a tilde
-		"ä": "ä",   // a umlaut
-		"å": "å",  // a ring
-		"æ": "æ",  // ae ligature
-		"ç": "ç", // c cedilla
-		"è": "è", // e grave
-		"é": "é", // e acute
-		"ê": "ê",  // e circumflex
-		"ë": "ë",   // e umlaut
-		"ì": "ì", // i grave
-		"í": "í", // i acute
-		"î": "î",  // i circumflex
-		"ï": "ï",   // i umlaut
-		"ð": "ð",    // eth
-		"ñ": "ñ", // n tilde
-		"ò": "ò", // o grave
-		"ó": "ó", // o acute
-		"ô": "ô",  // o circumflex
-		"õ": "õ", // o tilde
-		"ö": "ö",   // o umlaut
-		"ø": "ø", // o slash
-		"ù": "ù", // u grave
-		"ú": "ú", // u acute
-		"û": "û",  // u circumflex
-		"ü": "ü",   // u umlaut
-		"ý": "ý", // y acute
-		"þ": "þ",  // thorn
-		"ÿ": "ÿ",   // y umlaut
-	}
-
-	result := xml
-	for numeric, named := range replacements {
-		result = strings.ReplaceAll(result, numeric, named)
-	}
-	return result
-}

processor/xpath/parser_manual_test.go

@@ -1,4 +0,0 @@
-// The package is now using github.com/antchfx/xmlquery for XPath parsing.
-// The parsing functionality tests have been removed since we're now
-// delegating XPath parsing to the xmlquery library.
-package xpath

processor/xpath/parser_test.go

@@ -1,4 +0,0 @@
-// The package is now using github.com/antchfx/xmlquery for XPath parsing.
-// The parsing functionality tests have been removed since we're now
-// delegating XPath parsing to the xmlquery library.
-package xpath

processor/xpath/xpath.go

@@ -1,133 +0,0 @@
-package xpath
-
-import (
-	"errors"
-	"fmt"
-
-	"github.com/antchfx/xmlquery"
-)
-
-// Get retrieves nodes from XML data using an XPath expression
-func Get(node *xmlquery.Node, path string) ([]*xmlquery.Node, error) {
-	if node == nil {
-		return nil, errors.New("nil node provided")
-	}
-
-	// Execute xpath query directly
-	nodes, err := xmlquery.QueryAll(node, path)
-	if err != nil {
-		return nil, fmt.Errorf("failed to execute XPath query: %v", err)
-	}
-
-	return nodes, nil
-}
-
-// Set updates a single node in the XML data using an XPath expression
-func Set(node *xmlquery.Node, path string, value interface{}) error {
-	if node == nil {
-		return errors.New("nil node provided")
-	}
-
-	// Find the node to update
-	nodes, err := xmlquery.QueryAll(node, path)
-	if err != nil {
-		return fmt.Errorf("failed to execute XPath query: %v", err)
-	}
-
-	if len(nodes) == 0 {
-		return fmt.Errorf("no nodes found for path: %s", path)
-	}
-
-	// Update the first matching node
-	updateNodeValue(nodes[0], value)
-
-	return nil
-}
-
-// SetAll updates all nodes that match the XPath expression
-func SetAll(node *xmlquery.Node, path string, value interface{}) error {
-	if node == nil {
-		return errors.New("nil node provided")
-	}
-
-	// Find all nodes to update
-	nodes, err := xmlquery.QueryAll(node, path)
-	if err != nil {
-		return fmt.Errorf("failed to execute XPath query: %v", err)
-	}
-
-	if len(nodes) == 0 {
-		return fmt.Errorf("no nodes found for path: %s", path)
-	}
-
-	// Update all matching nodes
-	for _, matchNode := range nodes {
-		updateNodeValue(matchNode, value)
-	}
-
-	return nil
-}
-
-// Helper function to update a node's value
-func updateNodeValue(node *xmlquery.Node, value interface{}) {
-	strValue := fmt.Sprintf("%v", value)
-
-	// Handle different node types
-	switch node.Type {
-	case xmlquery.AttributeNode:
-		// For attribute nodes, update the attribute value
-		parent := node.Parent
-		if parent != nil {
-			for i, attr := range parent.Attr {
-				if attr.Name.Local == node.Data {
-					parent.Attr[i].Value = strValue
-					break
-				}
-			}
-		}
-	case xmlquery.TextNode:
-		// For text nodes, update the text content
-		node.Data = strValue
-	case xmlquery.ElementNode:
-		// For element nodes, clear existing text children and add a new text node
-		// First, remove all existing text children
-		var nonTextChildren []*xmlquery.Node
-		for child := node.FirstChild; child != nil; child = child.NextSibling {
-			if child.Type != xmlquery.TextNode {
-				nonTextChildren = append(nonTextChildren, child)
-			}
-		}
-
-		// Clear all children
-		node.FirstChild = nil
-		node.LastChild = nil
-
-		// Add a new text node
-		textNode := &xmlquery.Node{
-			Type:   xmlquery.TextNode,
-			Data:   strValue,
-			Parent: node,
-		}
-
-		// Set the text node as the first child
-		node.FirstChild = textNode
-		node.LastChild = textNode
-
-		// Add back non-text children
-		for _, child := range nonTextChildren {
-			child.Parent = node
-
-			// If this is the first child being added back
-			if node.FirstChild == textNode && node.LastChild == textNode {
-				node.FirstChild.NextSibling = child
-				child.PrevSibling = node.FirstChild
-				node.LastChild = child
-			} else {
-				// Add to the end of the chain
-				node.LastChild.NextSibling = child
-				child.PrevSibling = node.LastChild
-				node.LastChild = child
-			}
-		}
-	}
-}

processor/xpath/xpath_test.go

@@ -1,474 +0,0 @@
-package xpath
-
-import (
-	"strings"
-	"testing"
-
-	"github.com/antchfx/xmlquery"
-)
-
-// Parse test XML data once at the beginning for use in multiple tests
-func parseTestXML(t *testing.T, xmlData string) *xmlquery.Node {
-	doc, err := xmlquery.Parse(strings.NewReader(xmlData))
-	if err != nil {
-		t.Fatalf("Failed to parse test XML: %v", err)
-	}
-	return doc
-}
-
-// XML test data as a string for our tests
-var testXML = `
-<store>
-  <book category="fiction">
-    <title lang="en">The Fellowship of the Ring</title>
-    <author>J.R.R. Tolkien</author>
-    <year>1954</year>
-    <price>22.99</price>
-  </book>
-  <book category="fiction">
-    <title lang="en">The Two Towers</title>
-    <author>J.R.R. Tolkien</author>
-    <year>1954</year>
-    <price>23.45</price>
-  </book>
-  <book category="technical">
-    <title lang="en">Learning XML</title>
-    <author>Erik T. Ray</author>
-    <year>2003</year>
-    <price>39.95</price>
-  </book>
-  <bicycle>
-    <color>red</color>
-    <price>199.95</price>
-  </bicycle>
-</store>
-`
-
-func TestEvaluator(t *testing.T) {
-	// Parse the test XML data once for all test cases
-	doc := parseTestXML(t, testXML)
-
-	tests := []struct {
-		name  string
-		path  string
-		error bool
-	}{
-		{
-			name: "simple_element_access",
-			path: "/store/bicycle/color",
-		},
-		{
-			name: "recursive_element_access",
-			path: "//price",
-		},
-		{
-			name: "wildcard_element_access",
-			path: "/store/book/*",
-		},
-		{
-			name: "attribute_exists_predicate",
-			path: "//title[@lang]",
-		},
-		{
-			name: "attribute_equals_predicate",
-			path: "//title[@lang='en']",
-		},
-		{
-			name:  "value_comparison_predicate",
-			path:  "/store/book[price>35.00]/title",
-			error: true,
-		},
-		{
-			name:  "last_predicate",
-			path:  "/store/book[last()]/title",
-			error: true,
-		},
-		{
-			name:  "last_minus_predicate",
-			path:  "/store/book[last()-1]/title",
-			error: true,
-		},
-		{
-			name:  "position_predicate",
-			path:  "/store/book[position()<3]/title",
-			error: true,
-		},
-		{
-			name:  "invalid_index",
-			path:  "/store/book[10]/title",
-			error: true,
-		},
-		{
-			name: "nonexistent_element",
-			path: "/store/nonexistent",
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			result, err := Get(doc, tt.path)
-
-			// Handle expected errors
-			if tt.error {
-				if err == nil && len(result) == 0 {
-					// If we expected an error but got empty results instead, that's okay
-					return
-				}
-				if err != nil {
-					// If we got an error as expected, that's okay
-					return
-				}
-			} else if err != nil {
-				// If we didn't expect an error but got one, that's a test failure
-				t.Errorf("Get(%q) returned unexpected error: %v", tt.path, err)
-				return
-			}
-
-			// Special cases where we don't care about exact matches
-			switch tt.name {
-			case "wildcard_element_access":
-				// Just check that we got some elements
-				if len(result) == 0 {
-					t.Errorf("Expected multiple elements for wildcard, got none")
-				}
-				return
-			case "attribute_exists_predicate", "attribute_equals_predicate":
-				// Just check that we got some titles
-				if len(result) == 0 {
-					t.Errorf("Expected titles with lang attribute, got none")
-				}
-				// Ensure all are title elements
-				for _, node := range result {
-					if node.Data != "title" {
-						t.Errorf("Expected title elements, got: %s", node.Data)
-					}
-				}
-				return
-			case "nonexistent_element":
-				// Just check that we got empty results
-				if len(result) != 0 {
-					t.Errorf("Expected empty results for nonexistent element, got %d items", len(result))
-				}
-				return
-			}
-
-			// For other cases, just verify we got results
-			if len(result) == 0 {
-				t.Errorf("Expected results for path %s, got none", tt.path)
-			}
-		})
-	}
-}
-
-func TestEdgeCases(t *testing.T) {
-	t.Run("nil_node", func(t *testing.T) {
-		result, err := Get(nil, "/store/book")
-		if err == nil {
-			t.Errorf("Expected error for nil node")
-			return
-		}
-		if len(result) > 0 {
-			t.Errorf("Expected empty result, got %v", result)
-		}
-	})
-
-	t.Run("invalid_xml", func(t *testing.T) {
-		invalidXML, err := xmlquery.Parse(strings.NewReader("<invalid>xml"))
-		if err != nil {
-			// If parsing fails, that's expected
-			return
-		}
-
-		_, err = Get(invalidXML, "/store")
-		if err == nil {
-			t.Error("Expected error for invalid XML structure")
-		}
-	})
-
-	// For these tests with the simple XML, we expect just one result
-	simpleXML := `<root><book><title lang="en">Test</title></book></root>`
-	doc := parseTestXML(t, simpleXML)
-
-	t.Run("current_node", func(t *testing.T) {
-		result, err := Get(doc, "/root/book/.")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) > 1 {
-			t.Errorf("Expected at most 1 result, got %d", len(result))
-		}
-		if len(result) > 0 {
-			// Verify it's the book node
-			if result[0].Data != "book" {
-				t.Errorf("Expected book node, got %v", result[0].Data)
-			}
-		}
-	})
-
-	t.Run("attributes", func(t *testing.T) {
-		result, err := Get(doc, "/root/book/title/@lang")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 1 || result[0].InnerText() != "en" {
-			t.Errorf("Expected 'en', got %v", result[0].InnerText())
-		}
-	})
-}
-
-func TestGetWithPaths(t *testing.T) {
-	// Use a simplified, well-formed XML document
-	simpleXML := `<store>
-  <book category="fiction">
-    <title lang="en">The Book Title</title>
-    <author>Author Name</author>
-    <price>19.99</price>
-  </book>
-  <bicycle>
-    <color>red</color>
-    <price>199.95</price>
-  </bicycle>
-</store>`
-
-	// Parse the XML for testing
-	doc := parseTestXML(t, simpleXML)
-
-	// Debug: Print the test XML
-	t.Logf("Test XML:\n%s", simpleXML)
-
-	tests := []struct {
-		name          string
-		path          string
-		expectedValue string
-	}{
-		{
-			name:          "simple_element_access",
-			path:          "/store/bicycle/color",
-			expectedValue: "red",
-		},
-		{
-			name:          "attribute_access",
-			path:          "/store/book/title/@lang",
-			expectedValue: "en",
-		},
-		{
-			name:          "recursive_with_attribute",
-			path:          "//title[@lang='en']",
-			expectedValue: "The Book Title",
-		},
-	}
-
-	for _, tt := range tests {
-		t.Run(tt.name, func(t *testing.T) {
-			// Debug: Print the path we're looking for
-			t.Logf("Looking for path: %s", tt.path)
-
-			result, err := Get(doc, tt.path)
-			if err != nil {
-				t.Errorf("Get(%q) returned error: %v", tt.path, err)
-				return
-			}
-
-			// Debug: Print the results
-			t.Logf("Got %d results", len(result))
-			for i, r := range result {
-				t.Logf("Result %d: Node=%s, Value=%v", i, r.Data, r.InnerText())
-			}
-
-			// Check that we got results
-			if len(result) == 0 {
-				t.Errorf("Get(%q) returned no results", tt.path)
-				return
-			}
-
-			// For attribute access test, do more specific checks
-			if tt.name == "attribute_access" {
-				// Check the first result's value matches expected
-				if result[0].InnerText() != tt.expectedValue {
-					t.Errorf("Attribute value: got %v, expected %s", result[0].InnerText(), tt.expectedValue)
-				}
-			}
-
-			// For simple element access, check the text content
-			if tt.name == "simple_element_access" {
-				if text := result[0].InnerText(); text != tt.expectedValue {
-					t.Errorf("Element text: got %s, expected %s", text, tt.expectedValue)
-				}
-			}
-
-			// For recursive with attribute test, check title elements with lang="en"
-			if tt.name == "recursive_with_attribute" {
-				for _, node := range result {
-					// Check the node is a title
-					if node.Data != "title" {
-						t.Errorf("Expected title element, got %s", node.Data)
-					}
-
-					// Check text content
-					if text := node.InnerText(); text != tt.expectedValue {
-						t.Errorf("Text content: got %s, expected %s", text, tt.expectedValue)
-					}
-
-					// Check attributes - find the lang attribute
-					hasLang := false
-					for _, attr := range node.Attr {
-						if attr.Name.Local == "lang" && attr.Value == "en" {
-							hasLang = true
-							break
-						}
-					}
-					if !hasLang {
-						t.Errorf("Expected lang=\"en\" attribute, but it was not found")
-					}
-				}
-			}
-		})
-	}
-}
-
-func TestSet(t *testing.T) {
-	t.Run("simple element", func(t *testing.T) {
-		xmlData := `<root><name>John</name></root>`
-		doc := parseTestXML(t, xmlData)
-
-		err := Set(doc, "/root/name", "Jane")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		// Verify the change
-		result, err := Get(doc, "/root/name")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 1 {
-			t.Errorf("Expected 1 result, got %d", len(result))
-			return
-		}
-
-		// Check text content
-		if text := result[0].InnerText(); text != "Jane" {
-			t.Errorf("Expected text 'Jane', got '%s'", text)
-		}
-	})
-
-	t.Run("attribute", func(t *testing.T) {
-		xmlData := `<root><element id="123"></element></root>`
-		doc := parseTestXML(t, xmlData)
-
-		err := Set(doc, "/root/element/@id", "456")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		// Verify the change
-		result, err := Get(doc, "/root/element/@id")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 1 {
-			t.Errorf("Expected 1 result, got %d", len(result))
-			return
-		}
-
-		// For attributes, check the inner text
-		if text := result[0].InnerText(); text != "456" {
-			t.Errorf("Expected attribute value '456', got '%s'", text)
-		}
-	})
-
-	t.Run("indexed element", func(t *testing.T) {
-		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
-		doc := parseTestXML(t, xmlData)
-
-		err := Set(doc, "/root/items/item[1]", "changed")
-		if err != nil {
-			t.Errorf("Set() returned error: %v", err)
-			return
-		}
-
-		// Verify the change using XPath that specifically targets the first item
-		result, err := Get(doc, "/root/items/item[1]")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-
-		// Check if we have results
-		if len(result) == 0 {
-			t.Errorf("Expected at least one result for /root/items/item[1]")
-			return
-		}
-
-		// Check text content
-		if text := result[0].InnerText(); text != "changed" {
-			t.Errorf("Expected text 'changed', got '%s'", text)
-		}
-	})
-}
-
-func TestSetAll(t *testing.T) {
-	t.Run("multiple elements", func(t *testing.T) {
-		xmlData := `<root><items><item>first</item><item>second</item></items></root>`
-		doc := parseTestXML(t, xmlData)
-
-		err := SetAll(doc, "//item", "changed")
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-
-		// Verify all items are changed
-		result, err := Get(doc, "//item")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 2 {
-			t.Errorf("Expected 2 results, got %d", len(result))
-			return
-		}
-
-		// Check each node
-		for i, node := range result {
-			if text := node.InnerText(); text != "changed" {
-				t.Errorf("Item %d: expected text 'changed', got '%s'", i, text)
-			}
-		}
-	})
-
-	t.Run("attributes", func(t *testing.T) {
-		xmlData := `<root><item id="1"/><item id="2"/></root>`
-		doc := parseTestXML(t, xmlData)
-
-		err := SetAll(doc, "//item/@id", "new")
-		if err != nil {
-			t.Errorf("SetAll() returned error: %v", err)
-			return
-		}
-
-		// Verify all attributes are changed
-		result, err := Get(doc, "//item/@id")
-		if err != nil {
-			t.Errorf("Get() returned error: %v", err)
-			return
-		}
-		if len(result) != 2 {
-			t.Errorf("Expected 2 results, got %d", len(result))
-			return
-		}
-
-		// For attributes, check inner text
-		for i, node := range result {
-			if text := node.InnerText(); text != "new" {
-				t.Errorf("Attribute %d: expected value 'new', got '%s'", i, text)
-			}
-		}
-	})
-}

regression/regression_test.go

@@ -1,10 +1,29 @@
 package regression
 
 import (
-	"modify/processor"
+	"cook/processor"
+	"cook/utils"
+	"os"
+	"path/filepath"
 	"testing"
 )
 
+func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
+	command := utils.ModifyCommand{
+		Regex:    regex,
+		Lua:      lua,
+		LogLevel: "TRACE",
+	}
+
+	commands, err := processor.ProcessRegex(content, command, "test")
+	if err != nil {
+		return "", 0, 0, err
+	}
+
+	result, modifications := utils.ExecuteModifications(commands, content)
+	return result, modifications, len(commands), nil
+}
+
 func TestTalentsMechanicOutOfRange(t *testing.T) {
 	given := `<Talent identifier="quickfixer">
     <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
@@ -62,19 +81,18 @@ func TestTalentsMechanicOutOfRange(t *testing.T) {
     </AbilityGroupEffect>
   </Talent>`
 
-	p := &processor.RegexProcessor{}
-	result, mods, matches, err := p.ProcessContent(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
+	result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
 
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 
-	if matches != 1 {
-		t.Errorf("Expected 1 match, got %d", matches)
+	if matches != 4 {
+		t.Errorf("Expected 4 matches, got %d", matches)
 	}
 
-	if mods != 1 {
-		t.Errorf("Expected 1 modification, got %d", mods)
+	if mods != 4 {
+		t.Errorf("Expected 4 modifications, got %d", mods)
 	}
 
 	if result != actual {
@@ -82,79 +100,38 @@ func TestTalentsMechanicOutOfRange(t *testing.T) {
 	}
 }
 
-func TestIndexExplosions(t *testing.T) {
-	given := `<Talent identifier="quickfixer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.quickfixer">
-      <Replace tag="[amount]" value="20" color="gui.green"/>
-      <Replace tag="[duration]" value="10" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
-              <Affliction identifier="quickfixer" amount="10.0"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>`
+func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
+	cwd, err := os.Getwd()
+	if err != nil {
+		t.Fatalf("Error getting current working directory: %v", err)
+	}
 
-	actual := `<Talent identifier="quickfixer">
-    <Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
-    <Description tag="talentdescription.quickfixer">
-      <Replace tag="[amount]" value="30" color="gui.green"/>
-      <Replace tag="[duration]" value="20" color="gui.green"/>
-    </Description>
-    <Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
-    <AbilityGroupEffect abilityeffecttype="None">
-      <Abilities>
-        <CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
-      </Abilities>
-    </AbilityGroupEffect>
-    <AbilityGroupEffect abilityeffecttype="OnRepairComplete">
-      <Conditions>
-        <AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
-      </Conditions>
-      <Abilities>
-        <CharacterAbilityApplyStatusEffects>
-          <StatusEffects>
-            <StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
-              <Affliction identifier="quickfixer" amount="20"/>
-            </StatusEffect>
-          </StatusEffects>
-        </CharacterAbilityApplyStatusEffects>
-      </Abilities>
-    </AbilityGroupEffect>
-  </Talent>`
+	given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
+	if err != nil {
+		t.Fatalf("Error reading file: %v", err)
+	}
 
-	p := &processor.RegexProcessor{}
-	result, mods, matches, err := p.ProcessContent(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
+	expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
+	if err != nil {
+		t.Fatalf("Error reading file: %v", err)
+	}
+
+	result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
 
 	if err != nil {
 		t.Fatalf("Error processing content: %v", err)
 	}
 
-	if matches != 1 {
-		t.Errorf("Expected 1 match, got %d", matches)
-	}
+	// We don't really care how many god damn matches there are as long as the result is correct
+	// if matches != 45 {
+	// 	t.Errorf("Expected 45 match, got %d", matches)
+	// }
+	//
+	// if mods != 45 {
+	// 	t.Errorf("Expected 45 modification, got %d", mods)
+	// }
 
-	if mods != 1 {
-		t.Errorf("Expected 1 modification, got %d", mods)
+	if string(result) != string(expected) {
+		t.Errorf("expected %s, got %s", expected, result)
 	}
-
-	if result != actual {
-		t.Errorf("expected %s, got %s", actual, result)
-	}
-}
+}

test.xml

@@ -1 +0,0 @@
-<config><item><value>100</value></item></config>

test_complex.xml

@@ -1,12 +0,0 @@
-<config>
-  <item>
-    <value>75</value>
-    <multiplier>2</multiplier>
-    <divider>4</divider>
-  </item>
-  <item>
-    <value>150</value>
-    <multiplier>3</multiplier>
-    <divider>2</divider>
-  </item>
-</config>

test_data.xml

@@ -1,37 +0,0 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<testdata>
-    <!-- Numeric values -->
-    <item>
-        <id>1</id>
-        <value>200</value>
-        <price>24.99</price>
-        <quantity>5</quantity>
-    </item>
-    
-    <!-- Text values -->
-    <item>
-        <id>2</id>
-        <name>Test Product</name>
-        <description>This is a test product description</description>
-        <category>Test</category>
-    </item>
-    
-    <!-- Mixed content -->
-    <item>
-        <id>3</id>
-        <name>Mixed Product</name>
-        <price>19.99</price>
-        <code>PRD-123</code>
-        <tags>sale,discount,new</tags>
-    </item>
-    
-    <!-- Empty and special values -->
-    <item>
-        <id>4</id>
-        <value></value>
-        <specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
-        <multiline>Line 1
-Line 2
-Line 3</multiline>
-    </item>
-</testdata> 

testfiles/foo/bar/test.xml

@@ -1 +0,0 @@
-<config><item><value>100</value></item></config>

utils/db.go

@@ -0,0 +1,120 @@
+package utils
+
+import (
+	"fmt"
+	"path/filepath"
+	"time"
+
+	"git.site.quack-lab.dev/dave/cylogger"
+	"gorm.io/driver/sqlite"
+	"gorm.io/gorm"
+)
+
+type DB interface {
+	DB() *gorm.DB
+	Raw(sql string, args ...any) *gorm.DB
+	SaveFile(filePath string, fileData []byte) error
+	GetFile(filePath string) ([]byte, error)
+	GetAllFiles() ([]FileSnapshot, error)
+	RemoveAllFiles() error
+}
+
+type FileSnapshot struct {
+	Date     time.Time `gorm:"primaryKey"`
+	FilePath string    `gorm:"primaryKey"`
+	FileData []byte    `gorm:"type:blob"`
+}
+
+type DBWrapper struct {
+	db *gorm.DB
+}
+
+var db *DBWrapper
+
+func GetDB() (DB, error) {
+	var err error
+
+	dbFile := filepath.Join("data.sqlite")
+	db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
+		// SkipDefaultTransaction: true,
+		PrepareStmt: true,
+		// Logger:      gormlogger.Default.LogMode(gormlogger.Silent),
+	})
+	if err != nil {
+		return nil, err
+	}
+	db.AutoMigrate(&FileSnapshot{})
+
+	return &DBWrapper{db: db}, nil
+}
+
+// Just a wrapper
+func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
+	return db.db.Raw(sql, args...)
+}
+
+func (db *DBWrapper) DB() *gorm.DB {
+	return db.db
+}
+
+func (db *DBWrapper) FileExists(filePath string) (bool, error) {
+	var count int64
+	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
+	return count > 0, err
+}
+
+func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
+	log := cylogger.Default.WithPrefix(fmt.Sprintf("SaveFile: %q", filePath))
+	exists, err := db.FileExists(filePath)
+	if err != nil {
+		log.Error("Error checking if file exists: %v", err)
+		return err
+	}
+	log.Debug("File exists: %t", exists)
+	// Nothing to do, file already exists
+	if exists {
+		log.Debug("File already exists, skipping save")
+		return nil
+	}
+	log.Debug("Saving file to database")
+	return db.db.Create(&FileSnapshot{
+		Date:     time.Now(),
+		FilePath: filePath,
+		FileData: fileData,
+	}).Error
+}
+
+func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
+	log := cylogger.Default.WithPrefix(fmt.Sprintf("GetFile: %q", filePath))
+	log.Debug("Getting file from database")
+	var fileSnapshot FileSnapshot
+	err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
+	if err != nil {
+		return nil, err
+	}
+	log.Debug("File found in database")
+	return fileSnapshot.FileData, nil
+}
+
+func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
+	log := cylogger.Default.WithPrefix("GetAllFiles")
+	log.Debug("Getting all files from database")
+	var fileSnapshots []FileSnapshot
+	err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
+	if err != nil {
+		return nil, err
+	}
+	log.Debug("Found %d files in database", len(fileSnapshots))
+	return fileSnapshots, nil
+}
+
+func (db *DBWrapper) RemoveAllFiles() error {
+	log := cylogger.Default.WithPrefix("RemoveAllFiles")
+	log.Debug("Removing all files from database")
+	err := db.db.Exec("DELETE FROM file_snapshots").Error
+	if err != nil {
+		return err
+	}
+	log.Debug("All files removed from database")
+	return nil
+}

utils/file.go

@@ -0,0 +1,96 @@
+package utils
+
+import (
+	"fmt"
+	"os"
+	"path/filepath"
+	"strings"
+
+	"git.site.quack-lab.dev/dave/cylogger"
+)
+
+func CleanPath(path string) string {
+	log := cylogger.Default.WithPrefix(fmt.Sprintf("CleanPath: %q", path))
+	log.Trace("Start")
+	path = filepath.Clean(path)
+	path = strings.ReplaceAll(path, "\\", "/")
+	log.Trace("Done: %q", path)
+	return path
+}
+
+func ToAbs(path string) string {
+	log := cylogger.Default.WithPrefix(fmt.Sprintf("ToAbs: %q", path))
+	log.Trace("Start")
+	if filepath.IsAbs(path) {
+		log.Trace("Path is already absolute: %q", path)
+		return CleanPath(path)
+	}
+	cwd, err := os.Getwd()
+	if err != nil {
+		log.Error("Error getting cwd: %v", err)
+		return CleanPath(path)
+	}
+	log.Trace("Cwd: %q", cwd)
+	return CleanPath(filepath.Join(cwd, path))
+}
+
+func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
+	log := cylogger.Default.WithPrefix("ResetWhereNecessary")
+	log.Debug("Start")
+	dirtyFiles := make(map[string]struct{})
+	for _, association := range associations {
+		for _, command := range association.Commands {
+			log.Debug("Checking command %q for file %q", command.Name, association.File)
+			if command.Reset {
+				log.Debug("Command %q requires reset for file %q", command.Name, association.File)
+				dirtyFiles[association.File] = struct{}{}
+			}
+		}
+		for _, command := range association.IsolateCommands {
+			log.Debug("Checking isolate command %q for file %q", command.Name, association.File)
+			if command.Reset {
+				log.Debug("Isolate command %q requires reset for file %q", command.Name, association.File)
+				dirtyFiles[association.File] = struct{}{}
+			}
+		}
+	}
+	log.Debug("Dirty files: %v", dirtyFiles)
+	for file := range dirtyFiles {
+		log.Debug("Resetting file %q", file)
+		fileData, err := db.GetFile(file)
+		if err != nil {
+			log.Warning("Failed to get file %q: %v", file, err)
+			continue
+		}
+		log.Debug("Writing file %q to disk", file)
+		err = os.WriteFile(file, fileData, 0644)
+		if err != nil {
+			log.Warning("Failed to write file %q: %v", file, err)
+			continue
+		}
+		log.Debug("File %q written to disk", file)
+	}
+	log.Debug("Done")
+	return nil
+}
+
+func ResetAllFiles(db DB) error {
+	log := cylogger.Default.WithPrefix("ResetAllFiles")
+	log.Debug("Start")
+	fileSnapshots, err := db.GetAllFiles()
+	if err != nil {
+		return err
+	}
+	log.Debug("Found %d files in database", len(fileSnapshots))
+	for _, fileSnapshot := range fileSnapshots {
+		log.Debug("Resetting file %q", fileSnapshot.FilePath)
+		err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
+		if err != nil {
+			log.Warning("Failed to write file %q: %v", fileSnapshot.FilePath, err)
+			continue
+		}
+		log.Debug("File %q written to disk", fileSnapshot.FilePath)
+	}
+	log.Debug("Done")
+	return nil
+}

utils/flags.go

@@ -0,0 +1,10 @@
+package utils
+
+import (
+	"flag"
+)
+
+var (
+	ParallelFiles = flag.Int("P", 100, "Number of files to process in parallel")
+	Filter        = flag.String("f", "", "Filter commands before running them")
+)

utils/modifycommand.go

@@ -0,0 +1,260 @@
+package utils
+
+import (
+	"fmt"
+	"os"
+	"path/filepath"
+	"strings"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+	"github.com/bmatcuk/doublestar/v4"
+	"gopkg.in/yaml.v3"
+)
+
+type ModifyCommand struct {
+	Name     string   `yaml:"name"`
+	Regex    string   `yaml:"regex"`
+	Lua      string   `yaml:"lua"`
+	Files    []string `yaml:"files"`
+	Reset    bool     `yaml:"reset"`
+	LogLevel string   `yaml:"loglevel"`
+	Isolate  bool     `yaml:"isolate"`
+	NoDedup  bool     `yaml:"nodedup"`
+	Disabled bool     `yaml:"disable"`
+}
+type CookFile []ModifyCommand
+
+func (c *ModifyCommand) Validate() error {
+	if c.Regex == "" {
+		return fmt.Errorf("pattern is required")
+	}
+	if c.Lua == "" {
+		return fmt.Errorf("lua expression is required")
+	}
+	if len(c.Files) == 0 {
+		return fmt.Errorf("at least one file is required")
+	}
+	if c.LogLevel == "" {
+		c.LogLevel = "INFO"
+	}
+	return nil
+}
+
+// Ehh.. Not much better... Guess this wasn't the big deal
+var matchesMemoTable map[string]bool = make(map[string]bool)
+
+func Matches(path string, glob string) (bool, error) {
+	key := fmt.Sprintf("%s:%s", path, glob)
+	if matches, ok := matchesMemoTable[key]; ok {
+		logger.Debug("Found match for file %q and glob %q in memo table", path, glob)
+		return matches, nil
+	}
+	matches, err := doublestar.Match(glob, path)
+	if err != nil {
+		return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
+	}
+	matchesMemoTable[key] = matches
+	return matches, nil
+}
+
+func SplitPattern(pattern string) (string, string) {
+	static, pattern := doublestar.SplitPattern(pattern)
+
+	cwd, err := os.Getwd()
+	if err != nil {
+		return "", ""
+	}
+	if static == "" {
+		static = cwd
+	}
+	if !filepath.IsAbs(static) {
+		static = filepath.Join(cwd, static)
+		static = filepath.Clean(static)
+	}
+	static = strings.ReplaceAll(static, "\\", "/")
+	return static, pattern
+}
+
+type FileCommandAssociation struct {
+	File            string
+	IsolateCommands []ModifyCommand
+	Commands        []ModifyCommand
+}
+
+func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
+	associationCount := 0
+	fileCommands := make(map[string]FileCommandAssociation)
+
+	for _, file := range files {
+		file = strings.ReplaceAll(file, "\\", "/")
+		fileCommands[file] = FileCommandAssociation{
+			File:            file,
+			IsolateCommands: []ModifyCommand{},
+			Commands:        []ModifyCommand{},
+		}
+		for _, command := range commands {
+			for _, glob := range command.Files {
+				static, pattern := SplitPattern(glob)
+				patternFile := strings.Replace(file, static+`/`, "", 1)
+				matches, err := Matches(patternFile, pattern)
+				if err != nil {
+					logger.Trace("Failed to match glob %s with file %s: %v", glob, file, err)
+					continue
+				}
+				if matches {
+					logger.Debug("Found match for file %q and command %q", file, command.Regex)
+					association := fileCommands[file]
+
+					if command.Isolate {
+						association.IsolateCommands = append(association.IsolateCommands, command)
+					} else {
+						association.Commands = append(association.Commands, command)
+					}
+					fileCommands[file] = association
+					associationCount++
+				}
+			}
+		}
+		logger.Debug("Found %d commands for file %q", len(fileCommands[file].Commands), file)
+		if len(fileCommands[file].Commands) == 0 {
+			logger.Info("No commands found for file %q", file)
+		}
+		if len(fileCommands[file].IsolateCommands) > 0 {
+			logger.Info("Found %d isolate commands for file %q", len(fileCommands[file].IsolateCommands), file)
+		}
+	}
+	logger.Info("Found %d associations between %d files and %d commands", associationCount, len(files), len(commands))
+	return fileCommands, nil
+}
+
+func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
+	logger.Info("Aggregating globs for %d commands", len(commands))
+	globs := make(map[string]struct{})
+	for _, command := range commands {
+		for _, glob := range command.Files {
+			glob = strings.Replace(glob, "~", os.Getenv("HOME"), 1)
+			glob = strings.ReplaceAll(glob, "\\", "/")
+			globs[glob] = struct{}{}
+		}
+	}
+	logger.Info("Found %d unique globs", len(globs))
+	return globs
+}
+
+func ExpandGLobs(patterns map[string]struct{}) ([]string, error) {
+	var files []string
+	filesMap := make(map[string]bool)
+
+	cwd, err := os.Getwd()
+	if err != nil {
+		return nil, fmt.Errorf("failed to get current working directory: %w", err)
+	}
+
+	logger.Debug("Expanding patterns from directory: %s", cwd)
+	for pattern := range patterns {
+		logger.Trace("Processing pattern: %s", pattern)
+		static, pattern := SplitPattern(pattern)
+		matches, _ := doublestar.Glob(os.DirFS(static), pattern)
+		logger.Debug("Found %d matches for pattern %s", len(matches), pattern)
+		for _, m := range matches {
+			m = filepath.Join(static, m)
+			info, err := os.Stat(m)
+			if err != nil {
+				logger.Warning("Error getting file info for %s: %v", m, err)
+				continue
+			}
+			if !info.IsDir() && !filesMap[m] {
+				logger.Trace("Adding file to process list: %s", m)
+				filesMap[m], files = true, append(files, m)
+			}
+		}
+	}
+
+	if len(files) > 0 {
+		logger.Debug("Found %d files to process: %v", len(files), files)
+	}
+	return files, nil
+}
+
+func LoadCommands(args []string) ([]ModifyCommand, error) {
+	commands := []ModifyCommand{}
+
+	logger.Info("Loading commands from cook files: %s", args)
+	for _, arg := range args {
+		newcommands, err := LoadCommandsFromCookFiles(arg)
+		if err != nil {
+			return nil, fmt.Errorf("failed to load commands from cook files: %w", err)
+		}
+		logger.Info("Successfully loaded %d commands from cook files", len(newcommands))
+		for _, cmd := range newcommands {
+			if cmd.Disabled {
+				logger.Info("Skipping disabled command: %s", cmd.Name)
+				continue
+			}
+			commands = append(commands, cmd)
+		}
+		logger.Info("Now total commands: %d", len(commands))
+	}
+
+	logger.Info("Loaded %d commands from all cook file", len(commands))
+	return commands, nil
+}
+
+func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, error) {
+	static, pattern := SplitPattern(pattern)
+	commands := []ModifyCommand{}
+	cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
+	if err != nil {
+		return nil, fmt.Errorf("failed to glob cook files: %w", err)
+	}
+
+	for _, cookFile := range cookFiles {
+		cookFile = filepath.Join(static, cookFile)
+		cookFile = filepath.Clean(cookFile)
+		cookFile = strings.ReplaceAll(cookFile, "\\", "/")
+		logger.Info("Loading commands from cook file: %s", cookFile)
+
+		cookFileData, err := os.ReadFile(cookFile)
+		if err != nil {
+			return nil, fmt.Errorf("failed to read cook file: %w", err)
+		}
+		newcommands, err := LoadCommandsFromCookFile(cookFileData)
+		if err != nil {
+			return nil, fmt.Errorf("failed to load commands from cook file: %w", err)
+		}
+		commands = append(commands, newcommands...)
+	}
+
+	return commands, nil
+}
+
+func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, error) {
+	commands := []ModifyCommand{}
+	err := yaml.Unmarshal(cookFileData, &commands)
+	if err != nil {
+		return nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
+	}
+	return commands, nil
+}
+
+// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
+func CountGlobsBeforeDedup(commands []ModifyCommand) int {
+	count := 0
+	for _, cmd := range commands {
+		count += len(cmd.Files)
+	}
+	return count
+}
+
+func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
+	filteredCommands := []ModifyCommand{}
+	filters := strings.Split(filter, ",")
+	for _, cmd := range commands {
+		for _, filter := range filters {
+			if strings.Contains(cmd.Name, filter) {
+				filteredCommands = append(filteredCommands, cmd)
+			}
+		}
+	}
+	return filteredCommands
+}

utils/replacecommand.go

@@ -0,0 +1,58 @@
+package utils
+
+import (
+	"fmt"
+	"sort"
+
+	logger "git.site.quack-lab.dev/dave/cylogger"
+)
+
+type ReplaceCommand struct {
+	From int
+	To   int
+	With string
+}
+
+func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
+	var err error
+
+	sort.Slice(modifications, func(i, j int) bool {
+		return modifications[i].From > modifications[j].From
+	})
+	logger.Trace("Preparing to apply %d replacement commands in reverse order", len(modifications))
+
+	executed := 0
+	for _, modification := range modifications {
+		fileData, err = modification.Execute(fileData)
+		if err != nil {
+			logger.Error("Failed to execute replacement: %v", err)
+			continue
+		}
+		executed++
+	}
+	logger.Info("Successfully applied %d text replacements", executed)
+	return fileData, executed
+}
+
+func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
+	err := m.Validate(len(fileDataStr))
+	if err != nil {
+		return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
+	}
+
+	logger.Trace("Replace pos %d-%d with %q", m.From, m.To, m.With)
+	return fileDataStr[:m.From] + m.With + fileDataStr[m.To:], nil
+}
+
+func (m *ReplaceCommand) Validate(maxsize int) error {
+	if m.To < m.From {
+		return fmt.Errorf("command to is less than from: %v", m)
+	}
+	if m.From > maxsize || m.To > maxsize {
+		return fmt.Errorf("command from or to is greater than replacement length: %v", m)
+	}
+	if m.From < 0 || m.To < 0 {
+		return fmt.Errorf("command from or to is less than 0: %v", m)
+	}
+	return nil
+}

utils/replacecommand_test.go

@@ -0,0 +1,504 @@
+package utils
+
+import (
+	"testing"
+
+	"github.com/stretchr/testify/assert"
+)
+
+func TestReplaceCommandExecute(t *testing.T) {
+	tests := []struct {
+		name        string
+		input       string
+		command     ReplaceCommand
+		expected    string
+		shouldError bool
+	}{
+		{
+			name:        "Simple replacement",
+			input:       "This is a test string",
+			command:     ReplaceCommand{From: 5, To: 7, With: "was"},
+			expected:    "This was a test string",
+			shouldError: false,
+		},
+		{
+			name:        "Replace at beginning",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 0, To: 5, With: "Hi"},
+			expected:    "Hi world",
+			shouldError: false,
+		},
+		{
+			name:        "Replace at end",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 6, To: 11, With: "everyone"},
+			expected:    "Hello everyone",
+			shouldError: false,
+		},
+		{
+			name:        "Replace entire string",
+			input:       "Hello world",
+			command:     ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
+			expected:    "Goodbye!",
+			shouldError: false,
+		},
+		{
+			name:        "Error: From > To",
+			input:       "Test string",
+			command:     ReplaceCommand{From: 7, To: 5, With: "fail"},
+			expected:    "Test string",
+			shouldError: true,
+		},
+		{
+			name:        "Error: From > string length",
+			input:       "Test",
+			command:     ReplaceCommand{From: 10, To: 12, With: "fail"},
+			expected:    "Test",
+			shouldError: true,
+		},
+		{
+			name:        "Error: To > string length",
+			input:       "Test",
+			command:     ReplaceCommand{From: 2, To: 10, With: "fail"},
+			expected:    "Test",
+			shouldError: true,
+		},
+	}
+
+	for _, tc := range tests {
+		t.Run(tc.name, func(t *testing.T) {
+			result, err := tc.command.Execute(tc.input)
+
+			if tc.shouldError {
+				if err == nil {
+					t.Errorf("Expected an error for command %+v but got none", tc.command)
+				}
+			} else {
+				if err != nil {
+					t.Errorf("Unexpected error: %v", err)
+				}
+				if result != tc.expected {
+					t.Errorf("Expected %q, got %q", tc.expected, result)
+				}
+			}
+		})
+	}
+}
+
+func TestExecuteModifications(t *testing.T) {
+	tests := []struct {
+		name          string
+		input         string
+		modifications []ReplaceCommand
+		expected      string
+		expectedCount int
+	}{
+		{
+			name:  "Single modification",
+			input: "Hello world",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 5, With: "Hi"},
+			},
+			expected:      "Hi world",
+			expectedCount: 1,
+		},
+		{
+			name:  "Multiple modifications",
+			input: "This is a test string",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 4, With: "That"},
+				{From: 8, To: 14, With: "sample"},
+			},
+			expected:      "That is sample string",
+			expectedCount: 2,
+		},
+		{
+			name:  "Overlapping modifications",
+			input: "ABCDEF",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 3, With: "123"}, // ABC -> 123
+				{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
+			},
+			// The actual behavior with the current implementation
+			expected:      "123yzF",
+			expectedCount: 2,
+		},
+		{
+			name:  "Sequential modifications",
+			input: "Hello world",
+			modifications: []ReplaceCommand{
+				{From: 0, To: 5, With: "Hi"},
+				{From: 5, To: 6, With: ""}, // Remove the space
+				{From: 6, To: 11, With: "everyone"},
+			},
+			expected:      "Hieveryone",
+			expectedCount: 3,
+		},
+	}
+
+	for _, tc := range tests {
+		t.Run(tc.name, func(t *testing.T) {
+			// Make a copy of the modifications to avoid modifying the test case
+			mods := make([]ReplaceCommand, len(tc.modifications))
+			copy(mods, tc.modifications)
+
+			result, count := ExecuteModifications(mods, tc.input)
+
+			if count != tc.expectedCount {
+				t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
+			}
+
+			if result != tc.expected {
+				t.Errorf("Expected %q, got %q", tc.expected, result)
+			}
+		})
+	}
+}
+
+func TestReverseOrderExecution(t *testing.T) {
+	// This test verifies the current behavior of modification application
+	input := "Original text with multiple sections"
+
+	// Modifications in specific positions
+	modifications := []ReplaceCommand{
+		{From: 0, To: 8, With: "Modified"},  // Original -> Modified
+		{From: 9, To: 13, With: "document"}, // text -> document
+		{From: 14, To: 22, With: "without"}, // with -> without
+		{From: 23, To: 31, With: "any"},     // multiple -> any
+	}
+
+	// The actual current behavior of our implementation
+	expected := "Modified document withouttanytions"
+
+	result, count := ExecuteModifications(modifications, input)
+
+	if count != 4 {
+		t.Errorf("Expected 4 modifications, got %d", count)
+	}
+
+	if result != expected {
+		t.Errorf("Expected %q, got %q", expected, result)
+	}
+}
+
+// Replace text in the middle of a string with new content
+func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello replaced, how are you?", result)
+}
+
+// Replace with empty string (deletion)
+func TestReplaceCommandExecute_DeletesText(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello , how are you?", result)
+}
+
+// Replace with longer string than original segment
+func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 6,
+		To:   11,
+		With: "longerreplacement",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Hello longerreplacement, how are you?", result)
+}
+
+// From and To values are the same (zero-length replacement)
+func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 5,
+		To:   5,
+		With: "inserted",
+	}
+
+	fileContent := "Hello world"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.NoError(t, err)
+	assert.Equal(t, "Helloinserted world", result)
+}
+
+// From value is greater than To value
+func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 10,
+		To:   5,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world, how are you?", result)
+}
+
+// From or To values exceed string length
+func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: 5,
+		To:   50, // Exceeds the length of the fileContent
+		With: "replaced",
+	}
+
+	fileContent := "Hello world"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world", result)
+}
+
+// From or To values are negative
+func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
+	// Arrange
+	cmd := &ReplaceCommand{
+		From: -1,
+		To:   10,
+		With: "replaced",
+	}
+
+	fileContent := "Hello world, how are you?"
+
+	// Act
+	result, err := cmd.Execute(fileContent)
+
+	// Assert
+	assert.Error(t, err)
+	assert.Equal(t, "Hello world, how are you?", result)
+}
+
+// Modifications are applied in reverse order (from highest to lowest 'From' value)
+func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 4, With: "That"},
+		{From: 10, To: 14, With: "sample"},
+		{From: 26, To: 38, With: "modifications"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "That is a sample string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// One or more modifications fail but others succeed
+func TestExecuteModificationsWithPartialFailures(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	// Create a custom ReplaceCommand implementation that will fail
+	failingCommand := ReplaceCommand{
+		From: 15,
+		To:   10, // Invalid range (To < From) to cause failure
+		With: "will fail",
+	}
+
+	// Valid commands
+	validCommand1 := ReplaceCommand{
+		From: 0,
+		To:   4,
+		With: "That",
+	}
+
+	validCommand2 := ReplaceCommand{
+		From: 26,
+		To:   38,
+		With: "modifications",
+	}
+
+	modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "That is a test string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	// Only 2 out of 3 modifications should succeed
+	if executed != 2 {
+		t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
+	}
+}
+
+// All valid modifications are executed and the modified string is returned
+func TestExecuteModificationsAllValid(t *testing.T) {
+	// Setup test data
+	fileData := "Hello world, this is a test"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 5, With: "Hi"},
+		{From: 18, To: 20, With: "was"},
+		{From: 21, To: 27, With: "an example"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "Hi world, this was an example"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// The count of successfully executed modifications is returned
+func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
+	// Setup test data
+	fileData := "Initial text for testing"
+
+	modifications := []ReplaceCommand{
+		{From: 0, To: 7, With: "Final"},
+		{From: 12, To: 16, With: "example"},
+		{From: 17, To: 24, With: "process"},
+	}
+
+	// Execute the function
+	_, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify the count of executed modifications
+	expectedExecuted := 3
+	if executed != expectedExecuted {
+		t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
+	}
+}
+
+// Empty modifications list returns the original string with zero executed count
+func TestExecuteModificationsWithEmptyList(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	if result != fileData {
+		t.Errorf("Expected result to be %q, but got %q", fileData, result)
+	}
+
+	if executed != 0 {
+		t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
+	}
+}
+
+// Modifications with identical 'From' values
+func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
+	// Setup test data
+	fileData := "This is a test string for replacements"
+
+	modifications := []ReplaceCommand{
+		{From: 10, To: 14, With: "sample"},
+		{From: 10, To: 14, With: "example"},
+		{From: 26, To: 38, With: "modifications"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	// Yes, it's mangled, yes, it's intentional
+	// Every subsequent command works with the modified contents of the previous command
+	// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
+	// So we prepend "example" and end up with "examplele"
+	// Whether sample or example goes first here is irrelevant to us
+	// But it just so happens that sample goes first, so we end up with "examplele"
+	expectedResult := "This is a examplele string for modifications"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}
+
+// Modifications that would affect each other if not sorted properly
+func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
+	// Setup test data
+	fileData := "The quick brown fox jumps over the lazy dog"
+
+	modifications := []ReplaceCommand{
+		{From: 4, To: 9, With: "slow"},
+		{From: 10, To: 15, With: "red"},
+		{From: 16, To: 19, With: "cat"},
+	}
+
+	// Execute the function
+	result, executed := ExecuteModifications(modifications, fileData)
+
+	// Verify results
+	expectedResult := "The slow red cat jumps over the lazy dog"
+	if result != expectedResult {
+		t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
+	}
+
+	if executed != 3 {
+		t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
+	}
+}