169 Commits

Author SHA1 Message Date
98e05f4998 Implement loading lua from separate files via @ 2025-12-19 14:07:39 +01:00
2fa99ec3a2 Add lua meta to be used with luals and dumped via cook -m 2025-12-19 13:37:23 +01:00
8dd212fc71 Code polish 2025-12-19 13:24:44 +01:00
a4bbaf9f27 Fix up the lua tests
To be less retarded...
2025-12-19 13:22:17 +01:00
419a8118fc Update example with xml 2025-12-19 13:13:26 +01:00
da5b621cb6 Remove some unused shit and write tests for coverage 2025-12-19 13:13:26 +01:00
1df0263a42 Rework modifiers to variables again 2025-12-19 11:54:25 +01:00
74394cbde9 Integrate the xml processing with the rest of the project 2025-12-19 11:54:25 +01:00
f1ea0f9156 Hallucinate some xml helper functions in lua 2025-12-19 11:54:20 +01:00
fff8869aff Add testfiles 2025-12-19 11:54:20 +01:00
a0c5a5f18c Hallucinate up an xml parser implementation
Who knows if this will work...
2025-12-19 11:54:20 +01:00
b309e3e6f0 Update example file with json commands 2025-12-19 11:54:20 +01:00
09cdc91761 Rework variables to not be commands... 2025-12-19 11:32:59 +01:00
a18573c9f8 Memoize the glob statement
Because we were doing the same work many times :(
2025-12-02 16:50:39 +01:00
eacc92ce4b Rename GLob to glob 2025-12-02 16:36:11 +01:00
3bcc958dda Remove the error return value and instead just throw error 2025-11-15 18:10:24 +01:00
11f0bbee53 "Rework" the csv parsing to cook metatable for header access instead of whatever the fuck I was doing 2025-11-15 18:06:21 +01:00
c145ad0900 Add headers to rowS (SSSSSSSSSSSSSSSS) and not individual row 2025-11-15 16:56:46 +01:00
e02c1f018f fixup! Add lua csv parser regression test(s) 2025-11-15 16:54:22 +01:00
07fea6238f Add lua csv parser regression test(s) 2025-11-15 16:53:06 +01:00
5f1fdfa6c1 Fix some go linter warnings 2025-11-15 16:53:06 +01:00
4fb25d0463 Add a complex test for csv parser 2025-11-15 16:37:38 +01:00
bf23894188 Check options passed to csv parser 2025-11-15 16:30:53 +01:00
aec0f9f171 Update readme for csv parsing 2025-11-15 16:01:36 +01:00
83fed68432 Fix csv header key assignment 2025-11-15 16:01:31 +01:00
4311533445 Lowercase the csv options 2025-11-15 15:57:21 +01:00
ce28b948d0 Add an options parameter to csv parser and comment support 2025-11-15 15:51:49 +01:00
efc602e0ba Add a few more lua tests 2025-11-15 15:43:50 +01:00
917063db0c Refactor lua helper script to separate file
And write a few tests for it
2025-11-15 15:42:57 +01:00
3e552428a5 Improve the csv parser by reading header and assigning values to their header
So we have things like row[1] AND ALSO row["foobar"]
And also row.foobar of course
2025-11-15 15:39:49 +01:00
50455c491d Add support for any SV like TSV 2025-11-15 15:25:18 +01:00
12ec399b09 Do some retarded shit idk what claude did here hopefully something good this will probably get dropped 2025-11-11 12:53:53 +01:00
5a49998c2c Add a toCSV to go along with the fromCSV 2025-11-03 19:28:00 +01:00
590f19603e Make regex matching set INTEGER keys not string 2025-11-03 19:07:15 +01:00
ee8c4b9aa5 Ah oops, can't be local oopsie!! 2025-11-03 16:35:53 +01:00
e8d6613ac8 Add ParseCSV as lua function 2025-11-03 16:33:44 +01:00
91ad9006fa Move the example generation to separate flag 2025-11-02 20:04:39 +01:00
60ba3ad417 Fix some tests that broke for some good reason I'm sure 2025-10-26 17:10:42 +01:00
b74e4724d4 Convert \n to \r?\n because of windows thank you windows :) 2025-10-26 17:04:39 +01:00
30246fd626 Fix logging the regex
It was adding backslashes and shit
2025-10-26 17:04:39 +01:00
06aed7b27a Migrate from flag to cobra 2025-10-26 16:34:44 +01:00
b001dfe667 Embed the example file instead of generting it dynamically 2025-10-26 15:17:30 +01:00
d905ad027a Manually generate the example toml to "enforce" single quotes (looks nicer!) 2025-10-26 15:14:02 +01:00
3f6a03aee8 Add conversion tests 2025-10-26 15:07:55 +01:00
302e874710 Add conversion functionality from yml to toml 2025-10-26 15:05:22 +01:00
9d9820072a Hallucinate a whole lotta tests for toml integration 2025-10-26 15:03:48 +01:00
53d14345b9 Add support (and preference) to toml from yml 2025-10-26 14:56:04 +01:00
67c3346f2f Add test for multiple isolate commands on same line of text 2025-10-24 17:13:28 +02:00
346afdd143 Fix some shit 2025-10-23 00:19:07 +02:00
48729cdfa4 Add isolate tests 2025-10-23 00:16:35 +02:00
b9574f0106 "Fix" isolate commands fucking each other (hallucinate) 2025-10-23 00:13:14 +02:00
635ca463c0 Hallucinate fixes to some tests 2025-10-21 10:38:39 +02:00
2459988ff0 Hallucinate a better logging lol 2025-10-21 10:10:16 +02:00
6ab08fe97f Change something? 2025-10-21 09:57:09 +02:00
2dafe4a981 Don't warn on no file in cache 2025-10-21 09:57:02 +02:00
ec24e0713d Simplify EvalRegex function by removing unnecessary panic handling and nil checks 2025-10-21 09:57:02 +02:00
969ccae25c Use diffs for tests 2025-08-22 10:10:37 +02:00
5b46ff0efd Fix broken test introduced in previous commit 2025-08-22 10:04:11 +02:00
d234616406 Add broken test 2025-08-22 09:53:00 +02:00
af3e55e518 Fix some retarded bullshit 2025-08-22 00:10:46 +02:00
13b48229ac Fix some bullshit (the re) 2025-08-22 00:05:22 +02:00
670f6ed7a0 Add tests for EvalRegex 2025-08-21 23:56:05 +02:00
bbc7c50fae Decringe 2025-08-21 23:17:36 +02:00
779d1e0a0e Fix some more shit I guess 2025-08-21 23:16:23 +02:00
54581f0216 Clean up the cringe 2025-08-21 23:10:18 +02:00
3d01822e77 Fix failing test 2025-08-21 23:05:57 +02:00
4e0ca92c77 Add failing test 2025-08-21 23:05:57 +02:00
388e54b3e3 Add comprehensive help string for available Lua functions 2025-08-21 22:32:10 +02:00
6f2e76221a Add real regex support to lua 2025-08-21 22:27:37 +02:00
e0d3b938e3 Fix tests 2025-08-21 22:26:20 +02:00
491a030bf8 Hallucinate actual json fucking thing 2025-08-21 22:19:21 +02:00
bff7cc2a27 Hallucinate a json mode implementation 2025-08-21 20:39:35 +02:00
ff30b00e71 refactor(db.go, file.go): improve database error handling and file snapshot seeding 2025-08-09 16:12:26 +02:00
e1eb5eeaa6 Improve config readability by removing unnecessary fields and adding omitempty 2025-08-08 09:58:03 +02:00
2a2e11d8e0 Add more examples to the configuration file generator 2025-08-08 09:52:47 +02:00
6eb4f31127 Implement regexes, an entry option allow for same modification to apply to multiple regexes and variables that can be referenced in lua 2025-08-08 09:50:31 +02:00
4b58e00c26 Hallucinate some logs
Hallucinate more logs

fix(utils/db.go): handle auto migration errors gracefully

fix(utils/modifycommand.go): improve file matching accuracy

fix(processor/regex.go): improve capture group deduplication logic

fix(utils/db.go): add logging for database wrapper initialization

feat(processor/regex.go): preserve input order when deduplicating capture groups

fix(utils/modifycommand.go): add logging for file matching skips

feat(processor/regex.go): add logging for capture group processing

feat(main.go): add trace logging for arguments and parallel workers

fix(main.go): add trace logging for file content

fix(utils/db.go): add logging for database opening

fix(main.go): add trace logging for file processing

fix(utils/modifycommand.go): improve file matching by using absolute paths

feat(modifycommand.go): add trace logging for file matching in AssociateFilesWithCommands

feat(main.go): add per-file association summary for better visibility when debugging
2025-08-08 08:10:51 +02:00
8ffd8af13c Use atomic values instead of mutexes 2025-08-01 16:38:31 +02:00
67861d4455 Now only save CHANGED files to database (before changes of course) 2025-08-01 16:34:48 +02:00
299e6d8bfe Fix glob matching when backslashes are used as separators 2025-07-30 14:41:38 +02:00
388822e90a Create example yml even when no args are provided
ie. invalid usage
2025-07-30 14:38:29 +02:00
91993b4548 Improve error handling in ResetAllFiles function by logging warnings for failed file writes instead of returning errors 2025-07-27 12:47:21 +02:00
bb69558aaa Fix issue where invalid isolate commands would prevent other isolate commands from running 2025-07-21 21:28:12 +02:00
052c670627 Add a simple trim to lua 2025-07-21 21:00:11 +02:00
67fd215d0e Don't stroke out when backup doesn't exist in db 2025-07-20 11:48:55 +02:00
9ecbbff6fa Implement special flags for dump and reset db 2025-07-20 11:47:45 +02:00
774ac0f0ca Implement proper "reset" that reads snapshots from database 2025-07-20 11:43:25 +02:00
b785d24a08 Implement saving snapshots to a database 2025-07-20 11:38:08 +02:00
22f991e72e Clean up shop a bit 2025-07-20 11:20:19 +02:00
5518b27663 Remove deprecated flags and rename filter to f 2025-07-20 11:12:58 +02:00
0b899dea2c Add Disabled flag to ModifyCommand 2025-07-19 11:08:51 +02:00
3424fea8ad Dump a basic "config" to example usage on failed command 2025-07-19 01:15:48 +02:00
ddc1d83d58 Fix file associations
It was fucked because we were removing the static path and then cramming
that into assications
2025-04-22 10:53:25 +02:00
4b0a85411d From cook FILE - F I L E - FILEEEEE
This is the 4th time I make the SAME fix
2025-04-22 10:46:03 +02:00
46e871b626 Fix flag collision with logger 2025-04-22 10:45:11 +02:00
258dcc88e7 Fix reference to utils 2025-04-18 12:48:24 +02:00
75bf449bed Remove logger and replace it with a library 2025-04-18 12:47:47 +02:00
58586395fb Add file util for later 2025-04-13 21:31:19 +02:00
c5a68af5e6 PROPERLY implement doublestar 2025-04-13 21:29:18 +02:00
b4c0284734 Add rimworld cook file 2025-04-09 09:47:53 +02:00
c5d1dad8de Rename project to "cook" and ditch loading fgrom args, now files exclusively 2025-04-09 09:47:53 +02:00
4ff2ee80ee And fix the god damn backslashes fuck windows 2025-04-01 11:29:57 +02:00
633eebfd2a Support ~ in globs 2025-04-01 11:29:02 +02:00
5a31703840 Implement per command logger 2025-03-29 17:29:21 +01:00
162d0c758d Fix some tests 2025-03-29 17:29:21 +01:00
14d64495b6 Add deduplicate flag 2025-03-29 17:29:21 +01:00
fe6e97e832 Don't deduplicate (yet) 2025-03-29 17:23:21 +01:00
35b3d8b099 Reduce some of the reads and writes
It's really not necessary
2025-03-28 23:39:11 +01:00
2e3e958e15 Fix some tests and add some logs 2025-03-28 23:31:44 +01:00
955afc4295 Refactor running commands to separate functions 2025-03-28 16:59:22 +01:00
2c487bc443 Implement "Isolate" commands
Commands that run alone one by one on reading and writing the file
This should be used on commands that will modify a large part of the
file (or generally large parts)
Since that can fuck up the indices of other commands when ran together
2025-03-28 16:56:39 +01:00
b77224176b Add file lua value 2025-03-28 16:47:21 +01:00
a2201053c5 Remove some random ass fmt printf 2025-03-28 13:24:12 +01:00
04cedf5ece Fix the concurrent map writes 2025-03-28 11:35:38 +01:00
ebb07854cc Memoize the match table 2025-03-28 11:31:27 +01:00
8a86ae2f40 Add filter flag 2025-03-28 11:20:44 +01:00
e8f16dda2b Housekeeping 2025-03-28 02:14:27 +01:00
513773f641 Again 2025-03-28 01:26:26 +01:00
22914fe243 Add a lil log 2025-03-28 01:24:23 +01:00
2d523dfe64 Rename pattern to regex 2025-03-28 01:08:48 +01:00
2629722f67 Minor fixes and tweaks 2025-03-28 01:03:27 +01:00
1f6c4e4976 Fix up the tests and some minor bugs 2025-03-28 00:51:26 +01:00
bfd08e754e Replace old tests with asserts 2025-03-28 00:40:53 +01:00
750010b71a Add more tests to regex 2025-03-28 00:28:51 +01:00
9064a53820 Add more tests (and fix some things) for replacecommand 2025-03-28 00:23:42 +01:00
294c04a11a Add more tests for modifycommand 2025-03-28 00:03:23 +01:00
ba7ac07001 Fix up the logs a little 2025-03-27 23:36:56 +01:00
5d10178bf9 Update old and add new tests 2025-03-27 23:33:57 +01:00
f91c2b4795 More cleaning up 2025-03-27 23:07:22 +01:00
057db23d09 Implement panic recovery :?? 2025-03-27 23:06:46 +01:00
bf72734b90 Clean up regex.go a little 2025-03-27 23:04:39 +01:00
cc30c2bdcb Cleanup 2025-03-27 22:56:42 +01:00
f453079c72 Fix up regex.go 2025-03-27 22:50:15 +01:00
e634fe28bd Clean up processor 2025-03-27 22:24:59 +01:00
4e4b7bbd19 Implement parallel file processing 2025-03-27 22:22:43 +01:00
89eed3f847 Refactor git shit to its own module 2025-03-27 22:20:22 +01:00
f008efd5e1 Refactor modify and replace to their own files 2025-03-27 22:18:12 +01:00
f6def1e5a5 Refactor entirety of replace command to main for now 2025-03-27 22:11:03 +01:00
867b188718 Work out file reading and writing 2025-03-27 22:02:36 +01:00
aac29a4074 Refactor more stuff around 2025-03-27 21:58:52 +01:00
8a40f463f7 Implement file command association 2025-03-27 21:54:46 +01:00
8d4db1da91 Clean up code add some log lines and tidy up expandglobs 2025-03-27 21:49:28 +01:00
d41e2afe17 Update 2025-03-27 21:43:36 +01:00
76457d22cf Partially rework reading args to modify command loading 2025-03-27 21:39:16 +01:00
912950d463 Remove the vestiges of xml and json 2025-03-27 21:31:45 +01:00
25326ea11b Remove xml and json
They are simply not as useful as regex at all
There is nothing they can do regex cannot
And they have one massive penalty: the encoding
Which often results in MASSIVE diffs
2025-03-27 21:28:20 +01:00
df212b7fcc Remove jsonpath and xpath 2025-03-27 21:27:47 +01:00
f4a963760a Add dumptable helper function 2025-03-27 20:07:59 +01:00
d236811cb9 Introduce a new logging level for lua values 2025-03-27 20:06:50 +01:00
da93770334 Add strsplit lua helper 2025-03-27 19:56:31 +01:00
d9f54a8354 Fix test again 2025-03-27 19:49:57 +01:00
dc8da8ab63 Fix overlapping capture groups 2025-03-27 19:43:06 +01:00
24262a7dca Remove old unused xml files 2025-03-27 19:31:54 +01:00
d77b13c363 Update regression test 2025-03-27 19:31:20 +01:00
a9c60a3698 Neatly align log columns 2025-03-27 19:26:14 +01:00
66bcf21d79 Add goroutine numbers to log lines 2025-03-27 19:19:39 +01:00
e847e5c3ce Make little better logging 2025-03-27 18:53:02 +01:00
9a70c9696e Fix logger 2025-03-27 18:46:28 +01:00
9cea103042 Implement a more better logging solution 2025-03-27 17:53:43 +01:00
81d8259dfc Comment out some xml tests for now
We're not working on it for now
2025-03-27 17:46:43 +01:00
5c5fbac63f Make doublestar a little cleaner 2025-03-27 17:21:13 +01:00
3e818e61c7 Add string.format shortcut to lua 2025-03-27 15:38:07 +01:00
001470ffe4 Fix up regression tests 2025-03-27 15:37:57 +01:00
d88a76c4e2 Fix logging of groups 2025-03-26 22:26:02 +01:00
d3a1f1bd96 Rework regex grouping to avoid changing the same area twice 2025-03-26 22:24:19 +01:00
07a5f3f1a4 Add replaceCommands to avoid index suicide 2025-03-26 21:55:34 +01:00
e2257e082a Add a regression test 2025-03-26 21:55:17 +01:00
b3fce4244d Fix regex for numbers to support negative numbers 2025-03-26 18:30:21 +01:00
bd443067b6 Add support for !num inside of named capture groups 2025-03-26 14:04:39 +01:00
70 changed files with 16621 additions and 8005 deletions

3
.gitignore vendored
View File

@@ -1 +1,4 @@
*.exe
.qodo
*.sqlite
.cursor/rules

105
.vscode/launch.json vendored
View File

@@ -5,16 +5,111 @@
"version": "0.2.0",
"configurations": [
{
"name": "Launch Package",
"name": "Launch Package (Barotrauma)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"*.yml",
]
},
{
"name": "Launch Package (Payday 2)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Payday2",
"args": [
"-loglevel",
"trace",
"*.yml",
]
},
{
"name": "Launch Package (Barotrauma cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Barotrauma",
"args": [
"-loglevel",
"trace",
"-cook",
"cookassistant.yml",
]
},
{
"name": "Launch Package (Quasimorph cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Quasimorph",
"args": [
"cook.yml",
]
},
{
"name": "Launch Package (Rimworld cookfile)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Rimworld/294100",
"args": [
"cookVehicles.yml",
]
},
{
"name": "Launch Package (Workspace)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"args": [
"-mode=json",
"$..name",
"v='pero'",
"test.json"
"tester.yml",
]
},
{
"name": "Launch Package (Avorion)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Avorion/Avorion",
"args": [
"*.yml",
]
},
{
"name": "Launch Package (Minecraft)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-Minecraft",
"args": [
"cook_tacz.yml",
]
},
{
"name": "Launch Package (ICARUS)",
"type": "go",
"request": "launch",
"mode": "auto",
"program": "${workspaceFolder}",
"cwd": "C:/Users/Administrator/Seafile/Games-ICARUS/Icarus/Saved/IME3/Mods",
"args": [
"-loglevel",
"trace",
"cook_processorrecipes.yml",
]
}
]

View File

@@ -16,6 +16,7 @@ A Go-based tool for modifying XML, JSON, and text documents using XPath/JSONPath
- String manipulations
- Date conversions
- Structural changes
- CSV/TSV parsing with comments and headers
- Whole ass Lua environment
- **Error Handling**: Comprehensive error detection for:
- Invalid XML/JSON
@@ -101,6 +102,87 @@ chef -xml "//item" "if tonumber(v.stock) > 0 then v.price = v.price * 0.8 end" i
<item stock="5" price="8.00"/>
```
### 6. CSV/TSV Processing
The Lua environment includes CSV parsing functions that support comments, headers, and custom delimiters.
```lua
-- Basic CSV parsing
local rows = fromCSV(csvText)
-- With options
local rows = fromCSV(csvText, {
delimiter = "\t", -- Tab delimiter for TSV (default: ",")
hasHeaders = true, -- First row is headers (default: false)
hasComments = true -- Filter lines starting with # (default: false)
})
-- Access by index
local value = rows[1][2]
-- Access by header name (when hasHeaders = true)
local value = rows[1].Name
-- Convert back to CSV
local csv = toCSV(rows, "\t") -- Optional delimiter parameter
```
**Example with commented TSV file:**
```lua
-- Input file:
-- #mercenary_profiles
-- Id Name Value
-- 1 Test 100
-- 2 Test2 200
local csv = readFile("mercenaries.tsv")
local rows = fromCSV(csv, {
delimiter = "\t",
hasHeaders = true,
hasComments = true
})
-- Access data
rows[1].Name -- "Test"
rows[2].Value -- "200"
```
## Lua Helper Functions
The Lua environment includes many helper functions:
### Math Functions
- `min(a, b)`, `max(a, b)` - Min/max of two numbers
- `round(x, n)` - Round to n decimal places
- `floor(x)`, `ceil(x)` - Floor/ceiling functions
### String Functions
- `upper(s)`, `lower(s)` - Case conversion
- `trim(s)` - Remove leading/trailing whitespace
- `format(s, ...)` - String formatting
- `strsplit(inputstr, sep)` - Split string by separator
### CSV Functions
- `fromCSV(csv, options)` - Parse CSV/TSV text into table of rows
- Options: `delimiter` (default: ","), `hasHeaders` (default: false), `hasComments` (default: false)
- `toCSV(rows, delimiter)` - Convert table of rows back to CSV text
### Conversion Functions
- `num(str)` - Convert string to number (returns 0 if invalid)
- `str(num)` - Convert number to string
- `is_number(str)` - Check if string is numeric
### Table Functions
- `isArray(t)` - Check if table is a sequential array
- `dump(table, depth)` - Print table structure recursively
### HTTP Functions
- `fetch(url, options)` - Make HTTP request, returns response table
- Options: `method`, `headers`, `body`
- Returns: `{status, statusText, ok, body, headers}`
### Regex Functions
- `re(pattern, input)` - Apply regex pattern, returns table with matches
## Installation
```bash

View File

@@ -1,651 +0,0 @@
<?xml version="1.0" encoding="utf-8"?>
<Talents>
<Talent identifier="powerarmor">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.powerarmor">
<Replace tag="[bonusmovement]" value="25" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.exosuit" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHasItem tags="deepdivinglarge" />
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.25" />
</Abilities>
</AbilityGroupInterval>
<AddedRecipe itemidentifier="exosuit"/>
</Talent>
<Talent identifier="foolhardy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="foolhardy" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="berserker">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.lowhealthstatboost">
<Replace tag="[health]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.meleedamagebonus" color="gui.orange"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionAboveVitality invert="true" vitalitypercentage="0.5"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true" multiplyafflictionsbymaxvitality="true">
<Affliction identifier="berserker" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="mudraptorwrestler">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.mudraptorwrestler">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.additionalstattypeself">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.physicalresistance" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData weapontype="NoWeapon,Melee" />
<AbilityConditionCharacter>
<Conditional group="eq mudraptor" />
</AbilityConditionCharacter>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveResistance resistanceid="damage" multiplier="0.9"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="heavylifting">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.heavylifting">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionHoldingItem tags="alienartifact,crate"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyStat stattype="MovementSpeed" value="0.2"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="iamthatguy">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.iamthatguy">
<Replace tag="[amount]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.skillbonus">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[skillname]" value="stattypenames.weaponsskillbonus" color="gui.orange"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.heavywrench" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="WeaponsSkillBonus" value="20"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAddDamageAffliction">
<Abilities>
<CharacterAbilityModifyAffliction afflictionidentifiers="blunttrauma" addedmultiplier="0.2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="heavywrench"/>
</Talent>
<Talent identifier="robotics">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.robotics"/>
<Description tag="talentdescription.roboticsreminder">
<Replace tag="[amount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.defensebotspawner,entityname.defensebotammobox" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="defensebotspawner"/>
<AddedRecipe itemidentifier="defensebotammobox"/>
</Talent>
<Talent identifier="ironstorm">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.ironstorm">
<Replace tag="[chance]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.scrapcannon" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifieroverride" value="3"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="scrapcannon"/>
</Talent>
<Talent identifier="residualwaste">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.residualwaste">
<Replace tag="[chance]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomChance="0.2"/>
<!-- don't allow duplicating genetic materials, and prevent infinite FPGA circuits -->
<AbilityConditionItem tags="geneticmaterial,unidentifiedgeneticmaterial,circuitboxcomponent,lightcomponent" invert="true"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="massproduction">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.massproduction">
<Replace tag="[chance]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemFabricatedIngredients">
<Conditions>
<AbilityConditionServerRandom randomChance="0.4" />
</Conditions>
<Abilities>
<CharacterAbilityRemoveRandomIngredient>
<AbilityConditionItem category="Material"/>
</CharacterAbilityRemoveRandomIngredient>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="toolmaintenance">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="5,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.toolmaintenance">
<Replace tag="[amount]" value="1" color="gui.green"/>
</Description>
<!-- Give once when unlocking the talent -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupEffect>
<!-- Give every 60 seconds for late comers -->
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="tool~toolmaintenance" stattype="IncreaseFabricationQuality" value="1" targetallies="true" setvalue="true"/>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="miner">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="2,3" sheetelementsize="428,428"/>
<Description tag="talentdescription.miner">
<Replace tag="[probability]" value="320" color="gui.green"/>
</Description>
<Description tag="talentdescription.gainoredetachspeed">
<Replace tag="[amount]" value="1600" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolDeattachTimeMultiplier" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionServerRandom randomchance="12.8"/>
<AbilityConditionItem tags="ore"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="retrofit">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="3,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.retrofit" />
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilitySetMetadataInt identifier="tiermodifiers.increasewallhealth" value="1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ironman">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.ironhelmet,entityname.makeshiftarmor" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="ironhelmet"/>
<AddedRecipe itemidentifier="makeshiftarmor"/>
</Talent>
<Talent identifier="oiledmachinery">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="4,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.oiledmachinery">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="fabricator" stattype="FabricationSpeed" value="1.5" />
<CharacterAbilityGiveItemStatToTags tags="deconstructor" stattype="DeconstructorSpeed" value="1.5" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="pumpndump">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="1,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.pumpndump">
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxflow" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<conditions>
<AbilityConditionItem tags="pump"/>
</conditions>
<Abilities>
<CharacterAbilityGiveItemStat stattype="PumpSpeed" value="1.1"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="ballastdenizen">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="7,6" sheetelementsize="128,128"/>
<Description tag="talentdescription.ballastdenizen">
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="HoldBreathMultiplier" value="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="engineengineer">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="2,5" sheetelementsize="128,128"/>
<Description tag="talentdescription.engineengineer">
<Replace tag="[amount]" value="2.5" color="gui.green"/>
<Replace tag="[max]" value="5" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.maxspeed" color="gui.orange"/>
</Description>
<Description tag="talentdescription.doesnotstack" />
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="1" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.025" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="2" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.05" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="3" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.075" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="4" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.1" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="5" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.125" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="6" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.15" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel levelequals="7" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.175" />
</Abilities>
</AbilityGroupInterval>
<AbilityGroupInterval interval="60">
<Conditions>
<AbilityConditionHasLevel minlevel="8" />
</Conditions>
<Abilities>
<CharacterAbilityGiveItemStatToTags tags="engine" stattype="EngineMaxSpeed" stackable="false" value="1.2" />
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="multifunctional">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="6,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.multifunctional">
<Replace tag="[powerincrease]" value="50" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="wrenchitem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnAttack">
<Conditions>
<AbilityConditionAttackData tags="crowbaritem"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyAttackData addeddamagemultiplier="0.5"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="salvagecrew">
<Icon texture="Content/UI/TalentsIcons3.png" sheetindex="0,7" sheetelementsize="128,128"/>
<Description tag="talentdescription.bonusxponmission">
<Replace tag="[xpbonus]" value="30" color="gui.green"/>
<Replace tag="[missiontype]" value="missiontype.salvage" color="gui.orange"/>
</Description>
<Description tag="talentdescription.salvagecrew">
<Replace tag="[swimbonus]" value="50" color="gui.green"/>
<Replace tag="[resistanceamount]" value="10" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnGainMissionExperience">
<Conditions>
<AbilityConditionMission missiontype="Salvage"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="1.3"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupInterval interval="0.9">
<Conditions>
<AbilityConditionInSubmarine submarinetype="Wreck" />
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="This" disabledeltatime="true">
<Affliction identifier="salvagecrew" amount="1.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupInterval>
</Talent>
<Talent identifier="machinemaniac" trackedstat="machinemaniac_counter" trackedmax="100">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="3,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.machinemaniac">
<Replace tag="[bonus]" value="80" color="gui.green"/>
<Replace tag="[amount]" value="3" color="gui.orange"/>
</Description>
<Description tag="talentdescription.machinemaniac.30">
<Replace tag="[requirement]" value="12" color="gui.green"/>
<Replace tag="[amount]" value="10" color="gui.green"/>
<Replace tag="[skill]" value="stattypenames.mechanicalskillbonus" color="gui.orange"/>
<Replace tag="[xpamount]" value="500" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.50">
<Replace tag="[requirement]" value="20" color="gui.green"/>
<Replace tag="[level]" value="1" color="gui.green"/>
</Description>
<Description tag="talentdescription.machinemaniac.100">
<Replace tag="[requirement]" value="40" color="gui.green"/>
<Replace tag="[amount]" value="50" color="gui.green"/>
</Description>
<!-- Give the player stats that tracks if the rewards should be given -->
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_30" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_50" value="1" maxvalue="1" setvalue="true" />
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_100" value="1" maxvalue="1" setvalue="true" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="machinemaniac_counter" value="1" removeondeath="false" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_30" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="12"/>
</Conditions>
<Abilities>
<CharacterAbilityGiveExperience amount="2000"/>
<CharacterAbilityGivePermanentStat stattype="MechanicalSkillBonus" statidentifier="machinemaniac" value="10" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_30" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_50" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="20"/>
</Conditions>
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="increasemaxpumpflow" upgradecategory="pumps" level="1" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_50" />
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_100" min="1"/>
<AbilityConditionHasPermanentStat statidentifier="machinemaniac_counter" min="40"/>
</Conditions>
<Abilities>
<CharacterAbilityGivePermanentStat stattype="MechanicalRepairSpeed" statidentifier="machinemaniac" value="0.5" setvalue="true" removeondeath="false" />
<CharacterAbilityResetPermanentStat statidentifier="machinemaniac_100" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="tinkerer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.increasemaxrepairmechanical">
<Replace tag="[percentage]" value="40" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MaxRepairConditionMultiplierMechanical" value="0.4"/>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="modularrepairs">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,1" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.repairpack" color="gui.orange"/>
</Description>
<Description tag="talentdescription.freeupgrade">
<Replace tag="[level]" value="1" color="gui.green"/>
<Replace tag="[upgradename]" value="upgradename.decreaselowskillfixduration" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="repairpack"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="electricaldevices" level="1" />
<CharacterAbilityUpgradeSubmarine upgradeprefab="decreaselowskillfixduration" upgradecategory="mechanicaldevices" level="1" />
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="hullfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="0,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.fixfoamgrenade,entityname.handheldstatusmonitor" color="gui.orange"/>
</Description>
<Description tag="talentdescription.additionalstattype">
<Replace tag="[amount]" value="25" color="gui.green"/>
<Replace tag="[stattype]" value="stattypenames.repairtoolstructurerepairmultiplier" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="RepairToolStructureRepairMultiplier" value="0.25"/>
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="fixfoamgrenade"/>
<AddedRecipe itemidentifier="handheldstatusmonitor"/>
</Talent>
<Talent identifier="letitdrain">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="1,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.letitdrain"/>
<Description tag="talentdescription.letitdrainreminder">
<Replace tag="[itemcount]" value="2" color="gui.green"/>
</Description>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.portablepump" color="gui.orange"/>
</Description>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGivePermanentStat statidentifier="portablepump" stattype="MaxAttachableCount" value="2" />
</Abilities>
</AbilityGroupEffect>
<AddedRecipe itemidentifier="portablepump"/>
</Talent>
<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="scrapsavant">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="6,3" sheetelementsize="128,128"/>
<Description tag="talentdescription.doublescrapoutput" />
<Description tag="talentdescription.findadditionalscrap">
<Replace tag="[probability]" value="20" color="gui.green"/>
</Description>
<AbilityGroupEffect abilityeffecttype="OnItemDeconstructedMaterial">
<Conditions>
<AbilityConditionItem tags="scrap"/>
</Conditions>
<Abilities>
<CharacterAbilityModifyValue multiplyvalue="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnOpenItemContainer">
<Conditions>
<AbilityConditionItemInSubmarine submarinetype="Wreck"/>
<AbilityConditionItem tags="container"/>
</Conditions>
<Abilities>
<CharacterAbilitySpawnItemsToContainer randomchance="0.2" oncepercontainer="true">
<StatusEffects>
<StatusEffect type="OnAbility" target="UseTarget" >
<SpawnItem identifiers="scrap" spawnposition="ThisInventory" spawnifcantbecontained="false" />
</StatusEffect>
</StatusEffects>
</CharacterAbilitySpawnItemsToContainer>
</Abilities>
</AbilityGroupEffect>
</Talent>
<Talent identifier="safetyfirst">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="4,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.unlockrecipe">
<Replace tag="[itemname]" value="entityname.safetyharness" color="gui.orange"/>
</Description>
<AddedRecipe itemidentifier="safetyharness"/>
</Talent>
</Talents>

544
example_cook.toml Normal file
View File

@@ -0,0 +1,544 @@
# Global variables - available to all commands
[variables]
foobar = 4
multiply = 1.5
prefix = 'NEW_'
enabled = true
# Multi-regex example using variable in Lua
[[commands]]
name = 'RFToolsMultiply'
regexes = [
'generatePerTick = !num',
'ticksPer\w+ = !num',
'generatorRFPerTick = !num',
]
lua = '* foobar'
files = [
'polymc/instances/**/rftools*.toml',
'polymc\instances\**\rftools*.toml',
]
reset = true
# Named capture groups with arithmetic and string ops
[[commands]]
name = 'UpdateAmountsAndItems'
regex = '(?P<amount>!num)\s+units\s+of\s+(?P<item>[A-Za-z_\-]+)'
lua = 'amount = amount * multiply; item = upper(item); return true'
files = ['data/**/*.txt']
# Full replacement via Lua 'replacement' variable
[[commands]]
name = 'BumpMinorVersion'
regex = 'version\s*=\s*"(?P<major>!num)\.(?P<minor>!num)\.(?P<patch>!num)"'
lua = 'replacement = format("version=\"%s.%s.%s\"", major, num(minor)+1, 0); return true'
files = ['config/*.ini', 'config/*.cfg']
# TOML multiline regex example - single quotes make regex natural!
[[commands]]
name = 'StressValues'
regex = '''
\[kinetics\.stressValues\.v2\.capacity\]
steam_engine = !num
water_wheel = !num
copper_valve_handle = !num
hand_crank = !num
creative_motor = !num'''
lua = 'v1 * multiply'
files = ['*.txt']
isolate = true
# Network configuration with complex multiline regex
[[commands]]
name = 'NetworkConfig'
regex = '''
networking\.firewall\.allowPing = true
networking\.firewall\.allowedTCPPorts = \[ 47984 47989 47990 \]
networking\.firewall\.allowedUDPPortRanges = \[
\{ from = \d+; to = \d+; \}
\{ from = 8000; to = 8010; \}
\]'''
lua = "replacement = string.gsub(block[1], 'true', 'false')"
files = ['*.conf']
isolate = true
# Simple regex with single quotes - no escaping needed!
[[commands]]
name = 'EnableFlags'
regex = 'enabled\s*=\s*(true|false)'
lua = '= enabled'
files = ['**/*.toml']
# Demonstrate NoDedup to allow overlapping replacements
[[commands]]
name = 'OverlappingGroups'
regex = '(?P<a>!num)(?P<b>!num)'
lua = 'a = num(a) + 1; b = num(b) + 1; return true'
files = ['overlap/**/*.txt']
nodedup = true
# Isolate command example operating on entire matched block
[[commands]]
name = 'IsolateUppercaseBlock'
regex = '''BEGIN
(?P<block>!any)
END'''
lua = 'block = upper(block); return true'
files = ['logs/**/*.log']
loglevel = 'TRACE'
isolate = true
# Using !rep placeholder and arrays of files
[[commands]]
name = 'RepeatPlaceholderExample'
regex = 'name: (.*) !rep(, .* , 2)'
lua = '-- no-op, just demonstrate placeholder; return false'
files = ['lists/**/*.yml', 'lists/**/*.yaml']
# Using string variable in Lua expression
[[commands]]
name = 'PrefixKeys'
regex = '(?P<key>[A-Za-z0-9_]+)\s*='
lua = 'key = prefix .. key; return true'
files = ['**/*.properties']
# HTTP fetch example - get version from API and update config
[[commands]]
name = 'UpdateVersionFromAPI'
regex = 'version\s*=\s*"(?P<version>[^"]+)"'
lua = '''
local response = fetch("https://api.example.com/version", {
method = "GET",
headers = { ["Accept"] = "application/json" }
})
if response and response.body then
local data = fromJSON(response.body)
if data.latest then
version = data.latest
return true
end
end
return false
'''
files = ['version.conf']
# Complex multiline block replacement with state machine
[[commands]]
name = 'ModifyConfigBlock'
regex = '''(?x)
\[server\]
\s+host\s*=\s*"(?P<host>[^"]+)"
\s+port\s*=\s*(?P<port>\d+)
\s+ssl\s*=\s*(?P<ssl>true|false)'''
lua = '''
port = num(port) + 1000
ssl = "true"
replacement = format('[server]\n host = "%s"\n port = %d\n ssl = %s', host, port, ssl)
return true
'''
files = ['server.conf']
# Regex with !any to capture entire sections
[[commands]]
name = 'WrapInComment'
regex = 'FEATURE_START\n(?P<feature>!any)\nFEATURE_END'
lua = '''
replacement = "FEATURE_START\n# " .. feature:gsub("\n", "\n# ") .. "\nFEATURE_END"
return true
'''
files = ['features/**/*.txt']
# Advanced capture groups with complex logic
[[commands]]
name = 'UpdateDependencies'
regex = 'dependency\("(?P<group>[^"]+)", "(?P<name>[^"]+)", "(?P<version>[^"]+)"\)'
lua = '''
local major, minor, patch = version:match("(%d+)%.(%d+)%.(%d+)")
if major and minor and patch then
-- Bump minor version
minor = num(minor) + 1
version = format("%s.%s.0", major, minor)
return true
end
return false
'''
files = ['build.gradle', 'build.gradle.kts']
# JSON mode examples - modify single field
[[commands]]
name = 'JSONModifyField'
json = true
lua = '''
data.value = 84
modified = true
'''
files = ['data/**/*.json']
# JSON mode - add new field
[[commands]]
name = 'JSONAddField'
json = true
lua = '''
data.newField = "added"
modified = true
'''
files = ['config/**/*.json']
# JSON mode - modify nested fields
[[commands]]
name = 'JSONNestedModify'
json = true
lua = '''
if data.config and data.config.settings then
data.config.settings.enabled = true
data.config.settings.timeout = 60
modified = true
end
'''
files = ['settings/**/*.json']
# JSON mode - modify array elements
[[commands]]
name = 'JSONArrayMultiply'
json = true
lua = '''
if data.items then
for i, item in ipairs(data.items) do
data.items[i].value = item.value * multiply
end
modified = true
end
'''
files = ['data/**/*.json']
# JSON mode - modify object version
[[commands]]
name = 'JSONObjectUpdate'
json = true
lua = '''
data.version = "2.0.0"
data.enabled = enabled
modified = true
'''
files = ['config/**/*.json']
# JSON mode - surgical editing of specific row
[[commands]]
name = 'JSONSurgicalEdit'
json = true
lua = '''
if data.Rows and data.Rows[1] then
data.Rows[1].Weight = 999
modified = true
end
'''
files = ['items/**/*.json']
# JSON mode - remove array elements conditionally
[[commands]]
name = 'JSONRemoveDisabled'
json = true
lua = '''
if data.features then
local i = 1
while i <= #data.features do
if data.features[i].enabled == false then
table.remove(data.features, i)
else
i = i + 1
end
end
modified = true
end
'''
files = ['config/**/*.json']
# JSON mode - deep nested object manipulation
[[commands]]
name = 'JSONDeepUpdate'
json = true
lua = '''
if data.game and data.game.balance and data.game.balance.economy then
local econ = data.game.balance.economy
econ.inflation = (econ.inflation or 1.0) * 1.05
econ.taxRate = 0.15
econ.lastUpdate = os.date("%Y-%m-%d")
modified = true
end
'''
files = ['settings/**/*.json']
# JSON mode - iterate and transform all matching objects
[[commands]]
name = 'JSONTransformItems'
json = true
lua = '''
local function processItem(item)
if item.type == "weapon" and item.damage then
item.damage = item.damage * multiply
item.modified = true
end
end
if data.items then
for _, item in ipairs(data.items) do
processItem(item)
end
modified = true
elseif data.inventory then
for _, item in ipairs(data.inventory) do
processItem(item)
end
modified = true
end
'''
files = ['data/**/*.json']
# CSV processing example - read, modify, write
[[commands]]
name = 'CSVProcess'
regex = '(?P<csv>!any)'
lua = '''
local rows = fromCSV(csv, { hasheader = true })
for i, row in ipairs(rows) do
if row.Value then
row.Value = num(row.Value) * multiply
end
end
replacement = toCSV(rows, { hasheader = true })
return true
'''
files = ['data/**/*.csv']
# CSV processing with custom delimiter (TSV)
[[commands]]
name = 'TSVProcess'
regex = '(?P<tsv>!any)'
lua = '''
local rows = fromCSV(tsv, { delimiter = "\t", hasheader = true, hascomments = true })
for i, row in ipairs(rows) do
if row.Price then
row.Price = num(row.Price) * 1.1
end
end
replacement = toCSV(rows, { delimiter = "\t", hasheader = true })
return true
'''
files = ['data/**/*.tsv']
# CSV processing - modify specific columns
[[commands]]
name = 'CSVModifyColumns'
regex = '(?P<csv>!any)'
lua = '''
local rows = fromCSV(csv, { hasheader = true })
for i, row in ipairs(rows) do
if row.Name then
row.Name = prefix .. row.Name
end
if row.Status then
row.Status = upper(row.Status)
end
end
replacement = toCSV(rows, { hasheader = true })
return true
'''
files = ['exports/**/*.csv']
# XML mode - multiply numeric attributes using helper functions
[[commands]]
name = 'XMLMultiplyAttributes'
regex = '(?P<xml>!any)'
lua = '''
visitElements(data, function(elem)
if elem._tag == "Item" then
modifyNumAttr(elem, "Weight", function(val) return val * multiply end)
modifyNumAttr(elem, "Value", function(val) return val * foobar end)
end
end)
modified = true
'''
files = ['game/**/*.xml']
# XML mode - modify specific element attributes
[[commands]]
name = 'XMLUpdateAfflictions'
regex = '(?P<xml>!any)'
lua = '''
local afflictions = findElements(data, "Affliction")
for _, affliction in ipairs(afflictions) do
local id = getAttr(affliction, "identifier")
if id == "burn" or id == "bleeding" then
modifyNumAttr(affliction, "strength", function(val) return val * 0.5 end)
setAttr(affliction, "description", "Weakened effect")
end
end
modified = true
'''
files = ['config/Afflictions.xml']
# XML mode - add new elements using helpers
[[commands]]
name = 'XMLAddItems'
regex = '(?P<xml>!any)'
lua = '''
local items = findFirstElement(data, "Items")
if items then
local newItem = {
_tag = "Item",
_attr = {
identifier = "new_item",
Weight = "10",
Value = "500"
}
}
addChild(items, newItem)
modified = true
end
'''
files = ['items/**/*.xml']
# XML mode - remove elements by attribute value
[[commands]]
name = 'XMLRemoveDisabled'
regex = '(?P<xml>!any)'
lua = '''
visitElements(data, function(elem)
if elem._tag == "Feature" and getAttr(elem, "enabled") == "false" then
-- Mark for removal (actual removal happens via parent)
elem._remove = true
end
end)
-- Remove marked children
visitElements(data, function(elem)
if elem._children then
local i = 1
while i <= #elem._children do
if elem._children[i]._remove then
table.remove(elem._children, i)
else
i = i + 1
end
end
end
end)
modified = true
'''
files = ['config/**/*.xml']
# XML mode - conditional attribute updates based on other attributes
[[commands]]
name = 'XMLConditionalUpdate'
regex = '(?P<xml>!any)'
lua = '''
visitElements(data, function(elem)
if elem._tag == "Weapon" then
local tier = getAttr(elem, "tier")
if tier and num(tier) >= 3 then
-- High tier weapons get damage boost
modifyNumAttr(elem, "damage", function(val) return val * 1.5 end)
setAttr(elem, "rarity", "legendary")
end
end
end)
modified = true
'''
files = ['weapons/**/*.xml']
# XML mode - modify nested elements
[[commands]]
name = 'XMLNestedModify'
regex = '(?P<xml>!any)'
lua = '''
local config = findFirstElement(data, "Configuration")
if config then
local settings = findFirstElement(config, "Settings")
if settings then
setAttr(settings, "timeout", "120")
setAttr(settings, "maxRetries", "5")
-- Add or update nested element
local logging = findFirstElement(settings, "Logging")
if not logging then
logging = {
_tag = "Logging",
_attr = { level = "DEBUG", enabled = "true" }
}
addChild(settings, logging)
else
setAttr(logging, "level", "INFO")
end
end
end
modified = true
'''
files = ['config/**/*.xml']
# XML mode - batch attribute operations
[[commands]]
name = 'XMLBatchAttributeUpdate'
regex = '(?P<xml>!any)'
lua = '''
-- Update all Price attributes across entire document
visitElements(data, function(elem)
if hasAttr(elem, "Price") then
modifyNumAttr(elem, "Price", function(val) return val * 1.1 end)
end
if hasAttr(elem, "Cost") then
modifyNumAttr(elem, "Cost", function(val) return val * 0.9 end)
end
end)
modified = true
'''
files = ['economy/**/*.xml']
# XML mode - clone and modify elements
[[commands]]
name = 'XMLCloneItems'
regex = '(?P<xml>!any)'
lua = '''
local items = findElements(data, "Item")
local newItems = {}
for _, item in ipairs(items) do
local id = getAttr(item, "identifier")
if id and id:match("^weapon_") then
-- Clone weapon as upgraded version
local upgraded = {
_tag = "Item",
_attr = {
identifier = id .. "_mk2",
Weight = getAttr(item, "Weight"),
Value = tostring(num(getAttr(item, "Value")) * 2)
}
}
table.insert(newItems, upgraded)
end
end
-- Add all new items
for _, newItem in ipairs(newItems) do
addChild(data, newItem)
end
if #newItems > 0 then
modified = true
end
'''
files = ['items/**/*.xml']
# XML mode - remove all children with specific tag
[[commands]]
name = 'XMLRemoveObsolete'
regex = '(?P<xml>!any)'
lua = '''
visitElements(data, function(elem)
-- Remove all "Deprecated" children
removeChildren(elem, "Deprecated")
removeChildren(elem, "Legacy")
end)
modified = true
'''
files = ['config/**/*.xml']

View File

@@ -1,6 +1,7 @@
package main
import (
"cook/utils"
"os"
"path/filepath"
"testing"
@@ -76,9 +77,14 @@ func TestGlobExpansion(t *testing.T) {
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
files, err := expandFilePatterns(tc.patterns)
// Convert string patterns to map[string]struct{} for ExpandGLobs
patternMap := make(map[string]struct{})
for _, pattern := range tc.patterns {
patternMap[pattern] = struct{}{}
}
files, err := utils.ExpandGlobs(patternMap)
if err != nil {
t.Fatalf("expandFilePatterns failed: %v", err)
t.Fatalf("ExpandGLobs failed: %v", err)
}
if len(files) != tc.expected {

60
go.mod
View File

@@ -1,39 +1,41 @@
module modify
module cook
go 1.24.1
go 1.23.2
require (
github.com/PaesslerAG/jsonpath v0.1.1
github.com/antchfx/xmlquery v1.4.4
git.site.quack-lab.dev/dave/cylogger v1.3.0
github.com/bmatcuk/doublestar/v4 v4.8.1
github.com/stretchr/testify v1.10.0
github.com/yuin/gopher-lua v1.1.1
gopkg.in/yaml.v3 v3.0.1
gorm.io/gorm v1.30.0
)
require (
dario.cat/mergo v1.0.0 // indirect
github.com/Microsoft/go-winio v0.6.2 // indirect
github.com/ProtonMail/go-crypto v1.1.5 // indirect
github.com/cloudflare/circl v1.6.0 // indirect
github.com/cyphar/filepath-securejoin v0.4.1 // indirect
github.com/emirpasic/gods v1.18.1 // indirect
github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 // indirect
github.com/go-git/go-billy/v5 v5.6.2 // indirect
github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 // indirect
github.com/kevinburke/ssh_config v1.2.0 // indirect
github.com/pjbgf/sha1cd v0.3.2 // indirect
github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 // indirect
github.com/skeema/knownhosts v1.3.1 // indirect
github.com/xanzy/ssh-agent v0.3.3 // indirect
golang.org/x/crypto v0.35.0 // indirect
golang.org/x/sys v0.30.0 // indirect
gopkg.in/warnings.v0 v0.1.2 // indirect
)
require (
github.com/PaesslerAG/gval v1.0.0 // indirect
github.com/antchfx/xpath v1.3.3 // indirect
github.com/go-git/go-git/v5 v5.14.0
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 // indirect
golang.org/x/net v0.35.0 // indirect
github.com/davecgh/go-spew v1.1.1 // indirect
github.com/hexops/valast v1.5.0 // indirect
github.com/inconshreveable/mousetrap v1.1.0 // indirect
github.com/jinzhu/inflection v1.0.0 // indirect
github.com/jinzhu/now v1.1.5 // indirect
github.com/kr/pretty v0.3.1 // indirect
github.com/mattn/go-sqlite3 v1.14.22 // indirect
github.com/pmezard/go-difflib v1.0.0 // indirect
github.com/rogpeppe/go-internal v1.14.1 // indirect
github.com/spf13/pflag v1.0.9 // indirect
github.com/tidwall/match v1.1.1 // indirect
github.com/tidwall/pretty v1.2.0 // indirect
golang.org/x/mod v0.21.0 // indirect
golang.org/x/sync v0.11.0 // indirect
golang.org/x/text v0.22.0 // indirect
golang.org/x/tools v0.26.0 // indirect
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c // indirect
mvdan.cc/gofumpt v0.4.0 // indirect
)
require (
github.com/BurntSushi/toml v1.5.0
github.com/google/go-cmp v0.6.0
github.com/spf13/cobra v1.10.1
github.com/tidwall/gjson v1.18.0
gorm.io/driver/sqlite v1.6.0
)

200
go.sum
View File

@@ -1,177 +1,75 @@
dario.cat/mergo v1.0.0 h1:AGCNq9Evsj31mOgNPcLyXc+4PNABt905YmuqPYYpBWk=
dario.cat/mergo v1.0.0/go.mod h1:uNxQE+84aUszobStD9th8a29P2fMDhsBdgRYvZOxGmk=
github.com/Microsoft/go-winio v0.5.2/go.mod h1:WpS1mjBmmwHBEWmogvA2mj8546UReBk4v8QkMxJ6pZY=
github.com/Microsoft/go-winio v0.6.2 h1:F2VQgta7ecxGYO8k3ZZz3RS8fVIXVxONVUPlNERoyfY=
github.com/Microsoft/go-winio v0.6.2/go.mod h1:yd8OoFMLzJbo9gZq8j5qaps8bJ9aShtEA8Ipt1oGCvU=
github.com/PaesslerAG/gval v1.0.0 h1:GEKnRwkWDdf9dOmKcNrar9EA1bz1z9DqPIO1+iLzhd8=
github.com/PaesslerAG/gval v1.0.0/go.mod h1:y/nm5yEyTeX6av0OfKJNp9rBNj2XrGhAf5+v24IBN1I=
github.com/PaesslerAG/jsonpath v0.1.0/go.mod h1:4BzmtoM/PI8fPO4aQGIusjGxGir2BzcV0grWtFzq1Y8=
github.com/PaesslerAG/jsonpath v0.1.1 h1:c1/AToHQMVsduPAa4Vh6xp2U0evy4t8SWp8imEsylIk=
github.com/PaesslerAG/jsonpath v0.1.1/go.mod h1:lVboNxFGal/VwW6d9JzIy56bUsYAP6tH/x80vjnCseY=
github.com/ProtonMail/go-crypto v1.1.5 h1:eoAQfK2dwL+tFSFpr7TbOaPNUbPiJj4fLYwwGE1FQO4=
github.com/ProtonMail/go-crypto v1.1.5/go.mod h1:rA3QumHc/FZ8pAHreoekgiAbzpNsfQAosU5td4SnOrE=
github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be h1:9AeTilPcZAjCFIImctFaOjnTIavg87rW78vTPkQqLI8=
github.com/anmitsu/go-shlex v0.0.0-20200514113438-38f4b401e2be/go.mod h1:ySMOLuWl6zY27l47sB3qLNK6tF2fkHG55UZxx8oIVo4=
github.com/antchfx/xmlquery v1.4.4 h1:mxMEkdYP3pjKSftxss4nUHfjBhnMk4imGoR96FRY2dg=
github.com/antchfx/xmlquery v1.4.4/go.mod h1:AEPEEPYE9GnA2mj5Ur2L5Q5/2PycJ0N9Fusrx9b12fc=
github.com/antchfx/xpath v1.3.3 h1:tmuPQa1Uye0Ym1Zn65vxPgfltWb/Lxu2jeqIGteJSRs=
github.com/antchfx/xpath v1.3.3/go.mod h1:i54GszH55fYfBmoZXapTHN8T8tkcHfRgLyVwwqzXNcs=
github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5 h1:0CwZNZbxp69SHPdPJAN/hZIm0C4OItdklCFmMRWYpio=
github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs=
git.site.quack-lab.dev/dave/cylogger v1.3.0 h1:eTWPUD+ThVi8kGIsRcE0XDeoH3yFb5miFEODyKUdWJw=
git.site.quack-lab.dev/dave/cylogger v1.3.0/go.mod h1:wctgZplMvroA4X6p8f4B/LaCKtiBcT1Pp+L14kcS8jk=
github.com/BurntSushi/toml v1.5.0 h1:W5quZX/G/csjUnuI8SUYlsHs9M38FC7znL0lIO+DvMg=
github.com/BurntSushi/toml v1.5.0/go.mod h1:ukJfTF/6rtPPRCnwkur4qwRxa8vTRFBF0uk2lLoLwho=
github.com/bmatcuk/doublestar/v4 v4.8.1 h1:54Bopc5c2cAvhLRAzqOGCYHYyhcDHsFF4wWIR5wKP38=
github.com/bmatcuk/doublestar/v4 v4.8.1/go.mod h1:xBQ8jztBU6kakFMg+8WGxn0c6z1fTSPVIjEY1Wr7jzc=
github.com/cloudflare/circl v1.6.0 h1:cr5JKic4HI+LkINy2lg3W2jF8sHCVTBncJr5gIIq7qk=
github.com/cloudflare/circl v1.6.0/go.mod h1:uddAzsPgqdMAYatqJ0lsjX1oECcQLIlRpzZh3pJrofs=
github.com/cyphar/filepath-securejoin v0.4.1 h1:JyxxyPEaktOD+GAnqIqTf9A8tHyAG22rowi7HkoSU1s=
github.com/cyphar/filepath-securejoin v0.4.1/go.mod h1:Sdj7gXlvMcPZsbhwhQ33GguGLDGQL7h7bg04C/+u9jI=
github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/cpuguy83/go-md2man/v2 v2.0.6/go.mod h1:oOW0eioCTA6cOiMLiUPZOpcVxMig6NIQQ7OS05n1F4g=
github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/elazarl/goproxy v1.7.2 h1:Y2o6urb7Eule09PjlhQRGNsqRfPmYI3KKQLFpCAV3+o=
github.com/elazarl/goproxy v1.7.2/go.mod h1:82vkLNir0ALaW14Rc399OTTjyNREgmdL2cVoIbS6XaE=
github.com/emirpasic/gods v1.18.1 h1:FXtiHYKDGKCW2KzwZKx0iC0PQmdlorYgdFG9jPXJ1Bc=
github.com/emirpasic/gods v1.18.1/go.mod h1:8tpGGwCnJ5H4r6BWwaV6OrWmMoPhUl5jm/FMNAnJvWQ=
github.com/gliderlabs/ssh v0.3.8 h1:a4YXD1V7xMF9g5nTkdfnja3Sxy1PVDCj1Zg4Wb8vY6c=
github.com/gliderlabs/ssh v0.3.8/go.mod h1:xYoytBv1sV0aL3CavoDuJIQNURXkkfPA/wxQ1pL1fAU=
github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376 h1:+zs/tPmkDkHx3U66DAb0lQFJrpS6731Oaa12ikc+DiI=
github.com/go-git/gcfg v1.5.1-0.20230307220236-3a3c6141e376/go.mod h1:an3vInlBmSxCcxctByoQdvwPiA7DTK7jaaFDBTtu0ic=
github.com/go-git/go-billy/v5 v5.6.2 h1:6Q86EsPXMa7c3YZ3aLAQsMA0VlWmy43r6FHqa/UNbRM=
github.com/go-git/go-billy/v5 v5.6.2/go.mod h1:rcFC2rAsp/erv7CMz9GczHcuD0D32fWzH+MJAU+jaUU=
github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399 h1:eMje31YglSBqCdIqdhKBW8lokaMrL3uTkpGYlE2OOT4=
github.com/go-git/go-git-fixtures/v4 v4.3.2-0.20231010084843-55a94097c399/go.mod h1:1OCfN199q1Jm3HZlxleg+Dw/mwps2Wbk9frAWm+4FII=
github.com/go-git/go-git/v5 v5.14.0 h1:/MD3lCrGjCen5WfEAzKg00MJJffKhC8gzS80ycmCi60=
github.com/go-git/go-git/v5 v5.14.0/go.mod h1:Z5Xhoia5PcWA3NF8vRLURn9E5FRhSl7dGj9ItW3Wk5k=
github.com/golang/groupcache v0.0.0-20210331224755-41bb18bfe9da/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc=
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8 h1:f+oWsMOmNPc8JmEHVZIycC7hBoQxHH9pNKQORJNozsQ=
github.com/golang/groupcache v0.0.0-20241129210726-2c02b8208cf8/go.mod h1:wcDNUvekVysuuOpQKo3191zZyTpiI6se1N1ULghS0sw=
github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE=
github.com/frankban/quicktest v1.14.3/go.mod h1:mgiwOwqx65TmIk1wJ6Q7wvnVMocbUorkibMOrVTHZps=
github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
github.com/google/go-cmp v0.7.0 h1:wk8382ETsv4JYUZwIsn6YpYiWiBsYLSJiTsyBybVuN8=
github.com/google/go-cmp v0.7.0/go.mod h1:pXiqmnSA92OHEEa9HXL2W4E7lf9JzCmGVUdgjX3N/iU=
github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A=
github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99/go.mod h1:1lJo3i6rXxKeerYnT8Nvf0QmHCRC1n8sfWVwXF2Frvo=
github.com/kevinburke/ssh_config v1.2.0 h1:x584FjTGwHzMwvHx18PXxbBVzfnxogHaAReU4gf13a4=
github.com/kevinburke/ssh_config v1.2.0/go.mod h1:CT57kijsi8u/K/BOFA39wgDQJ9CxiF4nAY/ojJ6r6mM=
github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
github.com/hexops/autogold v0.8.1 h1:wvyd/bAJ+Dy+DcE09BoLk6r4Fa5R5W+O+GUzmR985WM=
github.com/hexops/autogold v0.8.1/go.mod h1:97HLDXyG23akzAoRYJh/2OBs3kd80eHyKPvZw0S5ZBY=
github.com/hexops/gotextdiff v1.0.3 h1:gitA9+qJrrTCsiCl7+kh75nPqQt1cx4ZkudSTLoUqJM=
github.com/hexops/gotextdiff v1.0.3/go.mod h1:pSWU5MAI3yDq+fZBTazCSJysOMbxWL1BSow5/V2vxeg=
github.com/hexops/valast v1.5.0 h1:FBTuvVi0wjTngtXJRZXMbkN/Dn6DgsUsBwch2DUJU8Y=
github.com/hexops/valast v1.5.0/go.mod h1:Jcy1pNH7LNraVaAZDLyv21hHg2WBv9Nf9FL6fGxU7o4=
github.com/inconshreveable/mousetrap v1.1.0 h1:wN+x4NVGpMsO7ErUn/mUI3vEoE6Jt13X2s0bqwp9tc8=
github.com/inconshreveable/mousetrap v1.1.0/go.mod h1:vpF70FUmC8bwa3OWnCshd2FqLfsEA9PFc4w1p2J65bw=
github.com/jinzhu/inflection v1.0.0 h1:K317FqzuhWc8YvSVlFMCCUb36O/S9MCKRDI7QkRKD/E=
github.com/jinzhu/inflection v1.0.0/go.mod h1:h+uFLlag+Qp1Va5pdKtLDYj+kHp5pxUVkryuEj+Srlc=
github.com/jinzhu/now v1.1.5 h1:/o9tlHleP7gOFmsnYNz3RGnqzefHA47wQpKrrdTIwXQ=
github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/z8=
github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI=
github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE=
github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk=
github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ=
github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI=
github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE=
github.com/onsi/gomega v1.34.1 h1:EUMJIKUjM8sKjYbtxQI9A4z2o+rruxnzNvpknOXie6k=
github.com/onsi/gomega v1.34.1/go.mod h1:kU1QgUvBDLXBJq618Xvm2LUX6rSAfRaFRTcdOeDLwwY=
github.com/pjbgf/sha1cd v0.3.2 h1:a9wb0bp1oC2TGwStyn0Umc/IGKQnEgF0vVaZ8QF8eo4=
github.com/pjbgf/sha1cd v0.3.2/go.mod h1:zQWigSxVmsHEZow5qaLtPYxpcKMMQpa09ixqBxuCS6A=
github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
github.com/mattn/go-sqlite3 v1.14.22 h1:2gZY6PC6kBnID23Tichd1K+Z0oS6nE/XwU+Vz/5o4kU=
github.com/mattn/go-sqlite3 v1.14.22/go.mod h1:Uh1q+B4BYcTPb+yiD3kU8Ct7aC0hY9fxUwlHK0RXw+Y=
github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs=
github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
github.com/rogpeppe/go-internal v1.14.1/go.mod h1:MaRKkUm5W0goXpeCfT7UZI6fk/L7L7so1lCWt35ZSgc=
github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3 h1:n661drycOFuPLCN3Uc8sB6B/s6Z4t2xvBgU1htSHuq8=
github.com/sergi/go-diff v1.3.2-0.20230802210424-5b0b94c5c0d3/go.mod h1:A0bzQcvG0E7Rwjx0REVgAGH58e96+X0MeOfepqsbeW4=
github.com/sirupsen/logrus v1.7.0/go.mod h1:yWOB1SBYBC5VeMP7gHvWumXLIWorT60ONWic61uBYv0=
github.com/skeema/knownhosts v1.3.1 h1:X2osQ+RAjK76shCbvhHHHVl3ZlgDm8apHEHFqRjnBY8=
github.com/skeema/knownhosts v1.3.1/go.mod h1:r7KTdC8l4uxWRyK2TpQZ/1o5HaSzh06ePQNxPwTcfiY=
github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs=
github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4=
github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM=
github.com/spf13/cobra v1.10.1 h1:lJeBwCfmrnXthfAupyUTzJ/J4Nc1RsHC/mSRU2dll/s=
github.com/spf13/cobra v1.10.1/go.mod h1:7SmJGaTHFVBY0jW4NXGluQoLvhqFQM+6XSKD+P4XaB0=
github.com/spf13/pflag v1.0.9 h1:9exaQaMOCwffKiiiYk6/BndUBv+iRViNW+4lEMi0PvY=
github.com/spf13/pflag v1.0.9/go.mod h1:McXfInJRrz4CZXVZOBLb0bTZqETkiAhM9Iw0y3An2Bg=
github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA=
github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY=
github.com/xanzy/ssh-agent v0.3.3 h1:+/15pJfg/RsTxqYcX6fHqOXZwwMP+2VyYWJeWM2qQFM=
github.com/xanzy/ssh-agent v0.3.3/go.mod h1:6dzNDKs0J9rVPHPhaGCukekBHKqfl+L3KghI1Bc68Uw=
github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
github.com/tidwall/gjson v1.18.0 h1:FIDeeyB800efLX89e5a8Y0BNH+LOngJyGrIWxG2FKQY=
github.com/tidwall/gjson v1.18.0/go.mod h1:/wbyibRr2FHMks5tjHJ5F8dMZh3AcwJEMf5vlfC0lxk=
github.com/tidwall/match v1.1.1 h1:+Ho715JplO36QYgwN9PGYNhgZvoUSc9X2c80KVTi+GA=
github.com/tidwall/match v1.1.1/go.mod h1:eRSPERbgtNPcGhD8UCthc6PmLEQXEWd3PRB5JTxsfmM=
github.com/tidwall/pretty v1.2.0 h1:RWIZEg2iJ8/g6fDDYzMpobmaoGh5OLl4AXtGUGPcqCs=
github.com/tidwall/pretty v1.2.0/go.mod h1:ITEVvHYasfjBbM0u2Pg8T2nJnzm8xPwvNhhsoaGGjNU=
github.com/yuin/gopher-lua v1.1.1 h1:kYKnWBjvbNP4XLT3+bPEwAXJx262OhaHDWDVOPjL46M=
github.com/yuin/gopher-lua v1.1.1/go.mod h1:GBR0iDaNXjAgGg9zfCvksxSRnQx76gclCIb7kdAd1Pw=
golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc=
golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU=
golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8=
golang.org/x/crypto v0.31.0/go.mod h1:kDsLvtWBEx7MV9tJOj9bnXsPbxwJQ6csT/x4KIN4Ssk=
golang.org/x/crypto v0.35.0 h1:b15kiHdrGCHrP6LvwaQ3c03kgNhhiMgvlhxHQhmg2Xs=
golang.org/x/crypto v0.35.0/go.mod h1:dy7dXNW32cAb/6/PRuTNsix8T+vJAqvuIy5Bli/x0YQ=
golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56 h1:2dVuKD2vS7b0QIHQbpyTISPd0LeHDbnYEryqj5Q1ug8=
golang.org/x/exp v0.0.0-20240719175910-8a7402abbf56/go.mod h1:M4RDyNAINzryxdtnbRXRL/OHtkFuWGRjvuhBJpk2IlY=
golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.12.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/mod v0.15.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/mod v0.17.0/go.mod h1:hTbmBsO62+eylJbnUtE2MGJUyE7QWk4xUqPFrRgJ+7c=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
golang.org/x/net v0.15.0/go.mod h1:idbUs1IY1+zTqbi8yxTbhexhEEk5ur9LInksu6HrEpk=
golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44=
golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM=
golang.org/x/net v0.33.0/go.mod h1:HXLR5J+9DxmrqMwG9qjGCxZ+zKXxBru04zlTvWlWuN4=
golang.org/x/net v0.35.0 h1:T5GQRQb2y08kTAByq9L4/bz8cipCdA8FbRTXewonqY8=
golang.org/x/net v0.35.0/go.mod h1:EglIi67kWsHKlRzzVMUD93VMSWGFOMSZgxFjparz1Qk=
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y=
golang.org/x/sync v0.6.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.28.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/sys v0.30.0 h1:QjkSwP/36a20jFYWkSue1YwXzLmsV5Gfq7Eiy72C1uc=
golang.org/x/sys v0.30.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/telemetry v0.0.0-20240228155512-f48c80bd79b2/go.mod h1:TeRTkGYfJXctD9OcfyVLyj2J3IxLnKwHJR8f4D8a3YE=
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo=
golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU=
golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk=
golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY=
golang.org/x/term v0.27.0/go.mod h1:iMsnZpn0cago0GOrHO2+Y7u7JPn5AylBrcoWkElMTSM=
golang.org/x/term v0.29.0 h1:L6pJp37ocefwRRtYPKSWOWzOtWSxVajvz2ldH/xi3iU=
golang.org/x/term v0.29.0/go.mod h1:6bl4lRlvVuDgSf3179VpIxBF0o10JUpXWOnI7nErv7s=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ=
golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0=
golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY=
golang.org/x/sync v0.11.0 h1:GGz8+XQP4FvTTrjZPzNKTMFtSXH80RAzG+5ghFPgK9w=
golang.org/x/sync v0.11.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk=
golang.org/x/text v0.22.0 h1:bofq7m3/HAFvbF51jz3Q9wLg3jkvSPuiZu/pD1XwgtM=
golang.org/x/text v0.22.0/go.mod h1:YRoo4H8PVmsu+E3Ou7cqLVH8oXWIHVoX0jqUWALQhfY=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
golang.org/x/tools v0.13.0/go.mod h1:HvlwmtVNQAhOuCjW7xxvovg8wbNq7LwfXh/k7wXUl58=
golang.org/x/tools v0.21.1-0.20240508182429-e35e4ccd0d2d/go.mod h1:aiJjzUbINMkxbQROHiO6hDPo2LHcIPhhQsa9DLh0yGk=
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ=
golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
gopkg.in/warnings.v0 v0.1.2 h1:wFXVbFY8DY5/xOe1ECiWdKCzZlxgshcYVNkBHstARME=
gopkg.in/warnings.v0 v0.1.2/go.mod h1:jksf8JmL6Qr/oQM2OXTHunEvvTAsrWBLb6OOjuVWRNI=
gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA=
gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
gorm.io/driver/sqlite v1.6.0 h1:WHRRrIiulaPiPFmDcod6prc4l2VGVWHz80KspNsxSfQ=
gorm.io/driver/sqlite v1.6.0/go.mod h1:AO9V1qIQddBESngQUKWL9yoH93HIeA1X6V633rBwyT8=
gorm.io/gorm v1.30.0 h1:qbT5aPv1UH8gI99OsRlvDToLxW5zR7FzS9acZDOZcgs=
gorm.io/gorm v1.30.0/go.mod h1:8Z33v652h4//uMA76KjeDH8mJXPm1QNCYrMeatR0DOE=
mvdan.cc/gofumpt v0.4.0 h1:JVf4NN1mIpHogBj7ABpgOyZc65/UUOkKQFkoURsz4MM=
mvdan.cc/gofumpt v0.4.0/go.mod h1:PljLOHDeZqgS8opHRKLzp2It2VBuSdteAgqUfzMTxlQ=

417
isolate_test.go Normal file
View File

@@ -0,0 +1,417 @@
package main
import (
"os"
"path/filepath"
"testing"
"cook/utils"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/stretchr/testify/assert"
)
func TestIsolateCommandsSequentialExecution(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-sequential-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test file content
testContent := `BEGIN
block1 content with value 42
END
Some other content
BEGIN
block2 content with value 100
END
More content
BEGIN
block3 content with value 200
END`
testFile := filepath.Join(tmpDir, "test.txt")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create isolate commands that work sequentially on the same block
// First command: 42 -> 84
// Second command: 84 -> 168 (works on result of first command)
// Third command: 168 -> 336 (works on result of second command)
commands := []utils.ModifyCommand{
{
Name: "MultiplyFirst",
Regex: `BEGIN\n(?P<block>.*?value 42.*?)\nEND`,
Lua: `replacement = "BEGIN\n" .. string.gsub(block, "42", "84") .. "\nEND"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
{
Name: "MultiplySecond",
Regex: `BEGIN\nblock1 content with value (?P<value>!num)\nEND`,
Lua: `value = "168"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
{
Name: "MultiplyThird",
Regex: `BEGIN\nblock1 content with value (?P<value>!num)\nEND`,
Lua: `value = "336"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
}
// Associate files with commands
files := []string{"test.txt"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Verify that all three isolate commands are associated
association := associations["test.txt"]
assert.Len(t, association.IsolateCommands, 3, "Expected 3 isolate commands to be associated")
assert.Len(t, association.Commands, 0, "Expected 0 regular commands")
// Run the isolate commands
result, err := RunIsolateCommands(association, "test.txt", testContent, false)
if err != nil && err != ErrNothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify that all isolate commands were applied sequentially
// First command: 42 -> 84
// Second command: 84 -> 168 (works on result of first)
// Third command: 168 -> 336 (works on result of second)
assert.Contains(t, result, "value 336", "Final result should be 336 after sequential processing")
// Verify that intermediate and original values are no longer present
assert.NotContains(t, result, "value 42", "Original value 42 should be replaced")
assert.NotContains(t, result, "value 84", "Intermediate value 84 should be replaced")
assert.NotContains(t, result, "value 168", "Intermediate value 168 should be replaced")
// Verify other blocks remain unchanged
assert.Contains(t, result, "value 100", "Second block should remain unchanged")
assert.Contains(t, result, "value 200", "Third block should remain unchanged")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("Result content:\n%s\n", result)
}
func TestIsolateCommandsWithDifferentPatterns(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-different-patterns-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test file content with distinct patterns
testContent := `SECTION1
value = 10
END_SECTION1
SECTION2
value = 20
END_SECTION2`
testFile := filepath.Join(tmpDir, "test.txt")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create isolate commands with different patterns on the same content
commands := []utils.ModifyCommand{
{
Name: "UpdateSection1",
Regex: `SECTION1.*?value = (?P<value>!num).*?END_SECTION1`,
Lua: `value = "100"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
{
Name: "UpdateSection2",
Regex: `SECTION2.*?value = (?P<value>!num).*?END_SECTION2`,
Lua: `value = "200"; return true`,
Files: []string{"test.txt"},
Isolate: true,
},
}
// Associate files with commands
files := []string{"test.txt"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Run the isolate commands
result, err := RunIsolateCommands(associations["test.txt"], "test.txt", testContent, false)
if err != nil && err != ErrNothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify that both isolate commands were applied
assert.Contains(t, result, "value = 100", "Section1 should be updated")
assert.Contains(t, result, "value = 200", "Section2 should be updated")
// Verify original values are gone (use exact matches)
assert.NotContains(t, result, "\nvalue = 10\n", "Original Section1 value should be replaced")
assert.NotContains(t, result, "\nvalue = 20\n", "Original Section2 value should be replaced")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("Result content:\n%s\n", result)
}
func TestIsolateCommandsWithJSONMode(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-json-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test JSON content
testContent := `{
"section1": {
"value": 42
},
"section2": {
"value": 100
}
}`
testFile := filepath.Join(tmpDir, "test.json")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create isolate commands with JSON mode
commands := []utils.ModifyCommand{
{
Name: "UpdateJSONFirst",
JSON: true,
Lua: `data.section1.value = data.section1.value * 2; return true`,
Files: []string{"test.json"},
Isolate: true,
},
{
Name: "UpdateJSONSecond",
JSON: true,
Lua: `data.section2.value = data.section2.value * 3; return true`,
Files: []string{"test.json"},
Isolate: true,
},
}
// Associate files with commands
files := []string{"test.json"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Run the isolate commands
result, err := RunIsolateCommands(associations["test.json"], "test.json", testContent, false)
if err != nil && err != ErrNothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify that both JSON isolate commands were applied
assert.Contains(t, result, `"value": 84`, "Section1 value should be doubled (42 * 2 = 84)")
assert.Contains(t, result, `"value": 300`, "Section2 value should be tripled (100 * 3 = 300)")
// Verify original values are gone
assert.NotContains(t, result, `"value": 42`, "Original Section1 value should be replaced")
assert.NotContains(t, result, `"value": 100`, "Original Section2 value should be replaced")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("Result content:\n%s\n", result)
}
func TestIsolateVsRegularCommands(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-regular-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test file with distinct sections
testContent := `ISOLATE_SECTION
value = 5
END_ISOLATE
REGULAR_SECTION
value = 10
END_REGULAR`
testFile := filepath.Join(tmpDir, "test.txt")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create both isolate and regular commands
commands := []utils.ModifyCommand{
{
Name: "IsolateMultiply",
Regex: `ISOLATE_SECTION.*?value = (?P<value>!num).*?END_ISOLATE`,
Lua: `value = tostring(num(value) * 10); return true`,
Files: []string{"test.txt"},
Isolate: true,
},
{
Name: "RegularMultiply",
Regex: `value = (?P<value>!num)`,
Lua: `value = tostring(num(value) + 100); return true`,
Files: []string{"test.txt"},
},
}
// Associate files with commands
files := []string{"test.txt"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Verify the association
association := associations["test.txt"]
assert.Len(t, association.IsolateCommands, 1, "Expected 1 isolate command")
assert.Len(t, association.Commands, 1, "Expected 1 regular command")
// First run isolate commands
isolateResult, err := RunIsolateCommands(association, "test.txt", testContent, false)
if err != nil && err != ErrNothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify isolate command result
assert.Contains(t, isolateResult, "value = 50", "Isolate section should be 5 * 10 = 50")
assert.Contains(t, isolateResult, "value = 10", "Regular section should be unchanged by isolate commands")
// Then run regular commands
commandLoggers := make(map[string]*logger.Logger)
finalResult, err := RunOtherCommands("test.txt", isolateResult, association, commandLoggers, false)
if err != nil && err != ErrNothingToDo {
t.Fatalf("Failed to run regular commands: %v", err)
}
// Verify final results - regular commands should affect ALL values
assert.Contains(t, finalResult, "value = 150", "Isolate section should be 50 + 100 = 150")
assert.Contains(t, finalResult, "value = 110", "Regular section should be 10 + 100 = 110")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("After isolate commands:\n%s\n", isolateResult)
t.Logf("Final result:\n%s\n", finalResult)
}
func TestMultipleIsolateModifiersOnSameValue(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "isolate-same-value-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create test file content that matches the scenario in the issue
testContent := `irons_spellbooks:chain_creeper
SpellPowerMultiplier = 1
irons_spellbooks:chain_lightning
SpellPowerMultiplier = 1`
testFile := filepath.Join(tmpDir, "irons_spellbooks-server.toml")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create isolate commands that match the issue scenario
// First command: targets chain_creeper and chain_lightning with multiplier *4
// Second command: targets all SpellPowerMultiplier with multiplier *4
commands := []utils.ModifyCommand{
{
Name: "healing",
Regexes: []string{
`irons_spellbooks:chain_creeper[\s\S]*?SpellPowerMultiplier = !num`,
`irons_spellbooks:chain_lightning[\s\S]*?SpellPowerMultiplier = !num`,
},
Lua: `v1 * 4`, // This should multiply by 4
Files: []string{"irons_spellbooks-server.toml"},
Reset: true,
Isolate: true,
},
{
Name: "spellpower",
Regex: `SpellPowerMultiplier = !num`,
Lua: `v1 * 4`, // This should multiply by 4 again
Files: []string{"irons_spellbooks-server.toml"},
Reset: true,
Isolate: true,
},
}
// Associate files with commands
files := []string{"irons_spellbooks-server.toml"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
t.Fatalf("Failed to associate files with commands: %v", err)
}
// Verify that both isolate commands are associated
association := associations["irons_spellbooks-server.toml"]
assert.Len(t, association.IsolateCommands, 2, "Expected 2 isolate commands to be associated")
assert.Len(t, association.Commands, 0, "Expected 0 regular commands")
// Run the isolate commands
result, err := RunIsolateCommands(association, "irons_spellbooks-server.toml", testContent, false)
if err != nil && err != ErrNothingToDo {
t.Fatalf("Failed to run isolate commands: %v", err)
}
// Verify that both isolate commands were applied sequentially
// Expected: 1 -> 4 (first command) -> 16 (second command)
assert.Contains(t, result, "SpellPowerMultiplier = 16", "Final result should be 16 after sequential processing (1 * 4 * 4)")
// The system is actually working correctly! Both isolate commands are applied:
// First command (healing): 1 -> 4
// Second command (spellpower): 4 -> 16
// The final result shows 16, which means both modifiers were applied
assert.Contains(t, result, "SpellPowerMultiplier = 16", "The system correctly applies both isolate modifiers sequentially")
t.Logf("Original content:\n%s\n", testContent)
t.Logf("Result content:\n%s\n", result)
}

873
main.go
View File

@@ -1,289 +1,672 @@
package main
import (
"flag"
"fmt"
"log"
_ "embed"
"errors"
"os"
"path/filepath"
"sort"
"sync"
"sync/atomic"
"time"
"github.com/bmatcuk/doublestar/v4"
"github.com/go-git/go-git/v5"
"github.com/go-git/go-git/v5/plumbing/object"
"cook/processor"
"cook/utils"
"modify/processor"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/spf13/cobra"
)
//go:embed example_cook.toml
var exampleTOMLContent string
// mainLogger is a scoped logger for the main package.
var mainLogger = logger.Default.WithPrefix("main")
type GlobalStats struct {
TotalMatches int
TotalModifications int
ProcessedFiles int
FailedFiles int
TotalMatches int64
TotalModifications int64
ProcessedFiles int64
FailedFiles int64
ModificationsPerCommand sync.Map
}
var stats GlobalStats
var logger *log.Logger
var (
jsonFlag = flag.Bool("json", false, "Process JSON files")
xmlFlag = flag.Bool("xml", false, "Process XML files")
gitFlag = flag.Bool("git", false, "Use git to manage files")
resetFlag = flag.Bool("reset", false, "Reset files to their original state")
repo *git.Repository
worktree *git.Worktree
stats GlobalStats = GlobalStats{
ModificationsPerCommand: sync.Map{},
}
)
func init() {
log.SetFlags(log.Lmicroseconds | log.Lshortfile)
logger = log.New(os.Stdout, "", log.Lmicroseconds|log.Lshortfile)
// rootCmd represents the base command when called without any subcommands
var rootCmd *cobra.Command
stats = GlobalStats{}
func init() {
rootCmd = &cobra.Command{
Use: "modifier [options] <pattern> <lua_expression> <...files_or_globs>",
Short: "A powerful file modification tool with Lua scripting",
Long: `Modifier is a powerful file processing tool that supports regex patterns,
JSON manipulation, and YAML to TOML conversion with Lua scripting capabilities.
Features:
- Regex-based pattern matching and replacement
- JSON file processing with query support
- YAML to TOML conversion
- Lua scripting for complex transformations
- Parallel file processing
- Command filtering and organization`,
PersistentPreRun: func(cmd *cobra.Command, args []string) {
logger.InitFlag()
mainLogger.Info("Initializing with log level: %s", logger.GetLevel().String())
mainLogger.Trace("Full argv: %v", os.Args)
},
Run: func(cmd *cobra.Command, args []string) {
exampleFlag, _ := cmd.Flags().GetBool("example")
if exampleFlag {
CreateExampleConfig()
return
}
metaFlag, _ := cmd.Flags().GetBool("meta")
if metaFlag {
cwd, err := os.Getwd()
if err != nil {
mainLogger.Error("Failed to get current directory: %v", err)
os.Exit(1)
}
metaPath := filepath.Join(cwd, "meta.lua")
if err := processor.GenerateMetaFile(metaPath); err != nil {
mainLogger.Error("Failed to generate meta.lua: %v", err)
os.Exit(1)
}
return
}
if len(args) == 0 {
cmd.Usage()
return
}
runModifier(args, cmd)
},
}
// Global flags
rootCmd.PersistentFlags().StringP("loglevel", "l", "INFO", "Set logging level: ERROR, WARNING, INFO, DEBUG, TRACE")
// Local flags
rootCmd.Flags().IntP("parallel", "P", 100, "Number of files to process in parallel")
rootCmd.Flags().StringP("filter", "f", "", "Filter commands before running them")
rootCmd.Flags().Bool("json", false, "Enable JSON mode for processing JSON files")
rootCmd.Flags().BoolP("conv", "c", false, "Convert YAML files to TOML format")
rootCmd.Flags().BoolP("example", "e", false, "Generate example_cook.toml and exit")
rootCmd.Flags().BoolP("meta", "m", false, "Generate meta.lua file for LuaLS autocomplete and exit")
// Set up examples in the help text
rootCmd.SetUsageTemplate(`Usage:{{if .Runnable}}
{{.UseLine}}{{end}}{{if .HasAvailableSubCommands}}
{{.CommandPath}} [command]{{end}} {{if gt (len .Aliases) 0}}
Aliases:
{{.NameAndAliases}}{{end}}{{if .HasExample}}
Examples:
{{.Example}}{{end}}{{if .HasAvailableSubCommands}}
Available Commands:{{range .Commands}}{{if (or .IsAvailableCommand (eq .Name "help"))}}
{{rpad .Name .NamePadding }} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableLocalFlags}}
Flags:
{{.LocalFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasAvailableInheritedFlags}}
Global Flags:
{{.InheritedFlags.FlagUsages | trimTrailingWhitespaces}}{{end}}{{if .HasHelpSubCommands}}
Additional help topics:{{range .Commands}}{{if .IsAdditionalHelpTopicCommand}}
{{rpad .CommandPath .CommandPathPadding}} {{.Short}}{{end}}{{end}}{{end}}{{if .HasAvailableSubCommands}}
Use "{{.CommandPath}} [command] --help" for more information about a command.{{end}}
`)
// Add examples
rootCmd.Example = ` Regex mode (default):
modifier "<value>(\\d+)</value>" "*1.5" data.xml
JSON mode:
modifier -json data.json
YAML to TOML conversion:
modifier -conv *.yml
modifier -conv **/*.yaml
With custom parallelism and filtering:
modifier -P 50 -f "mycommand" "pattern" "expression" files.txt
Note: v1, v2, etc. are used to refer to capture groups as numbers.
s1, s2, etc. are used to refer to capture groups as strings.
Helper functions: num(str) converts string to number, str(num) converts number to string
is_number(str) checks if a string is numeric
If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended
You can use any valid Lua code, including if statements, loops, etc.
Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)
` + processor.GetLuaFunctionsHelp()
}
func main() {
// TODO: Implement some sort of git integration
// Maybe use go-git
// Specify a -git flag
// If we are operating with git then:
// Inmitialize a repo if one doesn't exist (try to open right?)
// For each file matched by glob first figure out if it's already tracked
// If not tracked then track it and commit (either it alone or maybe multiple together somehow)
// Then reset the file (to undo previous modifications)
// THEN change the file
// In addition add a -undo flag that will ONLY reset the files without changing them
// Only for the ones matched by glob
// ^ important because binary files would fuck us up
flag.Usage = func() {
fmt.Fprintf(os.Stderr, "Usage: %s [options] <pattern> <lua_expression> <...files_or_globs>\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nOptions:\n")
fmt.Fprintf(os.Stderr, " -json\n")
fmt.Fprintf(os.Stderr, " Process JSON files\n")
fmt.Fprintf(os.Stderr, " -xml\n")
fmt.Fprintf(os.Stderr, " Process XML files\n")
fmt.Fprintf(os.Stderr, " -git\n")
fmt.Fprintf(os.Stderr, " Use git to manage files\n")
fmt.Fprintf(os.Stderr, " -reset\n")
fmt.Fprintf(os.Stderr, " Reset files to their original state\n")
fmt.Fprintf(os.Stderr, " -mode string\n")
fmt.Fprintf(os.Stderr, " Processing mode: regex, xml, json (default \"regex\")\n")
fmt.Fprintf(os.Stderr, "\nExamples:\n")
fmt.Fprintf(os.Stderr, " Regex mode (default):\n")
fmt.Fprintf(os.Stderr, " %s \"<value>(\\d+)</value>\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " XML mode:\n")
fmt.Fprintf(os.Stderr, " %s -xml \"//value\" \"*1.5\" data.xml\n", os.Args[0])
fmt.Fprintf(os.Stderr, " JSON mode:\n")
fmt.Fprintf(os.Stderr, " %s -json \"$.items[*].value\" \"*1.5\" data.json\n", os.Args[0])
fmt.Fprintf(os.Stderr, "\nNote: v1, v2, etc. are used to refer to capture groups as numbers.\n")
fmt.Fprintf(os.Stderr, " s1, s2, etc. are used to refer to capture groups as strings.\n")
fmt.Fprintf(os.Stderr, " Helper functions: num(str) converts string to number, str(num) converts number to string\n")
fmt.Fprintf(os.Stderr, " is_number(str) checks if a string is numeric\n")
fmt.Fprintf(os.Stderr, " For XML and JSON, the captured values are exposed as 'v', which can be of any type we capture (string, number, table).\n")
fmt.Fprintf(os.Stderr, " If expression starts with an operator like *, /, +, -, =, etc., v1 is automatically prepended\n")
fmt.Fprintf(os.Stderr, " You can use any valid Lua code, including if statements, loops, etc.\n")
fmt.Fprintf(os.Stderr, " Glob patterns are supported for file selection (*.xml, data/**.xml, etc.)\n")
if err := rootCmd.Execute(); err != nil {
mainLogger.Error("Command execution failed: %v", err)
os.Exit(1)
}
}
flag.Parse()
args := flag.Args()
if *resetFlag {
*gitFlag = true
}
func runModifier(args []string, cmd *cobra.Command) {
// Get flag values from Cobra
convertFlag, _ := cmd.Flags().GetBool("conv")
parallelFlag, _ := cmd.Flags().GetInt("parallel")
filterFlag, _ := cmd.Flags().GetString("filter")
jsonFlag, _ := cmd.Flags().GetBool("json")
if len(args) < 3 {
log.Printf("At least %d arguments are required", 3)
flag.Usage()
return
}
// Get the appropriate pattern and expression based on mode
var pattern, luaExpr string
var filePatterns []string
pattern = args[0]
luaExpr = args[1]
filePatterns = args[2:]
// Prepare the Lua expression
originalLuaExpr := luaExpr
luaExpr = processor.BuildLuaScript(luaExpr)
if originalLuaExpr != luaExpr {
logger.Printf("Transformed Lua expression from %q to %q", originalLuaExpr, luaExpr)
}
if *gitFlag {
err := setupGit()
if err != nil {
fmt.Fprintf(os.Stderr, "Error setting up git: %v\n", err)
return
}
}
// Expand file patterns with glob support
files, err := expandFilePatterns(filePatterns)
if err != nil {
fmt.Fprintf(os.Stderr, "Error expanding file patterns: %v\n", err)
return
}
if len(files) == 0 {
fmt.Fprintf(os.Stderr, "No files found matching the specified patterns\n")
return
}
if *gitFlag {
err := cleanupGitFiles(files)
if err != nil {
fmt.Fprintf(os.Stderr, "Error cleaning up git files: %v\n", err)
return
}
}
if *resetFlag {
log.Printf("Files reset to their original state, nothing more to do")
return
}
// Create the processor based on mode
var proc processor.Processor
switch {
case *xmlFlag:
proc = &processor.XMLProcessor{}
logger.Printf("Starting XML modifier with XPath %q, expression %q on %d files",
pattern, luaExpr, len(files))
case *jsonFlag:
proc = &processor.JSONProcessor{}
logger.Printf("Starting JSON modifier with JSONPath %q, expression %q on %d files",
pattern, luaExpr, len(files))
default:
proc = &processor.RegexProcessor{}
logger.Printf("Starting regex modifier with pattern %q, expression %q on %d files",
pattern, luaExpr, len(files))
}
var wg sync.WaitGroup
// Process each file
for _, file := range files {
wg.Add(1)
go func(file string) {
defer wg.Done()
logger.Printf("Processing file: %s", file)
// It's a bit fucked, maybe I could do better to call it from proc... But it'll do for now
modCount, matchCount, err := processor.Process(proc, file, pattern, luaExpr)
// Handle YAML to TOML conversion if -conv flag is set
if convertFlag {
mainLogger.Info("YAML to TOML conversion mode enabled")
conversionCount := 0
for _, arg := range args {
mainLogger.Debug("Converting YAML files matching pattern: %s", arg)
err := utils.ConvertYAMLToTOML(arg)
if err != nil {
fmt.Fprintf(os.Stderr, "Failed to process file %s: %v\n", file, err)
stats.FailedFiles++
} else {
logger.Printf("Successfully processed file: %s", file)
stats.ProcessedFiles++
stats.TotalMatches += matchCount
stats.TotalModifications += modCount
mainLogger.Error("Failed to convert YAML files for pattern %s: %v", arg, err)
continue
}
}(file)
conversionCount++
}
if conversionCount == 0 {
mainLogger.Warning("No files were converted. Please check your patterns.")
} else {
mainLogger.Info("Conversion completed for %d pattern(s)", conversionCount)
}
return
}
mainLogger.Debug("Getting database connection")
db, err := utils.GetDB()
if err != nil {
mainLogger.Error("Failed to get database: %v", err)
return
}
mainLogger.Debug("Database connection established")
workdone, err := HandleSpecialArgs(args, db)
if err != nil {
mainLogger.Error("Failed to handle special args: %v", err)
return
}
if workdone {
mainLogger.Info("Special arguments handled, exiting.")
return
}
// The plan is:
// Load all commands
mainLogger.Debug("Loading commands from arguments")
mainLogger.Trace("Arguments: %v", args)
commands, variables, err := utils.LoadCommands(args)
if err != nil || len(commands) == 0 {
mainLogger.Error("Failed to load commands: %v", err)
cmd.Usage()
return
}
if len(variables) > 0 {
mainLogger.Info("Loaded %d global variables", len(variables))
processor.SetVariables(variables)
}
mainLogger.Info("Loaded %d commands", len(commands))
if filterFlag != "" {
mainLogger.Info("Filtering commands by name: %s", filterFlag)
commands = utils.FilterCommands(commands, filterFlag)
mainLogger.Info("Filtered %d commands", len(commands))
}
// Then aggregate all the globs and deduplicate them
mainLogger.Debug("Aggregating globs and deduplicating")
globs := utils.AggregateGlobs(commands)
mainLogger.Debug("Aggregated %d globs before deduplication", utils.CountGlobsBeforeDedup(commands))
for _, command := range commands {
mainLogger.Trace("Command: %s", command.Name)
if len(command.Regexes) > 0 {
mainLogger.Trace("Regexes: %v", command.Regexes)
} else {
mainLogger.Trace("Regex: %s", command.Regex)
}
mainLogger.Trace("Files: %v", command.Files)
mainLogger.Trace("Lua: %s", command.Lua)
mainLogger.Trace("Reset: %t", command.Reset)
mainLogger.Trace("Isolate: %t", command.Isolate)
mainLogger.Trace("LogLevel: %s", command.LogLevel)
}
// Resolve all the files for all the globs
mainLogger.Info("Found %d unique file patterns", len(globs))
mainLogger.Debug("Expanding glob patterns to files")
files, err := utils.ExpandGlobs(globs)
if err != nil {
mainLogger.Error("Failed to expand file patterns: %v", err)
return
}
mainLogger.Info("Found %d files to process", len(files))
mainLogger.Trace("Files to process: %v", files)
// Somehow connect files to commands via globs..
// For each file check every glob of every command
// Maybe memoize this part
// That way we know what commands affect what files
mainLogger.Debug("Associating files with commands")
associations, err := utils.AssociateFilesWithCommands(files, commands)
if err != nil {
mainLogger.Error("Failed to associate files with commands: %v", err)
return
}
mainLogger.Debug("Files associated with commands")
mainLogger.Trace("File-command associations: %v", associations)
// Per-file association summary for better visibility when debugging
for file, assoc := range associations {
cmdNames := make([]string, 0, len(assoc.Commands))
for _, c := range assoc.Commands {
cmdNames = append(cmdNames, c.Name)
}
isoNames := make([]string, 0, len(assoc.IsolateCommands))
for _, c := range assoc.IsolateCommands {
isoNames = append(isoNames, c.Name)
}
mainLogger.Debug("File %q has %d regular and %d isolate commands", file, len(assoc.Commands), len(assoc.IsolateCommands))
mainLogger.Trace("\tRegular: %v", cmdNames)
mainLogger.Trace("\tIsolate: %v", isoNames)
}
mainLogger.Debug("Resetting files where necessary")
err = utils.ResetWhereNecessary(associations, db)
if err != nil {
mainLogger.Error("Failed to reset files where necessary: %v", err)
return
}
mainLogger.Debug("Files reset where necessary")
// Then for each file run all commands associated with the file
workers := make(chan struct{}, parallelFlag)
wg := sync.WaitGroup{}
mainLogger.Debug("Starting file processing with %d parallel workers", parallelFlag)
// Add performance tracking
startTime := time.Now()
// Create a map to store loggers for each command
commandLoggers := make(map[string]*logger.Logger)
for _, command := range commands {
// Create a named logger for each command
cmdName := command.Name
if cmdName == "" {
// If no name is provided, use a short version of the regex pattern
if len(command.Regex) > 20 {
cmdName = command.Regex[:17] + "..."
} else {
cmdName = command.Regex
}
}
// Parse the log level for this specific command
cmdLogLevel := logger.ParseLevel(command.LogLevel)
// Create a logger with the command name as a field
commandLoggers[command.Name] = logger.Default.WithField("command", cmdName)
commandLoggers[command.Name].SetLevel(cmdLogLevel)
mainLogger.Debug("Created logger for command %q with log level %s", cmdName, cmdLogLevel.String())
}
for file, association := range associations {
workers <- struct{}{}
wg.Add(1)
logger.SafeGoWithArgs(func(args ...interface{}) {
defer func() { <-workers }()
defer wg.Done()
// Track per-file processing time
fileStartTime := time.Now()
mainLogger.Debug("Reading file %q", file)
fileData, err := os.ReadFile(file)
if err != nil {
mainLogger.Error("Failed to read file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
fileDataStr := string(fileData)
mainLogger.Trace("File %q content: %s", file, utils.LimitString(fileDataStr, 500))
isChanged := false
mainLogger.Debug("Running isolate commands for file %q", file)
fileDataStr, err = RunIsolateCommands(association, file, fileDataStr, jsonFlag)
if err != nil && err != ErrNothingToDo {
mainLogger.Error("Failed to run isolate commands for file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
if err != ErrNothingToDo {
isChanged = true
}
mainLogger.Debug("Running other commands for file %q", file)
fileDataStr, err = RunOtherCommands(file, fileDataStr, association, commandLoggers, jsonFlag)
if err != nil && err != ErrNothingToDo {
mainLogger.Error("Failed to run other commands for file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
if err != ErrNothingToDo {
isChanged = true
}
if isChanged {
mainLogger.Debug("Saving file %q to database", file)
err = db.SaveFile(file, fileData)
if err != nil {
mainLogger.Error("Failed to save file %q to database: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
mainLogger.Debug("File %q saved to database", file)
}
mainLogger.Debug("Writing file %q", file)
err = os.WriteFile(file, []byte(fileDataStr), 0644)
if err != nil {
mainLogger.Error("Failed to write file %q: %v", file, err)
atomic.AddInt64(&stats.FailedFiles, 1)
return
}
mainLogger.Debug("File %q written", file)
// Only increment ProcessedFiles once per file, after all processing is complete
atomic.AddInt64(&stats.ProcessedFiles, 1)
mainLogger.Debug("File %q processed in %v", file, time.Since(fileStartTime))
}, file, commands)
}
wg.Wait()
processingTime := time.Since(startTime)
mainLogger.Info("Processing completed in %v", processingTime)
processedFiles := atomic.LoadInt64(&stats.ProcessedFiles)
if processedFiles > 0 {
mainLogger.Info("Average time per file: %v", processingTime/time.Duration(processedFiles))
}
// TODO: Also give each command its own logger, maybe prefix it with something... Maybe give commands a name?
// Do that with logger.WithField("loglevel", level.String())
// Since each command also has its own log level
// TODO: Maybe even figure out how to run individual commands...?
// Print summary
if stats.TotalModifications == 0 {
fmt.Fprintf(os.Stderr, "No modifications were made in any files\n")
totalModifications := atomic.LoadInt64(&stats.TotalModifications)
if totalModifications == 0 {
mainLogger.Warning("No modifications were made in any files")
} else {
fmt.Printf("Operation complete! Modified %d values in %d/%d files\n",
stats.TotalModifications, stats.ProcessedFiles, stats.ProcessedFiles+stats.FailedFiles)
failedFiles := atomic.LoadInt64(&stats.FailedFiles)
mainLogger.Info("Operation complete! Modified %d values in %d/%d files",
totalModifications, processedFiles, processedFiles+failedFiles)
sortedCommands := []string{}
stats.ModificationsPerCommand.Range(func(key, value interface{}) bool {
sortedCommands = append(sortedCommands, key.(string))
return true
})
sort.Strings(sortedCommands)
for _, command := range sortedCommands {
count, _ := stats.ModificationsPerCommand.Load(command)
if count.(int) > 0 {
mainLogger.Info("\tCommand %q made %d modifications", command, count)
} else {
mainLogger.Warning("\tCommand %q made no modifications", command)
}
}
}
}
func setupGit() error {
cwd, err := os.Getwd()
if err != nil {
return fmt.Errorf("failed to get current working directory: %w", err)
func HandleSpecialArgs(args []string, db utils.DB) (bool, error) {
handleSpecialArgsLogger := logger.Default.WithPrefix("HandleSpecialArgs")
handleSpecialArgsLogger.Debug("Handling special arguments: %v", args)
if len(args) == 0 {
handleSpecialArgsLogger.Warning("No arguments provided to HandleSpecialArgs")
return false, nil
}
logger.Printf("Current working directory obtained: %s", cwd)
logger.Printf("Attempting to open git repository at %s", cwd)
repo, err = git.PlainOpen(cwd)
if err != nil {
logger.Printf("No existing git repository found at %s, attempting to initialize a new git repository.", cwd)
repo, err = git.PlainInit(cwd, false)
switch args[0] {
case "reset":
handleSpecialArgsLogger.Info("Resetting all files to their original state from database")
err := utils.ResetAllFiles(db)
if err != nil {
return fmt.Errorf("failed to initialize a new git repository at %s: %w", cwd, err)
handleSpecialArgsLogger.Error("Failed to reset all files: %v", err)
return true, err
}
logger.Printf("Successfully initialized a new git repository at %s", cwd)
} else {
logger.Printf("Successfully opened existing git repository at %s", cwd)
}
logger.Printf("Attempting to obtain worktree for repository at %s", cwd)
worktree, err = repo.Worktree()
if err != nil {
return fmt.Errorf("failed to obtain worktree for repository at %s: %w", cwd, err)
}
logger.Printf("Successfully obtained worktree for repository at %s", cwd)
return nil
}
func expandFilePatterns(patterns []string) ([]string, error) {
var files []string
filesMap := make(map[string]bool)
for _, pattern := range patterns {
matches, _ := doublestar.Glob(os.DirFS("."), pattern)
for _, m := range matches {
if info, err := os.Stat(m); err == nil && !info.IsDir() && !filesMap[m] {
filesMap[m], files = true, append(files, m)
}
}
}
if len(files) > 0 {
logger.Printf("Found %d files to process", len(files))
}
return files, nil
}
func cleanupGitFiles(files []string) error {
for _, file := range files {
logger.Printf("Checking file: %s", file)
status, err := worktree.Status()
handleSpecialArgsLogger.Info("Successfully reset all files to original state")
return true, nil
case "dump":
handleSpecialArgsLogger.Info("Dumping all files from database (clearing snapshots)")
err := db.RemoveAllFiles()
if err != nil {
fmt.Fprintf(os.Stderr, "Error getting worktree status: %v\n", err)
return fmt.Errorf("error getting worktree status: %w", err)
handleSpecialArgsLogger.Error("Failed to remove all files from database: %v", err)
return true, err
}
if status.IsUntracked(file) {
logger.Printf("Detected untracked file: %s. Attempting to add it to the git index.", file)
_, err = worktree.Add(file)
if err != nil {
fmt.Fprintf(os.Stderr, "Error adding file to git: %v\n", err)
return fmt.Errorf("error adding file to git: %w", err)
}
handleSpecialArgsLogger.Info("Successfully cleared all file snapshots from database")
return true, nil
default:
handleSpecialArgsLogger.Debug("Unknown special argument: %q", args[0])
}
handleSpecialArgsLogger.Debug("No special arguments handled, returning false")
return false, nil
}
filename := filepath.Base(file)
logger.Printf("File %s added successfully. Now committing it with message: 'Track %s'", filename, filename)
_, err = worktree.Commit("Track "+filename, &git.CommitOptions{
Author: &object.Signature{
Name: "Big Chef",
Email: "bigchef@bigchef.com",
When: time.Now(),
},
})
if err != nil {
fmt.Fprintf(os.Stderr, "Error committing file: %v\n", err)
return fmt.Errorf("error committing file: %w", err)
}
logger.Printf("Successfully committed file: %s with message: 'Track %s'", filename, filename)
func CreateExampleConfig() {
createExampleConfigLogger := logger.Default.WithPrefix("CreateExampleConfig")
createExampleConfigLogger.Debug("Creating example configuration file")
// Save the embedded TOML content to disk
createExampleConfigLogger.Debug("Writing example_cook.toml")
err := os.WriteFile("example_cook.toml", []byte(exampleTOMLContent), 0644)
if err != nil {
createExampleConfigLogger.Error("Failed to write example_cook.toml: %v", err)
return
}
createExampleConfigLogger.Info("Wrote example_cook.toml")
}
var ErrNothingToDo = errors.New("nothing to do")
func RunOtherCommands(file string, fileDataStr string, association utils.FileCommandAssociation, commandLoggers map[string]*logger.Logger, jsonFlag bool) (string, error) {
runOtherCommandsLogger := mainLogger.WithPrefix("RunOtherCommands").WithField("file", file)
runOtherCommandsLogger.Debug("Running other commands for file")
runOtherCommandsLogger.Trace("File data before modifications: %s", utils.LimitString(fileDataStr, 200))
// Separate JSON and regex commands for different processing approaches
jsonCommands := []utils.ModifyCommand{}
regexCommands := []utils.ModifyCommand{}
for _, command := range association.Commands {
if command.JSON || jsonFlag {
jsonCommands = append(jsonCommands, command)
} else {
logger.Printf("File %s is already tracked. Restoring it to the working tree.", file)
err := worktree.Restore(&git.RestoreOptions{
Files: []string{file},
Staged: true,
Worktree: true,
})
if err != nil {
fmt.Fprintf(os.Stderr, "Error restoring file: %v\n", err)
return fmt.Errorf("error restoring file: %w", err)
}
logger.Printf("File %s restored successfully.", file)
regexCommands = append(regexCommands, command)
}
}
return nil
// Process JSON commands sequentially (each operates on the entire file)
for _, command := range jsonCommands {
cmdLogger := logger.Default
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
}
cmdLogger.Debug("Processing file with JSON mode for command %q", command.Name)
newModifications, err := processor.ProcessJSON(fileDataStr, command, file)
if err != nil {
runOtherCommandsLogger.Error("Failed to process file with JSON command %q: %v", command.Name, err)
continue
}
// Apply JSON modifications immediately
if len(newModifications) > 0 {
var count int
fileDataStr, count = utils.ExecuteModifications(newModifications, fileDataStr)
atomic.AddInt64(&stats.TotalModifications, int64(count))
cmdLogger.Debug("Applied %d JSON modifications for command %q", count, command.Name)
}
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
}
// Aggregate regex modifications and execute them
modifications := []utils.ReplaceCommand{}
numCommandsConsidered := 0
for _, command := range regexCommands {
cmdLogger := logger.Default
if cmdLog, ok := commandLoggers[command.Name]; ok {
cmdLogger = cmdLog
}
patterns := command.Regexes
if len(patterns) == 0 {
patterns = []string{command.Regex}
}
for idx, pattern := range patterns {
tmpCmd := command
tmpCmd.Regex = pattern
cmdLogger.Debug("Begin processing file with command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
numCommandsConsidered++
newModifications, err := processor.ProcessRegex(fileDataStr, tmpCmd, file)
if err != nil {
runOtherCommandsLogger.Error("Failed to process file with command %q: %v", command.Name, err)
continue
}
modifications = append(modifications, newModifications...)
count, ok := stats.ModificationsPerCommand.Load(command.Name)
if !ok {
count = 0
}
stats.ModificationsPerCommand.Store(command.Name, count.(int)+len(newModifications))
cmdLogger.Debug("Command %q generated %d modifications (pattern %d/%d)", command.Name, len(newModifications), idx+1, len(patterns))
cmdLogger.Trace("Modifications generated by command %q: %v", command.Name, newModifications)
if len(newModifications) == 0 {
cmdLogger.Debug("No modifications yielded by command %q (pattern %d/%d)", command.Name, idx+1, len(patterns))
}
}
}
runOtherCommandsLogger.Debug("Aggregated %d modifications from %d command-pattern runs", len(modifications), numCommandsConsidered)
runOtherCommandsLogger.Trace("All aggregated modifications: %v", modifications)
if len(modifications) == 0 {
runOtherCommandsLogger.Warning("No modifications found for file")
return fileDataStr, ErrNothingToDo
}
runOtherCommandsLogger.Debug("Executing %d modifications for file", len(modifications))
// Sort commands in reverse order for safe replacements
var count int
fileDataStr, count = utils.ExecuteModifications(modifications, fileDataStr)
runOtherCommandsLogger.Trace("File data after modifications: %s", utils.LimitString(fileDataStr, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
runOtherCommandsLogger.Info("Executed %d modifications for file", count)
return fileDataStr, nil
}
func RunIsolateCommands(association utils.FileCommandAssociation, file string, fileDataStr string, jsonFlag bool) (string, error) {
runIsolateCommandsLogger := mainLogger.WithPrefix("RunIsolateCommands").WithField("file", file)
runIsolateCommandsLogger.Debug("Running isolate commands for file")
runIsolateCommandsLogger.Trace("File data before isolate modifications: %s", utils.LimitString(fileDataStr, 200))
anythingDone := false
currentFileData := fileDataStr
for _, isolateCommand := range association.IsolateCommands {
// Check if this isolate command should use JSON mode
if isolateCommand.JSON || jsonFlag {
runIsolateCommandsLogger.Debug("Begin processing file with JSON isolate command %q", isolateCommand.Name)
modifications, err := processor.ProcessJSON(currentFileData, isolateCommand, file)
if err != nil {
runIsolateCommandsLogger.Error("Failed to process file with JSON isolate command %q: %v", isolateCommand.Name, err)
continue
}
if len(modifications) == 0 {
runIsolateCommandsLogger.Debug("JSON isolate command %q produced no modifications", isolateCommand.Name)
continue
}
anythingDone = true
runIsolateCommandsLogger.Debug("Executing %d JSON isolate modifications for file", len(modifications))
runIsolateCommandsLogger.Trace("JSON isolate modifications: %v", modifications)
var count int
currentFileData, count = utils.ExecuteModifications(modifications, currentFileData)
runIsolateCommandsLogger.Trace("File data after JSON isolate modifications: %s", utils.LimitString(currentFileData, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
cmdCount, ok := stats.ModificationsPerCommand.Load(isolateCommand.Name)
if !ok {
stats.ModificationsPerCommand.Store(isolateCommand.Name, 0)
cmdCount = 0
}
stats.ModificationsPerCommand.Store(isolateCommand.Name, cmdCount.(int)+len(modifications))
runIsolateCommandsLogger.Info("Executed %d JSON isolate modifications for file", count)
} else {
// Regular regex processing for isolate commands
patterns := isolateCommand.Regexes
if len(patterns) == 0 {
patterns = []string{isolateCommand.Regex}
}
for idx, pattern := range patterns {
tmpCmd := isolateCommand
tmpCmd.Regex = pattern
runIsolateCommandsLogger.Debug("Begin processing file with isolate command %q (pattern %d/%d)", isolateCommand.Name, idx+1, len(patterns))
modifications, err := processor.ProcessRegex(currentFileData, tmpCmd, file)
if err != nil {
runIsolateCommandsLogger.Error("Failed to process file with isolate command %q (pattern %d/%d): %v", isolateCommand.Name, idx+1, len(patterns), err)
continue
}
if len(modifications) == 0 {
runIsolateCommandsLogger.Debug("Isolate command %q produced no modifications (pattern %d/%d)", isolateCommand.Name, idx+1, len(patterns))
continue
}
anythingDone = true
runIsolateCommandsLogger.Debug("Executing %d isolate modifications for file", len(modifications))
runIsolateCommandsLogger.Trace("Isolate modifications: %v", modifications)
var count int
currentFileData, count = utils.ExecuteModifications(modifications, currentFileData)
runIsolateCommandsLogger.Trace("File data after isolate modifications: %s", utils.LimitString(currentFileData, 200))
atomic.AddInt64(&stats.TotalModifications, int64(count))
cmdCount, ok := stats.ModificationsPerCommand.Load(isolateCommand.Name)
if !ok {
stats.ModificationsPerCommand.Store(isolateCommand.Name, 0)
cmdCount = 0
}
stats.ModificationsPerCommand.Store(isolateCommand.Name, cmdCount.(int)+len(modifications))
runIsolateCommandsLogger.Info("Executed %d isolate modifications for file", count)
}
}
}
if !anythingDone {
runIsolateCommandsLogger.Debug("No isolate modifications were made for file")
return fileDataStr, ErrNothingToDo
}
return currentFileData, nil
}

View File

@@ -1,165 +1,591 @@
// Package processor provides JSON processing and Lua script execution capabilities
// for data transformation and manipulation.
package processor
import (
"cook/utils"
"encoding/json"
"fmt"
"log"
"modify/processor/jsonpath"
"sort"
"strconv"
"strings"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/tidwall/gjson"
lua "github.com/yuin/gopher-lua"
)
// JSONProcessor implements the Processor interface for JSON documents
type JSONProcessor struct{}
// jsonLogger is a scoped logger for the processor/json package.
var jsonLogger = logger.Default.WithPrefix("processor/json")
// ProcessContent implements the Processor interface for JSONProcessor
func (p *JSONProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Parse JSON document
// ProcessJSON applies Lua processing to JSON content
func ProcessJSON(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
processJSONLogger := jsonLogger.WithPrefix("ProcessJSON").WithField("commandName", command.Name).WithField("file", filename)
processJSONLogger.Debug("Starting JSON processing for file")
processJSONLogger.Trace("Initial file content length: %d", len(content))
var commands []utils.ReplaceCommand
startTime := time.Now()
// Parse JSON content
var jsonData interface{}
err := json.Unmarshal([]byte(content), &jsonData)
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing JSON: %v", err)
processJSONLogger.Error("Failed to parse JSON content: %v", err)
return commands, fmt.Errorf("failed to parse JSON: %v", err)
}
processJSONLogger.Debug("Successfully parsed JSON content")
// Find nodes matching the JSONPath pattern
nodes, err := jsonpath.Get(jsonData, pattern)
// Create Lua state
L, err := NewLuaState()
if err != nil {
return content, 0, 0, fmt.Errorf("error getting nodes: %v", err)
processJSONLogger.Error("Error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
// Set filename global
L.SetGlobal("file", lua.LString(filename))
// Convert JSON data to Lua table
luaTable, err := ToLuaTable(L, jsonData)
if err != nil {
processJSONLogger.Error("Failed to convert JSON to Lua table: %v", err)
return commands, fmt.Errorf("failed to convert JSON to Lua table: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
// Set the JSON data as a global variable
L.SetGlobal("data", luaTable)
processJSONLogger.Debug("Set JSON data as Lua global 'data'")
// Build and execute Lua script for JSON mode
luaExpr := BuildJSONLuaScript(command.Lua, command.SourceDir)
processJSONLogger.Debug("Built Lua script from expression: %q", command.Lua)
processJSONLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
if err := L.DoString(luaExpr); err != nil {
processJSONLogger.Error("Lua script execution failed: %v\nScript: %s", err, utils.LimitString(luaExpr, 200))
return commands, fmt.Errorf("lua script execution failed: %v", err)
}
processJSONLogger.Debug("Lua script executed successfully")
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
processJSONLogger.Debug("Skipping - no modifications indicated by Lua script")
return commands, nil
}
modCount := 0
for _, node := range nodes {
log.Printf("Processing node at path: %s with value: %v", node.Path, node.Value)
// Get the modified data from Lua
modifiedData := L.GetGlobal("data")
if modifiedData.Type() != lua.LTTable {
processJSONLogger.Error("Expected 'data' to be a table after Lua processing, got %s", modifiedData.Type().String())
return commands, fmt.Errorf("expected 'data' to be a table after Lua processing")
}
// Initialize Lua
L, err := NewLuaState()
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error creating Lua state: %v", err)
// Convert back to Go interface
goData, err := FromLua(L, modifiedData)
if err != nil {
processJSONLogger.Error("Failed to convert Lua table back to Go: %v", err)
return commands, fmt.Errorf("failed to convert Lua table back to Go: %v", err)
}
processJSONLogger.Debug("About to call applyChanges with original data and modified data")
commands, err = applyChanges(content, jsonData, goData)
if err != nil {
processJSONLogger.Error("Failed to apply surgical JSON changes: %v", err)
return commands, fmt.Errorf("failed to apply surgical JSON changes: %v", err)
}
processJSONLogger.Debug("Total JSON processing time: %v", time.Since(startTime))
processJSONLogger.Debug("Generated %d total modifications", len(commands))
return commands, nil
}
// applyChanges attempts to make surgical changes while preserving exact formatting
func applyChanges(content string, originalData, modifiedData interface{}) ([]utils.ReplaceCommand, error) {
var commands []utils.ReplaceCommand
// Find all changes between original and modified data
changes := findDeepChanges("", originalData, modifiedData)
jsonLogger.Debug("applyChanges: Found %d changes: %v", len(changes), changes)
if len(changes) == 0 {
return commands, nil
}
// Sort removal operations by index in descending order to avoid index shifting
var removals []string
var additions []string
var valueChanges []string
for path := range changes {
if strings.HasSuffix(path, "@remove") {
removals = append(removals, path)
} else if strings.HasSuffix(path, "@add") {
additions = append(additions, path)
} else {
valueChanges = append(valueChanges, path)
}
defer L.Close()
log.Println("Lua state initialized successfully.")
}
err = p.ToLua(L, node.Value)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error converting to Lua: %v", err)
jsonLogger.Debug("applyChanges: %d removals, %d additions, %d value changes", len(removals), len(additions), len(valueChanges))
// Apply removals first (from end to beginning to avoid index shifting)
for _, removalPath := range removals {
actualPath := strings.TrimSuffix(removalPath, "@remove")
elementIndex := extractIndexFromRemovalPath(actualPath)
arrayPath := getArrayPathFromElementPath(actualPath)
jsonLogger.Debug("Processing removal: path=%s, index=%d, arrayPath=%s", actualPath, elementIndex, arrayPath)
// Find the exact byte range to remove
from, to := findArrayElementRemovalRange(content, arrayPath, elementIndex)
jsonLogger.Debug("Removing bytes %d-%d", from, to)
commands = append(commands, utils.ReplaceCommand{
From: from,
To: to,
With: "",
})
jsonLogger.Debug("Added removal command: From=%d, To=%d, With=\"\"", from, to)
}
// Apply additions (new fields)
for _, additionPath := range additions {
actualPath := strings.TrimSuffix(additionPath, "@add")
newValue := changes[additionPath]
jsonLogger.Debug("Processing addition: path=%s, value=%v", actualPath, newValue)
// Find the parent object to add the field to
parentPath := getParentPath(actualPath)
fieldName := getFieldName(actualPath)
jsonLogger.Debug("Parent path: %s, field name: %s", parentPath, fieldName)
// Get the parent object
var parentResult gjson.Result
if parentPath == "" {
// Adding to root object - get the entire JSON
parentResult = gjson.Parse(content)
} else {
parentResult = gjson.Get(content, parentPath)
}
log.Printf("Converted node value to Lua: %v", node.Value)
originalScript := luaExpr
fullScript := BuildLuaScript(luaExpr)
log.Printf("Original script: %q, Full script: %q", originalScript, fullScript)
// Execute Lua script
log.Printf("Executing Lua script: %q", fullScript)
if err := L.DoString(fullScript); err != nil {
return content, len(nodes), 0, fmt.Errorf("error executing Lua %q: %v", fullScript, err)
}
log.Println("Lua script executed successfully.")
// Get modified value
result, err := p.FromLua(L)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error getting result from Lua: %v", err)
}
log.Printf("Retrieved modified value from Lua: %v", result)
modified := false
modified = L.GetGlobal("modified").String() == "true"
if !modified {
log.Printf("No changes made to node at path: %s", node.Path)
if !parentResult.Exists() {
jsonLogger.Debug("Parent path %s does not exist, skipping", parentPath)
continue
}
// Apply the modification to the JSON data
err = p.updateJSONValue(jsonData, node.Path, result)
// Find where to insert the new field (at the end of the object)
startPos := int(parentResult.Index + len(parentResult.Raw) - 1) // Before closing brace
jsonLogger.Debug("Inserting at pos %d", startPos)
// Convert the new value to JSON string
newValueStr := convertValueToJSONString(newValue)
// Insert the new field with pretty-printed formatting
// Format: ,"fieldName": { ... }
insertText := fmt.Sprintf(`,"%s": %s`, fieldName, newValueStr)
commands = append(commands, utils.ReplaceCommand{
From: startPos,
To: startPos,
With: insertText,
})
jsonLogger.Debug("Added addition command: From=%d, To=%d, With=%q", startPos, startPos, insertText)
}
// Apply value changes (in reverse order to avoid position shifting)
sort.Slice(valueChanges, func(i, j int) bool {
// Get positions for comparison
resultI := gjson.Get(content, valueChanges[i])
resultJ := gjson.Get(content, valueChanges[j])
return resultI.Index > resultJ.Index // Descending order
})
for _, path := range valueChanges {
newValue := changes[path]
jsonLogger.Debug("Processing value change: path=%s, value=%v", path, newValue)
// Get the current value and its position in the original JSON
result := gjson.Get(content, path)
if !result.Exists() {
jsonLogger.Debug("Path %s does not exist, skipping", path)
continue // Skip if path doesn't exist
}
// Get the exact byte positions of this value
startPos := result.Index
endPos := startPos + len(result.Raw)
jsonLogger.Debug("Found value at pos %d-%d: %q", startPos, endPos, result.Raw)
// Convert the new value to JSON string
newValueStr := convertValueToJSONString(newValue)
jsonLogger.Debug("Converting to: %q", newValueStr)
// Create a replacement command for this specific value
commands = append(commands, utils.ReplaceCommand{
From: int(startPos),
To: int(endPos),
With: newValueStr,
})
jsonLogger.Debug("Added command: From=%d, To=%d, With=%q", int(startPos), int(endPos), newValueStr)
}
return commands, nil
}
// extractIndexFromRemovalPath extracts the array index from a removal path like "Rows.0.Inputs.1@remove"
func extractIndexFromRemovalPath(path string) int {
parts := strings.Split(strings.TrimSuffix(path, "@remove"), ".")
if len(parts) > 0 {
lastPart := parts[len(parts)-1]
if index, err := strconv.Atoi(lastPart); err == nil {
return index
}
}
return -1
}
// getArrayPathFromElementPath converts "Rows.0.Inputs.1" to "Rows.0.Inputs"
func getArrayPathFromElementPath(elementPath string) string {
parts := strings.Split(elementPath, ".")
if len(parts) > 0 {
return strings.Join(parts[:len(parts)-1], ".")
}
return ""
}
// getParentPath extracts the parent path from a full path like "Rows.0.Inputs.1"
func getParentPath(fullPath string) string {
parts := strings.Split(fullPath, ".")
if len(parts) > 0 {
return strings.Join(parts[:len(parts)-1], ".")
}
return ""
}
// getFieldName extracts the field name from a full path like "Rows.0.Inputs.1"
func getFieldName(fullPath string) string {
parts := strings.Split(fullPath, ".")
if len(parts) > 0 {
return parts[len(parts)-1]
}
return ""
}
// convertValueToJSONString converts a Go interface{} to a JSON string representation
func convertValueToJSONString(value interface{}) string {
switch v := value.(type) {
case string:
return `"` + strings.ReplaceAll(v, `"`, `\"`) + `"`
case float64:
if v == float64(int64(v)) {
return strconv.FormatInt(int64(v), 10)
}
return strconv.FormatFloat(v, 'f', -1, 64)
case bool:
return strconv.FormatBool(v)
case nil:
return "null"
case map[string]interface{}:
// Handle maps specially to avoid double-escaping of keys
var pairs []string
for key, val := range v {
// The key might already have escaped quotes from Lua, so we need to be careful
// If the key already contains escaped quotes, we need to unescape them first
keyStr := key
if strings.Contains(key, `\"`) {
// Key already has escaped quotes, use it as-is
keyStr = `"` + key + `"`
} else {
// Normal key, escape quotes
keyStr = `"` + strings.ReplaceAll(key, `"`, `\"`) + `"`
}
valStr := convertValueToJSONString(val)
pairs = append(pairs, keyStr+":"+valStr)
}
return "{" + strings.Join(pairs, ",") + "}"
default:
// For other complex types (arrays), we need to use json.Marshal
jsonBytes, err := json.Marshal(v)
if err != nil {
return content, len(nodes), 0, fmt.Errorf("error updating JSON: %v", err)
return "null" // Fallback to null if marshaling fails
}
log.Printf("Updated JSON at path: %s with new value: %v", node.Path, result)
modCount++
return string(jsonBytes)
}
// Convert the modified JSON back to a string with same formatting
var jsonBytes []byte
jsonBytes, err = json.MarshalIndent(jsonData, "", " ")
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error marshalling JSON: %v", err)
}
return string(jsonBytes), modCount, matchCount, nil
}
// updateJSONValue updates a value in the JSON structure based on its JSONPath
func (p *JSONProcessor) updateJSONValue(jsonData interface{}, path string, newValue interface{}) error {
// Special handling for root node
if path == "$" {
// For the root node, we'll copy the value to the jsonData reference
// This is a special case since we can't directly replace the interface{} variable
// findArrayElementRemovalRange finds the exact byte range to remove for an array element
func findArrayElementRemovalRange(content, arrayPath string, elementIndex int) (int, int) {
// Get the array using gjson
var arrayResult gjson.Result
if arrayPath == "" {
// Root-level array
arrayResult = gjson.Parse(content)
} else {
arrayResult = gjson.Get(content, arrayPath)
}
// We need to handle different types of root elements
switch rootValue := newValue.(type) {
case map[string]interface{}:
// For objects, we need to copy over all keys
rootMap, ok := jsonData.(map[string]interface{})
if !ok {
// If the original wasn't a map, completely replace it with the new map
// This is handled by the jsonpath.Set function
return jsonpath.Set(jsonData, path, newValue)
if !arrayResult.Exists() || !arrayResult.IsArray() {
return -1, -1
}
// Get all array elements
elements := arrayResult.Array()
if elementIndex >= len(elements) {
return -1, -1
}
// Get the target element
elementResult := elements[elementIndex]
startPos := int(elementResult.Index)
endPos := int(elementResult.Index + len(elementResult.Raw))
// Handle comma removal properly
if elementIndex == 0 && len(elements) > 1 {
// First element but not the only one - remove comma after
for i := endPos; i < len(content) && i < endPos+50; i++ {
if content[i] == ',' {
endPos = i + 1
break
}
// Clear the original map
for k := range rootMap {
delete(rootMap, k)
}
} else if elementIndex == len(elements)-1 && len(elements) > 1 {
// Last element and not the only one - remove comma before
prevElementEnd := int(elements[elementIndex-1].Index + len(elements[elementIndex-1].Raw))
for i := prevElementEnd; i < startPos && i < len(content); i++ {
if content[i] == ',' {
startPos = i
break
}
}
}
// If it's the only element, don't remove any commas
// Copy all keys from the new map
for k, v := range rootValue {
rootMap[k] = v
return startPos, endPos
}
// findDeepChanges recursively finds all paths that need to be changed
func findDeepChanges(basePath string, original, modified interface{}) map[string]interface{} {
changes := make(map[string]interface{})
switch orig := original.(type) {
case map[string]interface{}:
if mod, ok := modified.(map[string]interface{}); ok {
// Check for new keys added in modified data
for key, modValue := range mod {
var currentPath string
if basePath == "" {
currentPath = key
} else {
currentPath = basePath + "." + key
}
if origValue, exists := orig[key]; exists {
// Key exists in both, check if value changed
switch modValue.(type) {
case map[string]interface{}, []interface{}:
// Recursively check nested structures
nestedChanges := findDeepChanges(currentPath, origValue, modValue)
for nestedPath, nestedValue := range nestedChanges {
changes[nestedPath] = nestedValue
}
default:
// Primitive value - check if changed
if !deepEqual(origValue, modValue) {
changes[currentPath] = modValue
}
}
} else {
// New key added - mark for addition
changes[currentPath+"@add"] = modValue
}
}
return nil
}
case []interface{}:
if mod, ok := modified.([]interface{}); ok {
// Handle array changes by detecting specific element operations
if len(orig) != len(mod) {
// Array length changed - detect if it's element removal
if len(orig) > len(mod) {
// Element(s) removed - find which ones by comparing content
removedIndices := findRemovedArrayElements(orig, mod)
for _, removedIndex := range removedIndices {
var currentPath string
if basePath == "" {
currentPath = fmt.Sprintf("%d@remove", removedIndex)
} else {
currentPath = fmt.Sprintf("%s.%d@remove", basePath, removedIndex)
}
changes[currentPath] = nil // Mark for removal
}
}
} else {
// Same length - check individual elements for value changes
for i, modValue := range mod {
var currentPath string
if basePath == "" {
currentPath = strconv.Itoa(i)
} else {
currentPath = basePath + "." + strconv.Itoa(i)
}
case []interface{}:
// For arrays, we need to handle similarly
rootArray, ok := jsonData.([]interface{})
if !ok {
// If the original wasn't an array, use jsonpath.Set
return jsonpath.Set(jsonData, path, newValue)
if i < len(orig) {
// Index exists in both, check if value changed
switch modValue.(type) {
case map[string]interface{}, []interface{}:
// Recursively check nested structures
nestedChanges := findDeepChanges(currentPath, orig[i], modValue)
for nestedPath, nestedValue := range nestedChanges {
changes[nestedPath] = nestedValue
}
default:
// Primitive value - check if changed
if !deepEqual(orig[i], modValue) {
changes[currentPath] = modValue
}
}
}
}
}
}
}
// Note: No default case needed - JSON data from unmarshaling is always
// map[string]interface{} or []interface{} at the top level
// Clear and recreate the array
*&rootArray = rootValue
return nil
return changes
}
default:
// For other types, use jsonpath.Set
return jsonpath.Set(jsonData, path, newValue)
// findRemovedArrayElements compares two arrays and returns indices of removed elements
func findRemovedArrayElements(original, modified []interface{}) []int {
var removedIndices []int
// Simple approach: find elements in original that don't exist in modified
for i, origElement := range original {
found := false
for _, modElement := range modified {
if deepEqual(origElement, modElement) {
found = true
break
}
}
if !found {
removedIndices = append(removedIndices, i)
}
}
// For non-root paths, use the regular Set method
err := jsonpath.Set(jsonData, path, newValue)
if err != nil {
return fmt.Errorf("failed to update JSON value at path '%s': %w", path, err)
}
return nil
return removedIndices
}
// ToLua converts JSON values to Lua variables
func (p *JSONProcessor) ToLua(L *lua.LState, data interface{}) error {
table, err := ToLua(L, data)
if err != nil {
return err
// deepEqual performs deep comparison of two values
func deepEqual(a, b interface{}) bool {
if a == nil && b == nil {
return true
}
if a == nil || b == nil {
return false
}
switch av := a.(type) {
case map[string]interface{}:
if bv, ok := b.(map[string]interface{}); ok {
if len(av) != len(bv) {
return false
}
for k, v := range av {
if !deepEqual(v, bv[k]) {
return false
}
}
return true
}
return false
case []interface{}:
if bv, ok := b.([]interface{}); ok {
if len(av) != len(bv) {
return false
}
for i, v := range av {
if !deepEqual(v, bv[i]) {
return false
}
}
return true
}
return false
default:
return a == b
}
L.SetGlobal("v", table)
return nil
}
// FromLua retrieves values from Lua
func (p *JSONProcessor) FromLua(L *lua.LState) (interface{}, error) {
luaValue := L.GetGlobal("v")
return FromLua(L, luaValue)
// ToLuaTable converts a Go interface{} (map or array) to a Lua table
// This should only be called with map[string]interface{} or []interface{} from JSON unmarshaling
func ToLuaTable(L *lua.LState, data interface{}) (*lua.LTable, error) {
switch v := data.(type) {
case map[string]interface{}:
table := L.CreateTable(0, len(v))
for key, value := range v {
table.RawSetString(key, ToLuaValue(L, value))
}
return table, nil
case []interface{}:
table := L.CreateTable(len(v), 0)
for i, value := range v {
table.RawSetInt(i+1, ToLuaValue(L, value)) // Lua arrays are 1-indexed
}
return table, nil
default:
// This should only happen with invalid JSON (root-level primitives)
return nil, fmt.Errorf("expected table or array, got %T", v)
}
}
// ToLuaValue converts a Go interface{} to a Lua value
func ToLuaValue(L *lua.LState, data interface{}) lua.LValue {
switch v := data.(type) {
case map[string]interface{}:
table := L.CreateTable(0, len(v))
for key, value := range v {
table.RawSetString(key, ToLuaValue(L, value))
}
return table
case []interface{}:
table := L.CreateTable(len(v), 0)
for i, value := range v {
table.RawSetInt(i+1, ToLuaValue(L, value)) // Lua arrays are 1-indexed
}
return table
case string:
return lua.LString(v)
case float64:
return lua.LNumber(v)
case bool:
return lua.LBool(v)
case nil:
return lua.LNil
default:
// This should never happen with JSON-unmarshaled data
return lua.LNil
}
}

View File

@@ -0,0 +1,283 @@
package processor
import (
"cook/utils"
"testing"
"github.com/stretchr/testify/assert"
)
// TestJSONFloat tests line 298 - float formatting for non-integer floats
func TestJSONFloatFormatting(t *testing.T) {
jsonContent := `{
"value": 10.5,
"another": 3.14159
}`
command := utils.ModifyCommand{
Name: "test_float",
JSON: true,
Lua: `
data.value = data.value * 2
data.another = data.another * 10
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, "21") // 10.5 * 2
assert.Contains(t, result, "31.4159") // 3.14159 * 10
}
// TestJSONNestedObjectAddition tests lines 303-320 - map[string]interface{} case
func TestJSONNestedObjectAddition(t *testing.T) {
jsonContent := `{
"items": {}
}`
command := utils.ModifyCommand{
Name: "test_nested",
JSON: true,
Lua: `
data.items.newObject = {
name = "test",
value = 42,
enabled = true
}
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, `"newObject"`)
assert.Contains(t, result, `"name"`)
assert.Contains(t, result, `"test"`)
assert.Contains(t, result, `"value"`)
assert.Contains(t, result, "42")
}
// TestJSONKeyWithQuotes tests line 315 - key escaping with quotes
func TestJSONKeyWithQuotes(t *testing.T) {
jsonContent := `{
"data": {}
}`
command := utils.ModifyCommand{
Name: "test_key_quotes",
JSON: true,
Lua: `
data.data["key-with-dash"] = "value1"
data.data.normalKey = "value2"
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, `"key-with-dash"`)
assert.Contains(t, result, `"normalKey"`)
}
// TestJSONArrayInValue tests lines 321-327 - default case with json.Marshal for arrays
func TestJSONArrayInValue(t *testing.T) {
jsonContent := `{
"data": {}
}`
command := utils.ModifyCommand{
Name: "test_array_value",
JSON: true,
Lua: `
data.data.items = {1, 2, 3, 4, 5}
data.data.strings = {"a", "b", "c"}
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, `"items"`)
assert.Contains(t, result, `[1,2,3,4,5]`)
assert.Contains(t, result, `"strings"`)
assert.Contains(t, result, `["a","b","c"]`)
}
// TestJSONRootArrayElementRemoval tests line 422 - removing from root-level array
func TestJSONRootArrayElementRemoval(t *testing.T) {
jsonContent := `[
{"id": 1, "name": "first"},
{"id": 2, "name": "second"},
{"id": 3, "name": "third"}
]`
command := utils.ModifyCommand{
Name: "test_root_array_removal",
JSON: true,
Lua: `
-- Remove the second element
table.remove(data, 2)
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, `"first"`)
assert.Contains(t, result, `"third"`)
assert.NotContains(t, result, `"second"`)
}
// TestJSONRootArrayElementChange tests lines 434 and 450 - changing primitive values in root array
func TestJSONRootArrayElementChange(t *testing.T) {
jsonContent := `[10, 20, 30, 40, 50]`
command := utils.ModifyCommand{
Name: "test_root_array_change",
JSON: true,
Lua: `
-- Double all values
for i = 1, #data do
data[i] = data[i] * 2
end
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, "20")
assert.Contains(t, result, "40")
assert.Contains(t, result, "60")
assert.Contains(t, result, "80")
assert.Contains(t, result, "100")
assert.NotContains(t, result, "10,")
}
// TestJSONRootArrayStringElements tests deepEqual with strings in root array
func TestJSONRootArrayStringElements(t *testing.T) {
jsonContent := `["apple", "banana", "cherry"]`
command := utils.ModifyCommand{
Name: "test_root_array_strings",
JSON: true,
Lua: `
data[2] = "orange"
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, `"apple"`)
assert.Contains(t, result, `"orange"`)
assert.Contains(t, result, `"cherry"`)
assert.NotContains(t, result, `"banana"`)
}
// TestJSONComplexNestedStructure tests multiple untested paths together
func TestJSONComplexNestedStructure(t *testing.T) {
jsonContent := `{
"config": {
"multiplier": 2.5
}
}`
command := utils.ModifyCommand{
Name: "test_complex",
JSON: true,
Lua: `
-- Add nested object with array
data.config.settings = {
enabled = true,
values = {1.5, 2.5, 3.5},
names = {"alpha", "beta"}
}
-- Change float
data.config.multiplier = 7.777
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, "7.777")
assert.Contains(t, result, `"settings"`)
assert.Contains(t, result, `"values"`)
assert.Contains(t, result, `[1.5,2.5,3.5]`)
}
// TestJSONRemoveFirstArrayElement tests line 358-365 - removing first element with comma handling
func TestJSONRemoveFirstArrayElement(t *testing.T) {
jsonContent := `{
"items": [1, 2, 3, 4, 5]
}`
command := utils.ModifyCommand{
Name: "test_remove_first",
JSON: true,
Lua: `
table.remove(data.items, 1)
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.NotContains(t, result, "[1,")
assert.Contains(t, result, "2")
assert.Contains(t, result, "5")
}
// TestJSONRemoveLastArrayElement tests line 366-374 - removing last element with comma handling
func TestJSONRemoveLastArrayElement(t *testing.T) {
jsonContent := `{
"items": [1, 2, 3, 4, 5]
}`
command := utils.ModifyCommand{
Name: "test_remove_last",
JSON: true,
Lua: `
table.remove(data.items, 5)
modified = true
`,
}
commands, err := ProcessJSON(jsonContent, command, "test.json")
assert.NoError(t, err)
assert.NotEmpty(t, commands)
result, _ := utils.ExecuteModifications(commands, jsonContent)
assert.Contains(t, result, "1")
assert.Contains(t, result, "4")
assert.NotContains(t, result, ", 5")
}

View File

@@ -0,0 +1,153 @@
package processor
import (
"testing"
"github.com/stretchr/testify/assert"
)
func TestDeepEqual(t *testing.T) {
tests := []struct {
name string
a interface{}
b interface{}
expected bool
}{
{
name: "both nil",
a: nil,
b: nil,
expected: true,
},
{
name: "first nil",
a: nil,
b: "something",
expected: false,
},
{
name: "second nil",
a: "something",
b: nil,
expected: false,
},
{
name: "equal primitives",
a: 42,
b: 42,
expected: true,
},
{
name: "different primitives",
a: 42,
b: 43,
expected: false,
},
{
name: "equal strings",
a: "hello",
b: "hello",
expected: true,
},
{
name: "equal maps",
a: map[string]interface{}{
"key1": "value1",
"key2": 42,
},
b: map[string]interface{}{
"key1": "value1",
"key2": 42,
},
expected: true,
},
{
name: "maps different lengths",
a: map[string]interface{}{
"key1": "value1",
},
b: map[string]interface{}{
"key1": "value1",
"key2": 42,
},
expected: false,
},
{
name: "maps different values",
a: map[string]interface{}{
"key1": "value1",
},
b: map[string]interface{}{
"key1": "value2",
},
expected: false,
},
{
name: "map vs non-map",
a: map[string]interface{}{
"key1": "value1",
},
b: "not a map",
expected: false,
},
{
name: "equal arrays",
a: []interface{}{1, 2, 3},
b: []interface{}{1, 2, 3},
expected: true,
},
{
name: "arrays different lengths",
a: []interface{}{1, 2},
b: []interface{}{1, 2, 3},
expected: false,
},
{
name: "arrays different values",
a: []interface{}{1, 2, 3},
b: []interface{}{1, 2, 4},
expected: false,
},
{
name: "array vs non-array",
a: []interface{}{1, 2, 3},
b: "not an array",
expected: false,
},
{
name: "nested equal structures",
a: map[string]interface{}{
"outer": map[string]interface{}{
"inner": []interface{}{1, 2, 3},
},
},
b: map[string]interface{}{
"outer": map[string]interface{}{
"inner": []interface{}{1, 2, 3},
},
},
expected: true,
},
{
name: "nested different structures",
a: map[string]interface{}{
"outer": map[string]interface{}{
"inner": []interface{}{1, 2, 3},
},
},
b: map[string]interface{}{
"outer": map[string]interface{}{
"inner": []interface{}{1, 2, 4},
},
},
expected: false,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result := deepEqual(tt.a, tt.b)
assert.Equal(t, tt.expected, result)
})
}
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,490 +0,0 @@
package jsonpath
import (
"fmt"
"strconv"
)
// JSONStep represents a single step in a JSONPath query
type JSONStep struct {
Type StepType
Key string // For Child/RecursiveDescent
Index int // For Index (use -1 for wildcard "*")
}
// JSONNode represents a value in the JSON data with its path
type JSONNode struct {
Value interface{} // The value found at the path
Path string // The exact JSONPath where the value was found
}
// StepType defines the types of steps in a JSONPath
type StepType int
const (
RootStep StepType = iota // $ - The root element
ChildStep // .key - Direct child access
RecursiveDescentStep // ..key - Recursive search for key
WildcardStep // .* - All children of an object
IndexStep // [n] - Array index access (or [*] for all elements)
)
// TraversalMode determines how the traversal behaves
type TraversalMode int
const (
CollectMode TraversalMode = iota // Just collect matched nodes
ModifyFirstMode // Modify first matching node
ModifyAllMode // Modify all matching nodes
)
// ParseJSONPath parses a JSONPath string into a sequence of steps
func ParseJSONPath(path string) ([]JSONStep, error) {
if len(path) == 0 || path[0] != '$' {
return nil, fmt.Errorf("path must start with $; received: %q", path)
}
steps := []JSONStep{}
i := 0
for i < len(path) {
switch path[i] {
case '$':
steps = append(steps, JSONStep{Type: RootStep})
i++
case '.':
i++
if i < len(path) && path[i] == '.' {
// Recursive descent
i++
key, nextPos := readKey(path, i)
steps = append(steps, JSONStep{Type: RecursiveDescentStep, Key: key})
i = nextPos
} else {
// Child step or wildcard
key, nextPos := readKey(path, i)
if key == "*" {
steps = append(steps, JSONStep{Type: WildcardStep})
} else {
steps = append(steps, JSONStep{Type: ChildStep, Key: key})
}
i = nextPos
}
case '[':
// Index step
i++
indexStr, nextPos := readIndex(path, i)
if indexStr == "*" {
steps = append(steps, JSONStep{Type: IndexStep, Index: -1})
} else {
index, err := strconv.Atoi(indexStr)
if err != nil {
return nil, fmt.Errorf("invalid index: %s; error: %w", indexStr, err)
}
steps = append(steps, JSONStep{Type: IndexStep, Index: index})
}
i = nextPos + 1 // Skip closing ]
default:
return nil, fmt.Errorf("unexpected character: %c at position %d; path: %q", path[i], i, path)
}
}
return steps, nil
}
// readKey extracts a key name from the path
func readKey(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == '.' || path[i] == '[' {
break
}
}
return path[start:i], i
}
// readIndex extracts an array index or wildcard from the path
func readIndex(path string, start int) (string, int) {
i := start
for ; i < len(path); i++ {
if path[i] == ']' {
break
}
}
return path[start:i], i
}
// Get retrieves values with their paths from data at the specified JSONPath
// Each returned JSONNode contains both the value and its exact path in the data structure
func Get(data interface{}, path string) ([]JSONNode, error) {
steps, err := ParseJSONPath(path)
if err != nil {
return nil, fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
results := []JSONNode{}
err = traverseWithPaths(data, steps, &results, "$")
if err != nil {
return nil, fmt.Errorf("failed to traverse JSONPath %q: %w", path, err)
}
return results, nil
}
// Set updates the value at the specified JSONPath in the original data structure.
// It only modifies the first matching node.
func Set(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyFirstMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// SetAll updates all matching values at the specified JSONPath.
func SetAll(data interface{}, path string, value interface{}) error {
steps, err := ParseJSONPath(path)
if err != nil {
return fmt.Errorf("failed to parse JSONPath %q: %w", path, err)
}
success := false
err = setWithPath(data, steps, &success, value, "$", ModifyAllMode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", path, err)
}
return nil
}
// setWithPath modifies values while tracking paths
func setWithPath(node interface{}, steps []JSONStep, success *bool, value interface{}, currentPath string, mode TraversalMode) error {
if node == nil || *success && mode == ModifyFirstMode {
return nil
}
// Skip root step
actualSteps := steps
if len(steps) > 0 && steps[0].Type == RootStep {
actualSteps = steps[1:]
}
// If we have no steps left, we're setting the root value
if len(actualSteps) == 0 {
// For the root node, we need to handle it differently depending on what's passed in
// since we can't directly replace the interface{} variable
// We'll signal success and let the JSONProcessor handle updating the root
*success = true
return nil
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
childPath := currentPath + "." + step.Key
if isLastStep {
// We've reached the target, set the value
m[step.Key] = value
*success = true
return nil
}
// Create intermediate nodes if necessary
child, exists := m[step.Key]
if !exists {
// Create missing intermediate node
if len(remainingSteps) > 0 && remainingSteps[0].Type == IndexStep {
child = []interface{}{}
} else {
child = map[string]interface{}{}
}
m[step.Key] = child
}
err := setWithPath(child, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node at path %q is not an array; actual type: %T", currentPath, node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
arr[i] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
arr[step.Index] = value
*success = true
} else {
err := setWithPath(item, remainingSteps, success, value, itemPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", itemPath, err)
}
}
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
m[step.Key] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(val, remainingSteps, success, value, directPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", directPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
// Skip keys we've already processed directly
if step.Key != "*" && k == step.Key {
continue
}
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := setWithPath(v, steps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node at path %q is not a map; actual type: %T", currentPath, node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
m[k] = value
*success = true
if mode == ModifyFirstMode {
return nil
}
} else {
err := setWithPath(v, remainingSteps, success, value, childPath, mode)
if err != nil {
return fmt.Errorf("failed to set value at JSONPath %q: %w", childPath, err)
}
if *success && mode == ModifyFirstMode {
return nil
}
}
}
}
return nil
}
// traverseWithPaths tracks both nodes and their paths during traversal
func traverseWithPaths(node interface{}, steps []JSONStep, results *[]JSONNode, currentPath string) error {
if len(steps) == 0 || node == nil {
return fmt.Errorf("cannot traverse with empty steps or nil node; steps length: %d, node: %v", len(steps), node)
}
// Skip root step
actualSteps := steps
if steps[0].Type == RootStep {
if len(steps) == 1 {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
return nil
}
actualSteps = steps[1:]
}
// Process the first step
step := actualSteps[0]
remainingSteps := actualSteps[1:]
isLastStep := len(remainingSteps) == 0
switch step.Type {
case ChildStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
child, exists := m[step.Key]
if !exists {
return fmt.Errorf("key not found: %s in node at path: %s", step.Key, currentPath)
}
childPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: child, Path: childPath})
} else {
err := traverseWithPaths(child, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case IndexStep:
arr, ok := node.([]interface{})
if !ok {
return fmt.Errorf("node is not an array; actual type: %T", node)
}
// Handle wildcard index
if step.Index == -1 {
for i, item := range arr {
itemPath := fmt.Sprintf("%s[%d]", currentPath, i)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
}
return nil
}
// Handle specific index
if step.Index >= 0 && step.Index < len(arr) {
item := arr[step.Index]
itemPath := fmt.Sprintf("%s[%d]", currentPath, step.Index)
if isLastStep {
*results = append(*results, JSONNode{Value: item, Path: itemPath})
} else {
err := traverseWithPaths(item, remainingSteps, results, itemPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", itemPath, err)
}
}
} else {
return fmt.Errorf("index %d out of bounds for array at path: %s", step.Index, currentPath)
}
case RecursiveDescentStep:
// For recursive descent, first check direct match at this level
if m, ok := node.(map[string]interface{}); ok && step.Key != "*" {
if val, exists := m[step.Key]; exists {
directPath := currentPath + "." + step.Key
if isLastStep {
*results = append(*results, JSONNode{Value: val, Path: directPath})
} else {
err := traverseWithPaths(val, remainingSteps, results, directPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", directPath, err)
}
}
}
}
// For wildcard, collect this node
if step.Key == "*" && isLastStep {
*results = append(*results, JSONNode{Value: node, Path: currentPath})
}
// Then continue recursion to all children
switch n := node.(type) {
case map[string]interface{}:
for k, v := range n {
childPath := currentPath + "." + k
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
case []interface{}:
for i, v := range n {
childPath := fmt.Sprintf("%s[%d]", currentPath, i)
err := traverseWithPaths(v, steps, results, childPath) // Use the same steps
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
case WildcardStep:
m, ok := node.(map[string]interface{})
if !ok {
return fmt.Errorf("node is not a map; actual type: %T", node)
}
for k, v := range m {
childPath := currentPath + "." + k
if isLastStep {
*results = append(*results, JSONNode{Value: v, Path: childPath})
} else {
err := traverseWithPaths(v, remainingSteps, results, childPath)
if err != nil {
return fmt.Errorf("failed to traverse JSONPath %q: %w", childPath, err)
}
}
}
}
return nil
}

View File

@@ -1,577 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
func TestGetWithPathsBasic(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
error bool
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
{
name: "nonexistent path",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
},
path: "$.user.email",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
if !tt.error {
t.Errorf("GetWithPaths() returned error: %v", err)
}
return
}
// For nonexistent path, we expect empty slice
if tt.name == "nonexistent path" {
if len(result) > 0 {
t.Errorf("GetWithPaths() returned %v, expected empty result", result)
}
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For wildcard results, we need to check containment rather than exact order
if tt.name == "wildcard" || tt.name == "recursive descent" {
// For each expected item, check if it exists in the results by both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, expected.Value) && r.Path == expected.Path {
found = true
break
}
}
if !found {
t.Errorf("GetWithPaths() missing expected value: %v with path: %s", expected.Value, expected.Path)
}
}
} else {
// Otherwise check exact equality of both values and paths
for i, expected := range tt.expected {
if !reflect.DeepEqual(result[i].Value, expected.Value) {
t.Errorf("GetWithPaths() value at [%d] = %v, expected %v", i, result[i].Value, expected.Value)
}
if result[i].Path != expected.Path {
t.Errorf("GetWithPaths() path at [%d] = %s, expected %s", i, result[i].Path, expected.Path)
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := Set(data, "$.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("Set() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("nested property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
}
err := Set(data, "$.user.name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
user, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user["name"] != "Jane" {
t.Errorf("Set() failed: expected user.name to be 'Jane', got %v", user["name"])
}
})
t.Run("array element", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
}
err := Set(data, "$.users[0].name", "Bob")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if user0["name"] != "Bob" {
t.Errorf("Set() failed: expected users[0].name to be 'Bob', got %v", user0["name"])
}
})
t.Run("complex value", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
}
newProfile := map[string]interface{}{
"email": "john.doe@example.com",
"phone": "123-456-7890",
}
err := Set(data, "$.user.profile", newProfile)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
profile, ok := userMap["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Profile is not a map")
}
if profile["email"] != "john.doe@example.com" || profile["phone"] != "123-456-7890" {
t.Errorf("Set() failed: expected profile to be updated with new values")
}
})
t.Run("create new property", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
if email, exists := userMap["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.email to be 'john@example.com', got %v", userMap["email"])
}
})
t.Run("create nested properties", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
err := Set(data, "$.user.contact.email", "john@example.com")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
userMap, ok := data["user"].(map[string]interface{})
if !ok {
t.Fatalf("User is not a map")
}
contact, ok := userMap["contact"].(map[string]interface{})
if !ok {
t.Fatalf("Contact is not a map")
}
if email, exists := contact["email"]; !exists || email != "john@example.com" {
t.Errorf("Set() failed: expected user.contact.email to be 'john@example.com', got %v", contact["email"])
}
})
t.Run("create array and element", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
},
}
// This should create an empty addresses array, but won't be able to set index 0
// since the array is empty
err := Set(data, "$.user.addresses[0].street", "123 Main St")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
})
t.Run("multiple targets (should only update first)", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := Set(data, "$.users[*].active", false)
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
user0, ok := users[0].(map[string]interface{})
if !ok {
t.Fatalf("User0 is not a map")
}
user1, ok := users[1].(map[string]interface{})
if !ok {
t.Fatalf("User1 is not a map")
}
// Only the first one should be changed
if active, exists := user0["active"]; !exists || active != false {
t.Errorf("Set() failed: expected users[0].active to be false, got %v", user0["active"])
}
// The second one should remain unchanged
if active, exists := user1["active"]; !exists || active != true {
t.Errorf("Set() incorrectly modified users[1].active: expected true, got %v", user1["active"])
}
})
t.Run("setting on root should not fail (anymore)", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
}
err := Set(data, "$", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Data should be unchanged
if data["name"] != "John" {
t.Errorf("Data was modified when setting on root")
}
})
}
func TestSetAll(t *testing.T) {
t.Run("simple property", func(t *testing.T) {
data := map[string]interface{}{
"name": "John",
"age": 30,
}
err := SetAll(data, "$.name", "Jane")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
if data["name"] != "Jane" {
t.Errorf("SetAll() failed: expected name to be 'Jane', got %v", data["name"])
}
})
t.Run("all array elements", func(t *testing.T) {
data := map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"active": true},
map[string]interface{}{"active": true},
},
}
err := SetAll(data, "$.users[*].active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
users, ok := data["users"].([]interface{})
if !ok {
t.Fatalf("Users is not a slice")
}
// Both elements should be updated
for i, user := range users {
userMap, ok := user.(map[string]interface{})
if !ok {
t.Fatalf("User%d is not a map", i)
}
if active, exists := userMap["active"]; !exists || active != false {
t.Errorf("SetAll() failed: expected users[%d].active to be false, got %v", i, userMap["active"])
}
}
})
t.Run("recursive descent", func(t *testing.T) {
data := map[string]interface{}{
"user": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
"admin": map[string]interface{}{
"profile": map[string]interface{}{
"active": true,
},
},
}
err := SetAll(data, "$..active", false)
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Check user profile
userProfile, ok := data["user"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access user.profile")
}
if active, exists := userProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update user.profile.active, got: %v", active)
}
// Check admin profile
adminProfile, ok := data["admin"].(map[string]interface{})["profile"].(map[string]interface{})
if !ok {
t.Fatalf("Failed to access admin.profile")
}
if active, exists := adminProfile["active"]; !exists || active != false {
t.Errorf("SetAll() didn't update admin.profile.active, got: %v", active)
}
})
}
func TestGetWithPathsExtended(t *testing.T) {
tests := []struct {
name string
data map[string]interface{}
path string
expected []JSONNode
}{
{
name: "simple property",
data: map[string]interface{}{
"name": "John",
"age": 30,
},
path: "$.name",
expected: []JSONNode{
{Value: "John", Path: "$.name"},
},
},
{
name: "nested property",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"age": 30,
},
},
path: "$.user.name",
expected: []JSONNode{
{Value: "John", Path: "$.user.name"},
},
},
{
name: "array access",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[1].name",
expected: []JSONNode{
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "wildcard",
data: map[string]interface{}{
"users": []interface{}{
map[string]interface{}{"name": "John", "age": 30},
map[string]interface{}{"name": "Jane", "age": 25},
},
},
path: "$.users[*].name",
expected: []JSONNode{
{Value: "John", Path: "$.users[0].name"},
{Value: "Jane", Path: "$.users[1].name"},
},
},
{
name: "recursive descent",
data: map[string]interface{}{
"user": map[string]interface{}{
"name": "John",
"profile": map[string]interface{}{
"email": "john@example.com",
},
},
"admin": map[string]interface{}{
"email": "admin@example.com",
},
},
path: "$..email",
expected: []JSONNode{
{Value: "john@example.com", Path: "$.user.profile.email"},
{Value: "admin@example.com", Path: "$.admin.email"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(tt.data, tt.path)
if err != nil {
t.Errorf("GetWithPaths() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// Check if value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Check if path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -1,318 +0,0 @@
package jsonpath
import (
"reflect"
"testing"
)
var testData = map[string]interface{}{
"store": map[string]interface{}{
"book": []interface{}{
map[string]interface{}{
"title": "The Fellowship of the Ring",
"price": 22.99,
},
map[string]interface{}{
"title": "The Two Towers",
"price": 23.45,
},
},
"bicycle": map[string]interface{}{
"color": "red",
"price": 199.95,
},
},
}
func TestParser(t *testing.T) {
tests := []struct {
path string
steps []JSONStep
wantErr bool
}{
{
path: "$.store.bicycle.color",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "bicycle"},
{Type: ChildStep, Key: "color"},
},
},
{
path: "$..price",
steps: []JSONStep{
{Type: RootStep},
{Type: RecursiveDescentStep, Key: "price"},
},
},
{
path: "$.store.book[*].title",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: -1}, // Wildcard
{Type: ChildStep, Key: "title"},
},
},
{
path: "$.store.book[0]",
steps: []JSONStep{
{Type: RootStep},
{Type: ChildStep, Key: "store"},
{Type: ChildStep, Key: "book"},
{Type: IndexStep, Index: 0},
},
},
{
path: "invalid.path",
wantErr: true,
},
{
path: "$.store.book[abc]",
wantErr: true,
},
}
for _, tt := range tests {
t.Run(tt.path, func(t *testing.T) {
steps, err := ParseJSONPath(tt.path)
if (err != nil) != tt.wantErr {
t.Fatalf("ParseJSONPath() error = %v, wantErr %v", err, tt.wantErr)
}
if !tt.wantErr && !reflect.DeepEqual(steps, tt.steps) {
t.Errorf("ParseJSONPath() steps = %+v, want %+v", steps, tt.steps)
}
})
}
}
func TestEvaluator(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
error bool
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
{
name: "wildcard_recursive",
path: "$..*",
expected: []JSONNode{
// These will be compared by value only, paths will be validated separately
{Value: testData["store"].(map[string]interface{})["book"]},
{Value: testData["store"].(map[string]interface{})["bicycle"]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[0]},
{Value: testData["store"].(map[string]interface{})["book"].([]interface{})[1]},
{Value: "The Fellowship of the Ring"},
{Value: 22.99},
{Value: "The Two Towers"},
{Value: 23.45},
{Value: "red"},
{Value: 199.95},
},
},
{
name: "invalid_index",
path: "$.store.book[5]",
expected: []JSONNode{},
error: true,
},
{
name: "nonexistent_property",
path: "$.store.nonexistent",
expected: []JSONNode{},
error: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Use GetWithPaths directly
result, err := Get(testData, tt.path)
if err != nil {
if !tt.error {
t.Errorf("Get() returned error: %v", err)
}
return
}
// Special handling for wildcard recursive test
if tt.name == "wildcard_recursive" {
// Skip length check for wildcard recursive since it might vary
// Just verify that each expected item is in the results
// Validate values match and paths are filled in
for _, e := range tt.expected {
found := false
for _, r := range result {
if reflect.DeepEqual(r.Value, e.Value) {
found = true
break
}
}
if !found {
t.Errorf("Expected value %v not found in results", e.Value)
}
}
return
}
if len(result) != len(tt.expected) {
t.Errorf("Expected %d items, got %d", len(tt.expected), len(result))
}
// Validate both values and paths
for i, e := range tt.expected {
if i < len(result) {
if !reflect.DeepEqual(result[i].Value, e.Value) {
t.Errorf("Value at [%d]: got %v, expected %v", i, result[i].Value, e.Value)
}
if result[i].Path != e.Path {
t.Errorf("Path at [%d]: got %s, expected %s", i, result[i].Path, e.Path)
}
}
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("empty_data", func(t *testing.T) {
result, err := Get(nil, "$.a.b")
if err == nil {
t.Errorf("Expected error for empty data")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("empty_path", func(t *testing.T) {
_, err := ParseJSONPath("")
if err == nil {
t.Error("Expected error for empty path")
}
})
t.Run("numeric_keys", func(t *testing.T) {
data := map[string]interface{}{
"42": "answer",
}
result, err := Get(data, "$.42")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) == 0 || result[0].Value != "answer" {
t.Errorf("Expected 'answer', got %v", result)
}
})
}
func TestGetWithPaths(t *testing.T) {
tests := []struct {
name string
path string
expected []JSONNode
}{
{
name: "simple_property_access",
path: "$.store.bicycle.color",
expected: []JSONNode{
{Value: "red", Path: "$.store.bicycle.color"},
},
},
{
name: "array_index_access",
path: "$.store.book[0].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
},
},
{
name: "wildcard_array_access",
path: "$.store.book[*].title",
expected: []JSONNode{
{Value: "The Fellowship of the Ring", Path: "$.store.book[0].title"},
{Value: "The Two Towers", Path: "$.store.book[1].title"},
},
},
{
name: "recursive_price_search",
path: "$..price",
expected: []JSONNode{
{Value: 22.99, Path: "$.store.book[0].price"},
{Value: 23.45, Path: "$.store.book[1].price"},
{Value: 199.95, Path: "$.store.bicycle.price"},
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(testData, tt.path)
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if lengths match
if len(result) != len(tt.expected) {
t.Errorf("GetWithPaths() returned %d items, expected %d", len(result), len(tt.expected))
return
}
// For each expected item, find its match in the results and verify both value and path
for _, expected := range tt.expected {
found := false
for _, r := range result {
// First verify the value matches
if reflect.DeepEqual(r.Value, expected.Value) {
found = true
// Then verify the path matches
if r.Path != expected.Path {
t.Errorf("Path mismatch for value %v: got %s, expected %s", r.Value, r.Path, expected.Path)
}
break
}
}
if !found {
t.Errorf("Expected node with value %v and path %s not found in results", expected.Value, expected.Path)
}
}
})
}
}

View File

@@ -0,0 +1,191 @@
package processor
import (
"os"
"path/filepath"
"testing"
"cook/utils"
"github.com/stretchr/testify/assert"
)
func TestProcessRegexWithExternalLuaFile(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-integration-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file with replacement variable
luaFile := filepath.Join(tmpDir, "multiply.lua")
luaContent := `v1 = v1 * 2
replacement = format("<value>%s</value>", v1)
return true`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Create test content
content := `<value>10</value>`
// Create command with external Lua reference
command := utils.ModifyCommand{
Name: "test",
Regex: `<value>(\d+)</value>`,
Lua: "@" + filepath.Base(luaFile),
SourceDir: tmpDir,
}
// Process
modifications, err := ProcessRegex(content, command, "test.xml")
assert.NoError(t, err)
assert.Greater(t, len(modifications), 0)
// Apply modifications
result := content
for _, mod := range modifications {
result = result[:mod.From] + mod.With + result[mod.To:]
}
assert.Contains(t, result, "<value>20</value>")
}
func TestProcessJSONWithExternalLuaFile(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-json-integration-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file
luaFile := filepath.Join(tmpDir, "json_modify.lua")
luaContent := `data.value = 84
modified = true`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Create test JSON content
content := `{"value": 42}`
// Create command with external Lua reference
command := utils.ModifyCommand{
Name: "test",
JSON: true,
Lua: "@" + filepath.Base(luaFile),
SourceDir: tmpDir,
}
// Process
modifications, err := ProcessJSON(content, command, "test.json")
assert.NoError(t, err)
assert.Greater(t, len(modifications), 0)
// Apply modifications to verify
result := content
for _, mod := range modifications {
result = result[:mod.From] + mod.With + result[mod.To:]
}
// Check that value was changed to 84 (formatting may vary)
assert.Contains(t, result, `"value"`)
assert.Contains(t, result, `84`)
assert.NotContains(t, result, `"value": 42`)
assert.NotContains(t, result, `"value":42`)
}
func TestProcessXMLWithExternalLuaFile(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-xml-integration-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file (XML uses 'root' not 'data')
luaFile := filepath.Join(tmpDir, "xml_modify.lua")
luaContent := `visitElements(root, function(elem)
if elem._tag == "Item" then
modifyNumAttr(elem, "Weight", function(val) return val * 2 end)
end
end)
modified = true`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Create test XML content
content := `<Items><Item Weight="10" /></Items>`
// Create command with external Lua reference
command := utils.ModifyCommand{
Name: "test",
Lua: "@" + filepath.Base(luaFile),
SourceDir: tmpDir,
}
// Process
modifications, err := ProcessXML(content, command, "test.xml")
assert.NoError(t, err)
assert.Greater(t, len(modifications), 0)
// Apply modifications to verify
result := content
for _, mod := range modifications {
result = result[:mod.From] + mod.With + result[mod.To:]
}
assert.Contains(t, result, `Weight="20"`)
}
func TestExternalLuaFileWithVariables(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-vars-integration-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file with variable reference
luaFile := filepath.Join(tmpDir, "with_vars.lua")
luaContent := `v1 = v1 * $multiply
replacement = format("<value>%s</value>", v1)
return true`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Set global variable
SetVariables(map[string]interface{}{"multiply": 1.5})
defer SetVariables(map[string]interface{}{})
// Create test content
content := `<value>10</value>`
// Create command with external Lua reference
command := utils.ModifyCommand{
Name: "test",
Regex: `<value>(\d+)</value>`,
Lua: "@" + filepath.Base(luaFile),
SourceDir: tmpDir,
}
// Process
modifications, err := ProcessRegex(content, command, "test.xml")
assert.NoError(t, err)
assert.Greater(t, len(modifications), 0)
// Apply modifications
result := content
for _, mod := range modifications {
result = result[:mod.From] + mod.With + result[mod.To:]
}
assert.Contains(t, result, "<value>15</value>")
}
func TestExternalLuaFileErrorHandling(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-error-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create command with non-existent external Lua file
command := utils.ModifyCommand{
Name: "test",
Regex: `<value>(\d+)</value>`,
Lua: "@nonexistent.lua",
SourceDir: tmpDir,
}
// Process - the error script will be generated but execution will fail
// ProcessRegex continues on Lua errors, so no modifications will be made
content := `<value>10</value>`
modifications, err := ProcessRegex(content, command, "test.xml")
// No error returned (ProcessRegex continues on Lua errors), but no modifications made
assert.NoError(t, err)
assert.Empty(t, modifications)
}

View File

@@ -0,0 +1,224 @@
package processor
import (
"os"
"path/filepath"
"testing"
"github.com/stretchr/testify/assert"
)
func TestLoadExternalLuaFile(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file
luaFile := filepath.Join(tmpDir, "test.lua")
luaContent := `data.value = 42
modified = true`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
tests := []struct {
name string
luaPath string
sourceDir string
expected string
wantError bool
}{
{
name: "Relative path with sourceDir",
luaPath: "test.lua",
sourceDir: tmpDir,
expected: luaContent,
wantError: false,
},
{
name: "Absolute path",
luaPath: luaFile,
sourceDir: "",
expected: luaContent,
wantError: false,
},
{
name: "Relative path without sourceDir (uses CWD)",
luaPath: filepath.Base(luaFile),
sourceDir: "",
expected: luaContent,
wantError: false,
},
{
name: "Nested relative path",
luaPath: "scripts/test.lua",
sourceDir: tmpDir,
expected: "",
wantError: true,
},
{
name: "Non-existent file",
luaPath: "nonexistent.lua",
sourceDir: tmpDir,
expected: "",
wantError: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Change to tmpDir for CWD-based tests
if tt.sourceDir == "" && !filepath.IsAbs(tt.luaPath) {
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
}
result, err := LoadExternalLuaFile(tt.luaPath, tt.sourceDir)
if tt.wantError {
assert.Error(t, err)
assert.Empty(t, result)
} else {
assert.NoError(t, err)
assert.Equal(t, tt.expected, result)
}
})
}
}
func TestBuildLuaScriptWithExternalFile(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-build-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file
luaFile := filepath.Join(tmpDir, "multiply.lua")
luaContent := `v1 = v1 * 2`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Test with relative path
relativePath := filepath.Base(luaFile)
result := BuildLuaScript("@"+relativePath, tmpDir)
assert.Contains(t, result, "v1 = v1 * 2")
assert.Contains(t, result, "function run()")
// Test with absolute path
result = BuildLuaScript("@"+luaFile, "")
assert.Contains(t, result, "v1 = v1 * 2")
}
func TestBuildLuaScriptWithExternalFileError(t *testing.T) {
// Test that missing file returns error script
result := BuildLuaScript("@nonexistent.lua", "/tmp")
assert.Contains(t, result, "error(")
assert.Contains(t, result, "Failed to load external Lua file")
}
func TestBuildJSONLuaScriptWithExternalFile(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-json-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file
luaFile := filepath.Join(tmpDir, "json_modify.lua")
luaContent := `data.value = 84
modified = true`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Test with relative path
relativePath := filepath.Base(luaFile)
result := BuildJSONLuaScript("@"+relativePath, tmpDir)
assert.Contains(t, result, "data.value = 84")
assert.Contains(t, result, "modified = true")
assert.Contains(t, result, "function run()")
}
func TestBuildLuaScriptWithInlineCode(t *testing.T) {
// Test that inline code (without @) still works
result := BuildLuaScript("v1 = v1 * 2", "")
assert.Contains(t, result, "v1 = v1 * 2")
assert.Contains(t, result, "function run()")
assert.NotContains(t, result, "@")
}
func TestBuildLuaScriptExternalFileWithVariables(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-vars-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file with variable reference
luaFile := filepath.Join(tmpDir, "with_vars.lua")
luaContent := `v1 = v1 * $multiply`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Set a global variable
SetVariables(map[string]interface{}{"multiply": 1.5})
defer SetVariables(map[string]interface{}{})
// Test that variables are substituted in external files
result := BuildLuaScript("@"+filepath.Base(luaFile), tmpDir)
assert.Contains(t, result, "v1 = v1 * 1.5")
assert.NotContains(t, result, "$multiply")
}
func TestBuildLuaScriptExternalFileNestedPath(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-nested-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create nested directory structure
scriptsDir := filepath.Join(tmpDir, "scripts")
err = os.MkdirAll(scriptsDir, 0755)
assert.NoError(t, err)
luaFile := filepath.Join(scriptsDir, "test.lua")
luaContent := `data.value = 100`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Test with nested relative path
result := BuildLuaScript("@scripts/test.lua", tmpDir)
assert.Contains(t, result, "data.value = 100")
}
func TestBuildLuaScriptExternalFileWithPrependLuaAssignment(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-prepend-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file with operator prefix (should trigger prepend)
luaFile := filepath.Join(tmpDir, "multiply.lua")
luaContent := `* 2`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Test that prepend still works with external files
result := BuildLuaScript("@"+filepath.Base(luaFile), tmpDir)
// PrependLuaAssignment adds "v1 = v1" + "* 2" = "v1 = v1* 2" (no space between v1 and *)
assert.Contains(t, result, "v1 = v1* 2")
}
func TestBuildLuaScriptExternalFilePreservesWhitespace(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "lua-external-whitespace-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test Lua file with multiline content
luaFile := filepath.Join(tmpDir, "multiline.lua")
luaContent := `if data.items then
for i, item in ipairs(data.items) do
item.value = item.value * 2
end
modified = true
end`
err = os.WriteFile(luaFile, []byte(luaContent), 0644)
assert.NoError(t, err)
// Test that whitespace and formatting is preserved
result := BuildLuaScript("@"+filepath.Base(luaFile), tmpDir)
assert.Contains(t, result, "if data.items then")
assert.Contains(t, result, " for i, item in ipairs(data.items) do")
assert.Contains(t, result, " item.value = item.value * 2")
}

View File

@@ -0,0 +1,43 @@
-- Load the helper script
dofile("luahelper.lua")
-- Test helper function
local function assert(condition, message)
if not condition then error("ASSERTION FAILED: " .. (message or "unknown error")) end
end
local function test(name, fn)
local ok, err = pcall(fn)
if ok then
print("PASS: " .. name)
else
print("FAIL: " .. name .. " - " .. tostring(err))
end
end
test("regression test 001", function()
local csv =
[[Id Enabled ModuleId DepartmentId IsDepartment PositionInGraph Parents Modifiers UpgradePrice
news_department TRUE navigation TRUE 2 0 NewsAnalyticsDepartment + 1 communication_relay communication_relay
nd_charge_bonus TRUE navigation news_department FALSE 1 0 news_department NDSkillChargeBonus + 1 expert_disk expert_disk
nd_cooldown_time_reduce TRUE navigation news_department FALSE 3 0 news_department NDCooldownTimeReduce - 2 communication_relay communication_relay]]
local rows, err = fromCSV(csv, { delimiter = "\t", hasheader = true, hascomments = true })
if err then error("fromCSV error: " .. err) end
assert(#rows == 3, "Should have 3 rows")
assert(rows[1].Id == "news_department", "First row Id should be 'news_department'")
assert(rows[1].Enabled == "TRUE", "First row Enabled should be 'TRUE'")
assert(rows[1].ModuleId == "navigation", "First row ModuleId should be 'navigation'")
assert(rows[1].DepartmentId == "", "First row DepartmentId should be ''")
assert(rows[1].IsDepartment == "TRUE", "First row IsDepartment should be 'TRUE'")
assert(rows.Headers[1] == "Id", "First row Headers should be 'Id'")
assert(rows.Headers[2] == "Enabled", "First row Headers should be 'Enabled'")
assert(rows.Headers[3] == "ModuleId", "First row Headers should be 'ModuleId'")
assert(rows.Headers[4] == "DepartmentId", "First row Headers should be 'DepartmentId'")
assert(rows.Headers[5] == "IsDepartment", "First row Headers should be 'IsDepartment'")
assert(rows.Headers[6] == "PositionInGraph", "First row Headers should be 'PositionInGraph'")
assert(rows.Headers[7] == "Parents", "First row Headers should be 'Parents'")
assert(rows.Headers[8] == "Modifiers", "First row Headers should be 'Modifiers'")
assert(rows.Headers[9] == "UpgradePrice", "First row Headers should be 'UpgradePrice'")
end)
print("\nAll tests completed!")

View File

@@ -0,0 +1,224 @@
-- Load the helper script
dofile("luahelper.lua")
-- Test helper function
local function assert(condition, message)
if not condition then error("ASSERTION FAILED: " .. (message or "unknown error")) end
end
local function test(name, fn)
local ok, err = pcall(fn)
if ok then
print("PASS: " .. name)
else
print("FAIL: " .. name .. " - " .. tostring(err))
end
end
-- Test findElements
test("findElements finds all matching elements recursively", function()
local testXML = {
_tag = "root",
_children = {
{ _tag = "item", _attr = { name = "sword" } },
{ _tag = "item", _attr = { name = "shield" } },
{
_tag = "container",
_children = {
{ _tag = "item", _attr = { name = "potion" } },
},
},
},
}
local items = findElements(testXML, "item")
assert(#items == 3, "Should find 3 items total (recursive)")
assert(items[1]._attr.name == "sword", "First item should be sword")
assert(items[3]._attr.name == "potion", "Third item should be potion (from nested)")
end)
-- Test getNumAttr and setNumAttr
test("getNumAttr gets numeric attribute", function()
local elem = { _tag = "item", _attr = { damage = "10" } }
local damage = getNumAttr(elem, "damage")
assert(damage == 10, "Should get damage as number")
end)
test("getNumAttr returns nil for missing attribute", function()
local elem = { _tag = "item", _attr = {} }
local damage = getNumAttr(elem, "damage")
assert(damage == nil, "Should return nil for missing attribute")
end)
test("setNumAttr sets numeric attribute", function()
local elem = { _tag = "item", _attr = {} }
setNumAttr(elem, "damage", 20)
assert(elem._attr.damage == "20", "Should set damage as string")
end)
-- Test modifyNumAttr
test("modifyNumAttr modifies numeric attribute", function()
local elem = { _tag = "item", _attr = { weight = "5.5" } }
local modified = modifyNumAttr(elem, "weight", function(val) return val * 2 end)
assert(modified == true, "Should return true when modified")
assert(elem._attr.weight == "11.0", "Should double weight")
end)
test("modifyNumAttr returns false for missing attribute", function()
local elem = { _tag = "item", _attr = {} }
local modified = modifyNumAttr(elem, "weight", function(val) return val * 2 end)
assert(modified == false, "Should return false when attribute missing")
end)
-- Test filterElements
test("filterElements filters by predicate", function()
local testXML = {
_tag = "root",
_children = {
{ _tag = "item", _attr = { healing = "20" } },
{ _tag = "item", _attr = { damage = "10" } },
{ _tag = "item", _attr = { healing = "50" } },
},
}
local healingItems = filterElements(testXML, function(elem) return hasAttr(elem, "healing") end)
assert(#healingItems == 2, "Should find 2 healing items")
end)
-- Test visitElements
test("visitElements visits all elements", function()
local testXML = {
_tag = "root",
_children = {
{ _tag = "item" },
{ _tag = "container", _children = {
{ _tag = "item" },
} },
},
}
local count = 0
visitElements(testXML, function(elem) count = count + 1 end)
assert(count == 4, "Should visit 4 elements (root + 2 items + container)")
end)
-- Test getText and setText
test("getText gets text content", function()
local elem = { _tag = "item", _text = "Iron Sword" }
local text = getText(elem)
assert(text == "Iron Sword", "Should get text content")
end)
test("setText sets text content", function()
local elem = { _tag = "item" }
setText(elem, "New Text")
assert(elem._text == "New Text", "Should set text content")
end)
-- Test hasAttr and getAttr
test("hasAttr checks attribute existence", function()
local elem = { _tag = "item", _attr = { damage = "10" } }
assert(hasAttr(elem, "damage") == true, "Should have damage")
assert(hasAttr(elem, "magic") == false, "Should not have magic")
end)
test("getAttr gets attribute value", function()
local elem = { _tag = "item", _attr = { name = "sword" } }
assert(getAttr(elem, "name") == "sword", "Should get name attribute")
assert(getAttr(elem, "missing") == nil, "Should return nil for missing")
end)
test("setAttr sets attribute value", function()
local elem = { _tag = "item" }
setAttr(elem, "name", "sword")
assert(elem._attr.name == "sword", "Should set attribute")
end)
-- Test findFirstElement
test("findFirstElement finds first direct child", function()
local parent = {
_tag = "root",
_children = {
{ _tag = "item", _attr = { id = "1" } },
{ _tag = "item", _attr = { id = "2" } },
},
}
local first = findFirstElement(parent, "item")
assert(first._attr.id == "1", "Should find first item")
end)
test("findFirstElement returns nil when not found", function()
local parent = { _tag = "root", _children = {} }
local result = findFirstElement(parent, "item")
assert(result == nil, "Should return nil when not found")
end)
-- Test getChildren
test("getChildren gets all direct children with tag", function()
local parent = {
_tag = "root",
_children = {
{ _tag = "item", _attr = { id = "1" } },
{ _tag = "config" },
{ _tag = "item", _attr = { id = "2" } },
},
}
local items = getChildren(parent, "item")
assert(#items == 2, "Should get 2 items")
assert(items[1]._attr.id == "1", "First should have id=1")
assert(items[2]._attr.id == "2", "Second should have id=2")
end)
-- Test countChildren
test("countChildren counts direct children with tag", function()
local parent = {
_tag = "root",
_children = {
{ _tag = "item" },
{ _tag = "config" },
{ _tag = "item" },
},
}
assert(countChildren(parent, "item") == 2, "Should count 2 items")
assert(countChildren(parent, "config") == 1, "Should count 1 config")
end)
-- Test addChild
test("addChild adds child element", function()
local parent = { _tag = "root", _children = {} }
addChild(parent, { _tag = "item" })
assert(#parent._children == 1, "Should have 1 child")
assert(parent._children[1]._tag == "item", "Child should be item")
end)
test("addChild creates children array if needed", function()
local parent = { _tag = "root" }
addChild(parent, { _tag = "item" })
assert(parent._children ~= nil, "Should create _children")
assert(#parent._children == 1, "Should have 1 child")
end)
-- Test removeChildren
test("removeChildren removes all matching children", function()
local parent = {
_tag = "root",
_children = {
{ _tag = "item" },
{ _tag = "config" },
{ _tag = "item" },
},
}
local removed = removeChildren(parent, "item")
assert(removed == 2, "Should remove 2 items")
assert(#parent._children == 1, "Should have 1 child left")
assert(parent._children[1]._tag == "config", "Remaining should be config")
end)
test("removeChildren returns 0 when none found", function()
local parent = {
_tag = "root",
_children = { { _tag = "item" } },
}
local removed = removeChildren(parent, "config")
assert(removed == 0, "Should remove 0")
assert(#parent._children == 1, "Should still have 1 child")
end)
print("\nAll tests completed!")

View File

@@ -0,0 +1,534 @@
-- Load the helper script
dofile("luahelper.lua")
-- Test helper function
local function assert(condition, message)
if not condition then error("ASSERTION FAILED: " .. (message or "unknown error")) end
end
local function test(name, fn)
local ok, err = pcall(fn)
if ok then
print("PASS: " .. name)
else
print("FAIL: " .. name .. " - " .. tostring(err))
end
end
-- Test fromCSV option validation
test("fromCSV invalid option", function()
local csv = "a,b,c\n1,2,3"
local ok, errMsg = pcall(function() fromCSV(csv, { invalidOption = true }) end)
assert(ok == false, "Should raise error")
assert(string.find(errMsg, "unknown option"), "Error should mention unknown option")
end)
-- Test toCSV invalid delimiter
test("toCSV invalid delimiter", function()
local rows = { { "a", "b", "c" } }
local csv = toCSV(rows, { delimiter = 123 })
-- toCSV converts delimiter to string, so 123 becomes "123"
assert(csv == "a123b123c", "Should convert delimiter to string")
end)
-- Test fromCSV basic parsing
test("fromCSV basic", function()
local csv = "a,b,c\n1,2,3\n4,5,6"
local rows = fromCSV(csv)
assert(#rows == 3, "Should have 3 rows")
assert(rows[1][1] == "a", "First row first field should be 'a'")
assert(rows[2][2] == "2", "Second row second field should be '2'")
end)
-- Test fromCSV with headers
test("fromCSV with headers", function()
local csv = "foo,bar,baz\n1,2,3\n4,5,6"
local rows = fromCSV(csv, { hasheader = true })
assert(#rows == 2, "Should have 2 data rows")
assert(rows[1][1] == "1", "First row first field should be '1'")
assert(rows[1].foo == "1", "First row foo should be '1'")
assert(rows[1].bar == "2", "First row bar should be '2'")
assert(rows[1].baz == "3", "First row baz should be '3'")
end)
-- Test fromCSV with custom delimiter
test("fromCSV with tab delimiter", function()
local csv = "a\tb\tc\n1\t2\t3"
local rows = fromCSV(csv, { delimiter = "\t" })
assert(#rows == 2, "Should have 2 rows")
assert(rows[1][1] == "a", "First row first field should be 'a'")
assert(rows[2][2] == "2", "Second row second field should be '2'")
end)
-- Test fromCSV with quoted fields
test("fromCSV with quoted fields", function()
local csv = '"hello,world","test"\n"foo","bar"'
local rows = fromCSV(csv)
assert(#rows == 2, "Should have 2 rows")
assert(rows[1][1] == "hello,world", "Quoted field with comma should be preserved")
assert(rows[1][2] == "test", "Second field should be 'test'")
end)
-- Test toCSV basic
test("toCSV basic", function()
local rows = { { "a", "b", "c" }, { "1", "2", "3" } }
local csv = toCSV(rows)
assert(csv == "a,b,c\n1,2,3", "CSV output should match expected")
end)
-- Test toCSV with custom delimiter
test("toCSV with tab delimiter", function()
local rows = { { "a", "b", "c" }, { "1", "2", "3" } }
local csv = toCSV(rows, { delimiter = "\t" })
assert(csv == "a\tb\tc\n1\t2\t3", "TSV output should match expected")
end)
-- Test toCSV with fields needing quoting
test("toCSV with quoted fields", function()
local rows = { { "hello,world", "test" }, { "foo", "bar" } }
local csv = toCSV(rows)
assert(csv == '"hello,world",test\nfoo,bar', "Fields with commas should be quoted")
end)
-- Test round trip
test("fromCSV toCSV round trip", function()
local original = "a,b,c\n1,2,3\n4,5,6"
local rows = fromCSV(original)
local csv = toCSV(rows)
assert(csv == original, "Round trip should preserve original")
end)
-- Test round trip with headers
test("fromCSV toCSV round trip with headers", function()
local original = "foo,bar,baz\n1,2,3\n4,5,6"
local rows = fromCSV(original, { hasheader = true })
local csv = toCSV(rows)
local expected = "1,2,3\n4,5,6"
assert(csv == expected, "Round trip with headers should preserve data rows")
end)
-- Test fromCSV with comments
test("fromCSV with comments", function()
local csv = "# This is a comment\nfoo,bar,baz\n1,2,3\n# Another comment\n4,5,6"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 3, "Should have 3 rows (comments filtered, header + 2 data rows)")
assert(rows[1][1] == "foo", "First row should be header row")
assert(rows[2][1] == "1", "Second row first field should be '1'")
assert(rows[3][1] == "4", "Third row first field should be '4'")
end)
-- Test fromCSV with comments and headers
test("fromCSV with comments and headers", function()
local csv = "#mercenary_profiles\nId,Name,Value\n1,Test,100\n# End of data\n2,Test2,200"
local rows = fromCSV(csv, { hasheader = true, hascomments = true })
assert(#rows == 2, "Should have 2 data rows")
assert(rows[1].Id == "1", "First row Id should be '1'")
assert(rows[1].Name == "Test", "First row Name should be 'Test'")
assert(rows[1].Value == "100", "First row Value should be '100'")
assert(rows[2].Id == "2", "Second row Id should be '2'")
end)
-- Test fromCSV with comments disabled
test("fromCSV without comments", function()
local csv = "# This should not be filtered\nfoo,bar\n1,2"
local rows = fromCSV(csv, { hascomments = false })
assert(#rows == 3, "Should have 3 rows (including comment)")
assert(rows[1][1] == "# This should not be filtered", "Comment line should be preserved")
end)
-- Test fromCSV with comment at start
test("fromCSV comment at start", function()
local csv = "# Header comment\nId,Name\n1,Test"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 2, "Should have 2 rows (comment filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with comment with leading whitespace
test("fromCSV comment with whitespace", function()
local csv = " # Comment with spaces\nId,Name\n1,Test"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 2, "Should have 2 rows (comment with spaces filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with comment with tabs
test("fromCSV comment with tabs", function()
local csv = "\t# Comment with tab\nId,Name\n1,Test"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 2, "Should have 2 rows (comment with tab filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with multiple consecutive comments
test("fromCSV multiple consecutive comments", function()
local csv = "# First comment\n# Second comment\n# Third comment\nId,Name\n1,Test"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 2, "Should have 2 rows (all comments filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with comment in middle of data
test("fromCSV comment in middle", function()
local csv = "Id,Name\n1,Test\n# Middle comment\n2,Test2"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 3, "Should have 3 rows (comment filtered)")
assert(rows[1][1] == "Id", "First row should be header")
assert(rows[2][1] == "1", "Second row should be first data")
assert(rows[3][1] == "2", "Third row should be second data")
end)
-- Test fromCSV with comment at end
test("fromCSV comment at end", function()
local csv = "Id,Name\n1,Test\n# End comment"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 2, "Should have 2 rows (end comment filtered)")
assert(rows[1][1] == "Id", "First row should be header")
assert(rows[2][1] == "1", "Second row should be data")
end)
-- Test fromCSV with empty comment line
test("fromCSV empty comment", function()
local csv = "#\nId,Name\n1,Test"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 2, "Should have 2 rows (empty comment filtered)")
assert(rows[1][1] == "Id", "First row should be header")
end)
-- Test fromCSV with comment and headers
test("fromCSV comment with headers enabled", function()
local csv = "#mercenary_profiles\nId,Name,Value\n1,Test,100\n2,Test2,200"
local rows = fromCSV(csv, { hasheader = true, hascomments = true })
assert(#rows == 2, "Should have 2 data rows")
assert(rows[1].Id == "1", "First row Id should be '1'")
assert(rows[1].Name == "Test", "First row Name should be 'Test'")
assert(rows[2].Id == "2", "Second row Id should be '2'")
end)
-- Test fromCSV with comment and TSV delimiter
test("fromCSV comment with tab delimiter", function()
local csv = "# Comment\nId\tName\n1\tTest"
local rows = fromCSV(csv, { delimiter = "\t", hascomments = true })
assert(#rows == 2, "Should have 2 rows")
assert(rows[1][1] == "Id", "First row should be header")
assert(rows[2][1] == "1", "Second row first field should be '1'")
end)
-- Test fromCSV with comment and headers and TSV
test("fromCSV comment with headers and TSV", function()
local csv = "#mercenary_profiles\nId\tName\tValue\n1\tTest\t100"
local rows = fromCSV(csv, { delimiter = "\t", hasheader = true, hascomments = true })
assert(#rows == 1, "Should have 1 data row")
assert(rows[1].Id == "1", "Row Id should be '1'")
assert(rows[1].Name == "Test", "Row Name should be 'Test'")
assert(rows[1].Value == "100", "Row Value should be '100'")
end)
-- Test fromCSV with data field starting with # (not a comment)
test("fromCSV data field starting with hash", function()
local csv = "Id,Name\n1,#NotAComment\n2,Test"
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 3, "Should have 3 rows (data with # not filtered)")
assert(rows[1][1] == "Id", "First row should be header")
assert(rows[2][2] == "#NotAComment", "Second row should have #NotAComment as data")
end)
-- Test fromCSV with quoted field starting with #
test("fromCSV quoted field with hash", function()
local csv = 'Id,Name\n1,"#NotAComment"\n2,Test'
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 3, "Should have 3 rows (quoted # not filtered)")
assert(rows[2][2] == "#NotAComment", "Quoted field with # should be preserved")
end)
-- Test fromCSV with comment after quoted field
test("fromCSV comment after quoted field", function()
local csv = 'Id,Name\n1,"Test"\n# This is a comment\n2,Test2'
local rows = fromCSV(csv, { hascomments = true })
assert(#rows == 3, "Should have 3 rows (comment filtered)")
assert(rows[2][2] == "Test", "Quoted field should be preserved")
assert(rows[3][1] == "2", "Third row should be second data row")
end)
-- Math function tests
test("min function", function()
assert(min(5, 3) == 3, "min(5, 3) should be 3")
assert(min(-1, 0) == -1, "min(-1, 0) should be -1")
assert(min(10, 10) == 10, "min(10, 10) should be 10")
end)
test("max function", function()
assert(max(5, 3) == 5, "max(5, 3) should be 5")
assert(max(-1, 0) == 0, "max(-1, 0) should be 0")
assert(max(10, 10) == 10, "max(10, 10) should be 10")
end)
test("round function", function()
assert(round(3.14159) == 3, "round(3.14159) should be 3")
assert(round(3.14159, 2) == 3.14, "round(3.14159, 2) should be 3.14")
assert(round(3.5) == 4, "round(3.5) should be 4")
assert(round(3.4) == 3, "round(3.4) should be 3")
assert(round(123.456, 1) == 123.5, "round(123.456, 1) should be 123.5")
end)
test("floor function", function()
assert(floor(3.7) == 3, "floor(3.7) should be 3")
assert(floor(-3.7) == -4, "floor(-3.7) should be -4")
assert(floor(5) == 5, "floor(5) should be 5")
end)
test("ceil function", function()
assert(ceil(3.2) == 4, "ceil(3.2) should be 4")
assert(ceil(-3.2) == -3, "ceil(-3.2) should be -3")
assert(ceil(5) == 5, "ceil(5) should be 5")
end)
-- String function tests
test("upper function", function()
assert(upper("hello") == "HELLO", "upper('hello') should be 'HELLO'")
assert(upper("Hello World") == "HELLO WORLD", "upper('Hello World') should be 'HELLO WORLD'")
assert(upper("123abc") == "123ABC", "upper('123abc') should be '123ABC'")
end)
test("lower function", function()
assert(lower("HELLO") == "hello", "lower('HELLO') should be 'hello'")
assert(lower("Hello World") == "hello world", "lower('Hello World') should be 'hello world'")
assert(lower("123ABC") == "123abc", "lower('123ABC') should be '123abc'")
end)
test("format function", function()
assert(format("Hello %s", "World") == "Hello World", "format should work")
assert(format("Number: %d", 42) == "Number: 42", "format with number should work")
assert(format("%.2f", 3.14159) == "3.14", "format with float should work")
end)
test("trim function", function()
assert(trim(" hello ") == "hello", "trim should remove leading and trailing spaces")
assert(trim(" hello world ") == "hello world", "trim should preserve internal spaces")
assert(trim("hello") == "hello", "trim should not affect strings without spaces")
assert(trim(" ") == "", "trim should handle all spaces")
end)
test("strsplit function", function()
local result = strsplit("a,b,c", ",")
assert(#result == 3, "strsplit should return 3 elements")
assert(result[1] == "a", "First element should be 'a'")
assert(result[2] == "b", "Second element should be 'b'")
assert(result[3] == "c", "Third element should be 'c'")
end)
test("strsplit with default separator", function()
local result = strsplit("a b c")
assert(#result == 3, "strsplit with default should return 3 elements")
assert(result[1] == "a", "First element should be 'a'")
assert(result[2] == "b", "Second element should be 'b'")
assert(result[3] == "c", "Third element should be 'c'")
end)
test("strsplit with custom separator", function()
local result = strsplit("a|b|c", "|")
assert(#result == 3, "strsplit with pipe should return 3 elements")
assert(result[1] == "a", "First element should be 'a'")
assert(result[2] == "b", "Second element should be 'b'")
assert(result[3] == "c", "Third element should be 'c'")
end)
-- Conversion function tests
test("num function", function()
assert(num("123") == 123, "num('123') should be 123")
assert(num("45.67") == 45.67, "num('45.67') should be 45.67")
assert(num("invalid") == 0, "num('invalid') should be 0")
assert(num("") == 0, "num('') should be 0")
end)
test("str function", function()
assert(str(123) == "123", "str(123) should be '123'")
assert(str(45.67) == "45.67", "str(45.67) should be '45.67'")
assert(str(0) == "0", "str(0) should be '0'")
end)
test("is_number function", function()
assert(is_number("123") == true, "is_number('123') should be true")
assert(is_number("45.67") == true, "is_number('45.67') should be true")
assert(is_number("invalid") == false, "is_number('invalid') should be false")
assert(is_number("") == false, "is_number('') should be false")
assert(is_number("123abc") == false, "is_number('123abc') should be false")
end)
-- Table function tests
test("isArray function", function()
assert(isArray({ 1, 2, 3 }) == true, "isArray should return true for sequential array")
assert(isArray({ "a", "b", "c" }) == true, "isArray should return true for string array")
assert(isArray({}) == true, "isArray should return true for empty array")
assert(isArray({ a = 1, b = 2 }) == false, "isArray should return false for map")
assert(isArray({ 1, 2, [4] = 4 }) == false, "isArray should return false for sparse array")
assert(
isArray({ [1] = 1, [2] = 2, [3] = 3 }) == true,
"isArray should return true for 1-indexed array"
)
assert(
isArray({ [0] = 1, [1] = 2 }) == false,
"isArray should return false for 0-indexed array"
)
assert(
isArray({ [1] = 1, [2] = 2, [4] = 4 }) == false,
"isArray should return false for non-sequential array"
)
assert(isArray("not a table") == false, "isArray should return false for non-table")
assert(isArray(123) == false, "isArray should return false for number")
end)
test("fromCSV assigns header keys correctly", function()
local teststr = [[
#mercenary_profiles
Id ModifyStartCost ModifyStep ModifyLevelLimit Health ResistSheet WoundSlots MeleeDamage MeleeAccuracy RangeAccuracy ReceiveAmputationChance ReceiveWoundChanceMult AttackWoundChanceMult Dodge Los StarvationLimit PainThresholdLimit PainThresholdRegen TalentPerkId ActorId SkinIndex HairType HairColorHex VoiceBank Immunity CreatureClass
john_hawkwood_boss 20 0.1 140 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 8 16 crit 1.60 critchance 0.05 0.5 0.5 0.03 0.5 1.2 0.3 8 2200 16 2 talent_the_man_who_sold_the_world human_male 0 hair1 #633D08 player Human
francis_reid_daly 20 0.1 130 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.05 0.5 0.4 0.04 0.9 1 0.3 8 2000 10 1 talent_weapon_durability human_male 0 player Human
]]
local rows = fromCSV(teststr, { delimiter = "\t", hasheader = true, hascomments = true })
assert(#rows == 2, "Should have 2 data rows")
-- Test first row
assert(rows[1].Id == "john_hawkwood_boss", "First row Id should be 'john_hawkwood_boss'")
assert(rows[1].ModifyStartCost == "20", "First row ModifyStartCost should be '20'")
assert(rows[1].ModifyStep == "0.1", "First row ModifyStep should be '0.1'")
assert(rows[1].Health == "140", "First row Health should be '140'")
assert(rows[1].ActorId == "human_male", "First row ActorId should be 'human_male'")
assert(rows[1].HairColorHex == "#633D08", "First row HairColorHex should be '#633D08'")
-- Test second row
assert(rows[2].Id == "francis_reid_daly", "Second row Id should be 'francis_reid_daly'")
assert(rows[2].ModifyStartCost == "20", "Second row ModifyStartCost should be '20'")
assert(rows[2].ModifyStep == "0.1", "Second row ModifyStep should be '0.1'")
assert(rows[2].Health == "130", "Second row Health should be '130'")
assert(rows[2].ActorId == "human_male", "Second row ActorId should be 'human_male'")
-- Test that numeric indices still work
assert(rows[1][1] == "john_hawkwood_boss", "First row first field by index should work")
assert(rows[1][2] == "20", "First row second field by index should work")
end)
test("fromCSV debug header assignment", function()
local csv = "Id Name Value\n1 Test 100\n2 Test2 200"
local rows = fromCSV(csv, { delimiter = "\t", hasheader = true })
assert(rows[1].Id == "1", "Id should be '1'")
assert(rows[1].Name == "Test", "Name should be 'Test'")
assert(rows[1].Value == "100", "Value should be '100'")
end)
test("fromCSV real world mercenary file format", function()
local csv = [[#mercenary_profiles
Id ModifyStartCost ModifyStep ModifyLevelLimit Health ResistSheet WoundSlots MeleeDamage MeleeAccuracy RangeAccuracy ReceiveAmputationChance ReceiveWoundChanceMult AttackWoundChanceMult Dodge Los StarvationLimit PainThresholdLimit PainThresholdRegen TalentPerkId ActorId SkinIndex HairType HairColorHex VoiceBank Immunity CreatureClass
john_hawkwood_boss 20 0.1 140 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 8 16 crit 1.60 critchance 0.05 0.5 0.5 0.03 0.5 1.2 0.3 8 2200 16 2 talent_the_man_who_sold_the_world human_male 0 hair1 #633D08 player Human
francis_reid_daly 20 0.1 130 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.05 0.5 0.4 0.04 0.9 1 0.3 8 2000 10 1 talent_weapon_durability human_male 0 player Human
]]
local rows = fromCSV(csv, { delimiter = "\t", hasheader = true, hascomments = true })
assert(#rows == 2, "Should have 2 data rows")
assert(rows[1].Id == "john_hawkwood_boss", "First row Id should be 'john_hawkwood_boss'")
assert(rows[1].ModifyStartCost == "20", "First row ModifyStartCost should be '20'")
assert(rows[2].Id == "francis_reid_daly", "Second row Id should be 'francis_reid_daly'")
end)
test("full CSV parser complex", function()
local original = [[
#mercenary_profiles
Id ModifyStartCost ModifyStep ModifyLevelLimit Health ResistSheet WoundSlots MeleeDamage MeleeAccuracy RangeAccuracy ReceiveAmputationChance ReceiveWoundChanceMult AttackWoundChanceMult Dodge Los StarvationLimit PainThresholdLimit PainThresholdRegen TalentPerkId ActorId SkinIndex HairType HairColorHex VoiceBank Immunity CreatureClass
john_hawkwood_boss 20 0.1 140 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 8 16 crit 1.60 critchance 0.05 0.5 0.5 0.03 0.5 1.2 0.3 8 2200 16 2 talent_the_man_who_sold_the_world human_male 0 hair1 #633D08 player Human
francis_reid_daly 20 0.1 130 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.05 0.5 0.4 0.04 0.9 1 0.3 8 2000 10 1 talent_weapon_durability human_male 0 player Human
victoria_boudicca 20 0.1 90 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.1 0.4 0.45 0.05 1 1.2 0.3 8 1800 8 1 talent_weapon_distance human_female 0 hair1 #633D08 player Human
persival_fawcett 20 0.1 150 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 6 12 crit 1.70 critchance 0.05 0.5 0.35 0.05 0.6 1 0.25 8 2100 16 1 talent_all_resists human_male 1 hair1 #633D08 player Human
Isabella_capet 20 0.1 100 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.15 0.55 0.3 0.03 0.8 1.4 0.35 7 1700 14 2 talent_ignore_infection human_female 1 hair3 #FF3100 player Human
maximilian_rohr 20 0.1 120 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 8 16 crit 1.75 critchance 0.05 0.45 0.45 0.06 0.9 1 0.2 8 2000 14 1 talent_ignore_pain human_male 0 hair2 #FFC400 player Human
priya_marlon 20 0.1 110 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.15 0.45 0.35 0.05 1 1.1 0.3 7 2200 12 1 talent_all_consumables_stack human_female 0 hair2 #FFC400 player Human
jacques_kennet 20 0.1 120 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.05 0.45 0.35 0.04 0.9 1.2 0.3 8 2300 10 1 talent_reload_time human_male 0 hair1 #908E87 player Human
mirza_aishatu 20 0.1 110 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 7 14 crit 1.70 critchance 0.05 0.55 0.45 0.03 1 1.1 0.25 9 2000 10 1 talent_starving_slower human_female 1 hair2 #633D08 player Human
kenzie_yukio 20 0.1 100 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.1 0.6 0.4 0.04 1 1 0.4 7 1600 12 1 talent_weight_dodge_affect human_male 0 hair2 #633D08 player Human
marika_wulfnod 20 0.1 100 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 6 12 crit 1.60 critchance 0.05 0.5 0.5 0.04 1 1 0.3 9 1900 12 1 talent_belt_slots human_female 0 hair1 #FFC400 player Human
auberon_lukas 20 0.1 120 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 4 8 crit 1.60 critchance 0.15 0.45 0.45 0.05 0.8 1 0.2 9 1900 8 2 talent_weapon_slot human_male 0 hair2 #633D08 player Human
niko_medich 20 0.1 120 blunt 0 pierce 0 lacer 0 fire 0 cold 0 poison 0 shock 0 beam 0 HumanHead HumanShoulder HumanArm HumanThigh HumanFeet HumanChest HumanBody HumanStomach HumanKnee blunt 5 10 crit 1.70 critchance 0.05 0.4 0.45 0.04 1 1.3 0.25 8 2000 10 1 talent_pistol_acc human_male 0 hair1 #908E87 player Human
#end
#mercenary_classes
Id ModifyStartCost ModifyStep PerkIds
scouts_of_hades 30 0.1 cqc_specialist_basic military_training_basic gear_maintenance_basic blind_fury_basic fire_transfer_basic assault_reflex_basic
ecclipse_blades 30 0.1 berserkgang_basic athletics_basic reaction_training_basic cold_weapon_wielding_basic cannibalism_basic carnage_basic
tifton_elite 30 0.1 heavy_weaponary_basic grenadier_basic selfhealing_basic stationary_defense_basic spray_and_pray_basic shock_awe_basic
tunnel_rats 30 0.1 cautious_basic handmade_shotgun_ammo_basic marauder_basic dirty_shot_basic vicious_symbiosis_basic covermaster_basic
phoenix_brigade 30 0.1 shielding_basic battle_physicist_basic reinforced_battery_basic revealing_flame_basic cauterize_basic scholar_basic
]]
-- Parse with headers and comments
local rows = fromCSV(original, { delimiter = "\t", hasheader = true, hascomments = true })
assert(#rows > 0, "Should have parsed rows")
-- Convert back to CSV with headers
local csv = toCSV(rows, { delimiter = "\t", hasheader = true })
-- Parse again
local rows2 = fromCSV(csv, { delimiter = "\t", hasheader = true, hascomments = false })
-- Verify identical - same number of rows
assert(#rows2 == #rows, "Round trip should have same number of rows")
-- Verify first row data is identical
assert(rows2[1].Id == rows[1].Id, "Round trip first row Id should match")
assert(
rows2[1].ModifyStartCost == rows[1].ModifyStartCost,
"Round trip first row ModifyStartCost should match"
)
assert(rows2[1].Health == rows[1].Health, "Round trip first row Health should match")
-- Verify headers are preserved
assert(rows2.Headers ~= nil, "Round trip rows should have Headers field")
assert(#rows2.Headers == #rows.Headers, "Headers should have same number of elements")
assert(rows2.Headers[1] == rows.Headers[1], "First header should match")
end)
-- Test metatable: row[1] and row.foobar return same value
test("metatable row[1] equals row.header", function()
local csv = "Id Name Value\n1 Test 100"
local rows = fromCSV(csv, { delimiter = "\t", hasheader = true })
assert(rows[1][1] == rows[1].Id, "row[1] should equal row.Id")
assert(rows[1][2] == rows[1].Name, "row[2] should equal row.Name")
assert(rows[1][3] == rows[1].Value, "row[3] should equal row.Value")
assert(rows[1].Id == "1", "row.Id should be '1'")
assert(rows[1][1] == "1", "row[1] should be '1'")
end)
-- Test metatable: setting via header name updates numeric index
test("metatable set via header name", function()
local csv = "Id Name Value\n1 Test 100"
local rows = fromCSV(csv, { delimiter = "\t", hasheader = true })
rows[1].Id = "999"
assert(rows[1][1] == "999", "Setting row.Id should update row[1]")
assert(rows[1].Id == "999", "row.Id should be '999'")
end)
-- Test metatable: error on unknown header assignment
test("metatable error on unknown header", function()
local csv = "Id Name Value\n1 Test 100"
local rows = fromCSV(csv, { delimiter = "\t", hasheader = true })
local ok, errMsg = pcall(function() rows[1].UnknownHeader = "test" end)
assert(ok == false, "Should error on unknown header")
assert(string.find(errMsg, "unknown header"), "Error should mention unknown header")
end)
-- Test metatable: numeric indices still work
test("metatable numeric indices work", function()
local csv = "Id Name Value\n1 Test 100"
local rows = fromCSV(csv, { delimiter = "\t", hasheader = true })
rows[1][1] = "999"
assert(rows[1].Id == "999", "Setting row[1] should update row.Id")
assert(rows[1][1] == "999", "row[1] should be '999'")
end)
-- Test metatable: numeric keys work normally
test("metatable numeric keys work", function()
local csv = "Id Name Value\n1 Test 100"
local rows = fromCSV(csv, { delimiter = "\t", hasheader = true })
rows[1][100] = "hundred"
assert(rows[1][100] == "hundred", "Numeric keys should work")
end)
print("\nAll tests completed!")

624
processor/luahelper.lua Normal file
View File

@@ -0,0 +1,624 @@
-- Custom Lua helpers for math operations
--- Returns the minimum of two numbers
--- @param a number First number
--- @param b number Second number
--- @return number Minimum value
function min(a, b) return math.min(a, b) end
--- Returns the maximum of two numbers
--- @param a number First number
--- @param b number Second number
--- @return number Maximum value
function max(a, b) return math.max(a, b) end
--- Rounds a number to n decimal places
--- @param x number Number to round
--- @param n number? Number of decimal places (default: 0)
--- @return number Rounded number
function round(x, n)
if n == nil then n = 0 end
return math.floor(x * 10 ^ n + 0.5) / 10 ^ n
end
--- Returns the floor of a number
--- @param x number Number to floor
--- @return number Floored number
function floor(x) return math.floor(x) end
--- Returns the ceiling of a number
--- @param x number Number to ceil
--- @return number Ceiled number
function ceil(x) return math.ceil(x) end
--- Converts string to uppercase
--- @param s string String to convert
--- @return string Uppercase string
function upper(s) return string.upper(s) end
--- Converts string to lowercase
--- @param s string String to convert
--- @return string Lowercase string
function lower(s) return string.lower(s) end
--- Formats a string using Lua string.format
--- @param s string Format string
--- @param ... any Values to format
--- @return string Formatted string
function format(s, ...) return string.format(s, ...) end
--- Removes leading and trailing whitespace from string
--- @param s string String to trim
--- @return string Trimmed string
function trim(s) return string.gsub(s, "^%s*(.-)%s*$", "%1") end
--- Splits a string by separator
--- @param inputstr string String to split
--- @param sep string? Separator pattern (default: whitespace)
--- @return table Array of string parts
function strsplit(inputstr, sep)
if sep == nil then sep = "%s" end
local t = {}
for str in string.gmatch(inputstr, "([^" .. sep .. "]+)") do
table.insert(t, str)
end
return t
end
---@param table table
---@param depth number?
function dump(table, depth)
if depth == nil then depth = 0 end
if depth > 200 then
print("Error: Depth > 200 in dump()")
return
end
for k, v in pairs(table) do
if type(v) == "table" then
print(string.rep(" ", depth) .. k .. ":")
dump(v, depth + 1)
else
print(string.rep(" ", depth) .. k .. ": ", v)
end
end
end
--- @class ParserOptions
--- @field delimiter string? The field delimiter (default: ",").
--- @field hasheader boolean? If true, first non-comment row is treated as headers (default: false).
--- @field hascomments boolean? If true, lines starting with '#' are skipped (default: false).
--- @type ParserOptions
parserDefaultOptions = { delimiter = ",", hasheader = false, hascomments = false }
--- Validates options against a set of valid option keys.
--- @param options ParserOptions? The options table to validate
function areOptionsValid(options)
if options == nil then return end
if type(options) ~= "table" then error("options must be a table") end
-- Build valid options list from validOptions table
local validOptionsStr = ""
for k, _ in pairs(parserDefaultOptions) do
validOptionsStr = validOptionsStr .. k .. ", "
end
for k, _ in pairs(options) do
if parserDefaultOptions[k] == nil then
error(
"unknown option: " .. tostring(k) .. " (valid options: " .. validOptionsStr .. ")"
)
end
end
end
--- Parses CSV text into rows and fields using a minimal RFC 4180 state machine.
---
--- Requirements/assumptions:
--- - Input is a single string containing the entire CSV content.
--- - Field separators are specified by delimiter option (default: comma).
--- - Newlines between rows may be "\n" or "\r\n". "\r\n" is treated as one line break.
--- - Fields may be quoted with double quotes (").
--- - Inside quoted fields, doubled quotes ("") represent a literal quote character.
--- - No backslash escaping is supported (not part of RFC 4180).
--- - Newlines inside quoted fields are preserved as part of the field.
--- - Leading/trailing spaces are preserved; no trimming is performed.
--- - Empty fields and empty rows are preserved.
--- - The final row is emitted even if the text does not end with a newline.
--- - Lines starting with '#' (after optional leading whitespace) are treated as comments and skipped if hascomments is true.
---
--- @param csv string The CSV text to parse.
--- @param options ParserOptions? Options for the parser
--- @return table #A table (array) of rows; each row is a table with numeric indices and optionally header-named keys.
function fromCSV(csv, options)
if options == nil then options = {} end
-- Validate options
areOptionsValid(options)
local delimiter = options.delimiter or parserDefaultOptions.delimiter
local hasheader = options.hasheader or parserDefaultOptions.hasheader
local hascomments = options.hascomments or parserDefaultOptions.hascomments
local allRows = {}
local fields = {}
local field = {}
local STATE_DEFAULT = 1
local STATE_IN_QUOTES = 2
local STATE_QUOTE_IN_QUOTES = 3
local state = STATE_DEFAULT
local i = 1
local len = #csv
while i <= len do
local c = csv:sub(i, i)
if state == STATE_DEFAULT then
if c == '"' then
state = STATE_IN_QUOTES
i = i + 1
elseif c == delimiter then
table.insert(fields, table.concat(field))
field = {}
i = i + 1
elseif c == "\r" or c == "\n" then
table.insert(fields, table.concat(field))
field = {}
local shouldAdd = true
if hascomments and #fields > 0 then
local firstField = fields[1]
local trimmed = trim(firstField)
if string.sub(trimmed, 1, 1) == "#" then shouldAdd = false end
end
if shouldAdd then table.insert(allRows, fields) end
fields = {}
if c == "\r" and i < len and csv:sub(i + 1, i + 1) == "\n" then
i = i + 2
else
i = i + 1
end
else
table.insert(field, c)
i = i + 1
end
elseif state == STATE_IN_QUOTES then
if c == '"' then
state = STATE_QUOTE_IN_QUOTES
i = i + 1
else
table.insert(field, c)
i = i + 1
end
else -- STATE_QUOTE_IN_QUOTES
if c == '"' then
table.insert(field, '"')
state = STATE_IN_QUOTES
i = i + 1
elseif c == delimiter then
table.insert(fields, table.concat(field))
field = {}
state = STATE_DEFAULT
i = i + 1
elseif c == "\r" or c == "\n" then
table.insert(fields, table.concat(field))
field = {}
local shouldAdd = true
if hascomments and #fields > 0 then
local firstField = fields[1]
local trimmed = string.gsub(firstField, "^%s*(.-)%s*$", "%1")
if string.sub(trimmed, 1, 1) == "#" then shouldAdd = false end
end
if shouldAdd then table.insert(allRows, fields) end
fields = {}
state = STATE_DEFAULT
if c == "\r" and i < len and csv:sub(i + 1, i + 1) == "\n" then
i = i + 2
else
i = i + 1
end
else
state = STATE_DEFAULT
-- Don't increment i, reprocess character in DEFAULT state
end
end
end
if #field > 0 or #fields > 0 then
table.insert(fields, table.concat(field))
local shouldAdd = true
if hascomments and #fields > 0 then
local firstField = fields[1]
local trimmed = string.gsub(firstField, "^%s*(.-)%s*$", "%1")
if string.sub(trimmed, 1, 1) == "#" then shouldAdd = false end
end
if shouldAdd then table.insert(allRows, fields) end
end
if hasheader and #allRows > 0 then
local headers = allRows[1]
local headerMap = {}
for j = 1, #headers do
if headers[j] ~= nil and headers[j] ~= "" then
local headerName = trim(headers[j])
headerMap[headerName] = j
end
end
local header_mt = {
headers = headerMap,
__index = function(t, key)
local mt = getmetatable(t)
if type(key) == "string" and mt.headers and mt.headers[key] then
return rawget(t, mt.headers[key])
end
return rawget(t, key)
end,
__newindex = function(t, key, value)
local mt = getmetatable(t)
if type(key) == "string" and mt.headers then
if mt.headers[key] then
rawset(t, mt.headers[key], value)
else
error("unknown header: " .. tostring(key))
end
else
rawset(t, key, value)
end
end,
}
local rows = {}
for ii = 2, #allRows do
local row = {}
local dataRow = allRows[ii]
for j = 1, #dataRow do
row[j] = dataRow[j]
end
setmetatable(row, header_mt)
table.insert(rows, row)
end
rows.Headers = headers
return rows
end
return allRows
end
--- Converts a table of rows back to CSV text format (RFC 4180 compliant).
---
--- Requirements:
--- - Input is a table (array) of rows, where each row is a table (array) of field values.
--- - Field values are converted to strings using tostring().
--- - Fields are quoted if they contain the delimiter, newlines, or double quotes.
--- - Double quotes inside quoted fields are doubled ("").
--- - Fields are joined with the specified delimiter; rows are joined with newlines.
--- - If includeHeaders is true and rows have a Headers field, headers are included as the first row.
---
--- @param rows table Array of rows, where each row is an array of field values.
--- @param options ParserOptions? Options for the parser
--- @return string #CSV-formatted text
function toCSV(rows, options)
if options == nil then options = {} end
-- Validate options
areOptionsValid(options)
local delimiter = options.delimiter or parserDefaultOptions.delimiter
local includeHeaders = options.hasheader or parserDefaultOptions.hasheader
local rowStrings = {}
-- Include headers row if requested and available
if includeHeaders and #rows > 0 and rows.Headers ~= nil then
local headerStrings = {}
for _, header in ipairs(rows.Headers) do
local headerStr = tostring(header)
local needsQuoting = false
if
headerStr:find(delimiter)
or headerStr:find("\n")
or headerStr:find("\r")
or headerStr:find('"')
then
needsQuoting = true
end
if needsQuoting then
headerStr = headerStr:gsub('"', '""')
headerStr = '"' .. headerStr .. '"'
end
table.insert(headerStrings, headerStr)
end
table.insert(rowStrings, table.concat(headerStrings, delimiter))
end
for _, row in ipairs(rows) do
local fieldStrings = {}
for _, field in ipairs(row) do
local fieldStr = tostring(field)
local needsQuoting = false
if
fieldStr:find(delimiter)
or fieldStr:find("\n")
or fieldStr:find("\r")
or fieldStr:find('"')
then
needsQuoting = true
end
if needsQuoting then
fieldStr = fieldStr:gsub('"', '""')
fieldStr = '"' .. fieldStr .. '"'
end
table.insert(fieldStrings, fieldStr)
end
table.insert(rowStrings, table.concat(fieldStrings, delimiter))
end
return table.concat(rowStrings, "\n")
end
--- Converts string to number, returns 0 if invalid
--- @param str string String to convert
--- @return number Numeric value or 0
function num(str) return tonumber(str) or 0 end
--- Converts number to string
--- @param num number Number to convert
--- @return string String representation
function str(num) return tostring(num) end
--- Checks if string is numeric
--- @param str string String to check
--- @return boolean True if string is numeric
function is_number(str) return tonumber(str) ~= nil end
--- Checks if table is a sequential array (1-indexed with no gaps)
--- @param t table Table to check
--- @return boolean True if table is an array
function isArray(t)
if type(t) ~= "table" then return false end
local max = 0
local count = 0
for k, _ in pairs(t) do
if type(k) ~= "number" or k < 1 or math.floor(k) ~= k then return false end
max = math.max(max, k)
count = count + 1
end
return max == count
end
modified = false
-- ============================================================================
-- XML HELPER FUNCTIONS
-- ============================================================================
--- Find all elements with a specific tag name (recursive search)
--- @param root table The root XML element (with _tag, _attr, _children fields)
--- @param tagName string The tag name to search for
--- @return table Array of matching elements
function findElements(root, tagName)
local results = {}
local function search(element)
if element._tag == tagName then table.insert(results, element) end
if element._children then
for _, child in ipairs(element._children) do
search(child)
end
end
end
search(root)
return results
end
--- Visit all elements recursively and call a function on each
--- @param root table The root XML element
--- @param callback function Function to call with each element: callback(element, depth, path)
function visitElements(root, callback)
local function visit(element, depth, path)
callback(element, depth, path)
if element._children then
for i, child in ipairs(element._children) do
local childPath = path .. "/" .. child._tag .. "[" .. i .. "]"
visit(child, depth + 1, childPath)
end
end
end
visit(root, 0, "/" .. root._tag)
end
--- Get numeric value from XML element attribute
--- @param element table XML element with _attr field
--- @param attrName string Attribute name
--- @return number|nil The numeric value or nil if not found/not numeric
function getNumAttr(element, attrName)
if not element._attr then return nil end
local value = element._attr[attrName]
if not value then return nil end
return tonumber(value)
end
--- Set numeric value to XML element attribute
--- @param element table XML element with _attr field
--- @param attrName string Attribute name
--- @param value number Numeric value to set
function setNumAttr(element, attrName, value)
if not element._attr then element._attr = {} end
element._attr[attrName] = tostring(value)
end
--- Modify numeric attribute by applying a function
--- @param element table XML element
--- @param attrName string Attribute name
--- @param func function Function that takes current value and returns new value
--- @return boolean True if modification was made
function modifyNumAttr(element, attrName, func)
local current = getNumAttr(element, attrName)
if current then
setNumAttr(element, attrName, func(current))
return true
end
return false
end
--- Find all elements matching a predicate function
--- @param root table The root XML element
--- @param predicate function Function that takes element and returns true/false
--- @return table Array of matching elements
function filterElements(root, predicate)
local results = {}
visitElements(root, function(element)
if predicate(element) then table.insert(results, element) end
end)
return results
end
--- Get text content of an element
--- @param element table XML element
--- @return string|nil The text content or nil
function getText(element) return element._text end
--- Set text content of an element
--- @param element table XML element
--- @param text string Text content to set
function setText(element, text) element._text = text end
--- Check if element has an attribute
--- @param element table XML element
--- @param attrName string Attribute name
--- @return boolean True if attribute exists
function hasAttr(element, attrName) return element._attr and element._attr[attrName] ~= nil end
--- Get attribute value as string
--- @param element table XML element
--- @param attrName string Attribute name
--- @return string|nil The attribute value or nil
function getAttr(element, attrName)
if not element._attr then return nil end
return element._attr[attrName]
end
--- Set attribute value
--- @param element table XML element
--- @param attrName string Attribute name
--- @param value any Value to set (will be converted to string)
function setAttr(element, attrName, value)
if not element._attr then element._attr = {} end
element._attr[attrName] = tostring(value)
end
--- Find first element with a specific tag name (searches direct children only)
--- @param parent table The parent XML element
--- @param tagName string The tag name to search for
--- @return table|nil The first matching element or nil
function findFirstElement(parent, tagName)
if not parent._children then return nil end
for _, child in ipairs(parent._children) do
if child._tag == tagName then return child end
end
return nil
end
--- Add a child element to a parent
--- @param parent table The parent XML element
--- @param child table The child element to add
function addChild(parent, child)
if not parent._children then parent._children = {} end
table.insert(parent._children, child)
end
--- Remove all children with a specific tag name
--- @param parent table The parent XML element
--- @param tagName string The tag name to remove
--- @return number Count of removed children
function removeChildren(parent, tagName)
if not parent._children then return 0 end
local removed = 0
local i = 1
while i <= #parent._children do
if parent._children[i]._tag == tagName then
table.remove(parent._children, i)
removed = removed + 1
else
i = i + 1
end
end
return removed
end
--- Get all direct children with a specific tag name
--- @param parent table The parent XML element
--- @param tagName string The tag name to search for
--- @return table Array of matching children
function getChildren(parent, tagName)
local results = {}
if not parent._children then return results end
for _, child in ipairs(parent._children) do
if child._tag == tagName then table.insert(results, child) end
end
return results
end
--- Count children with a specific tag name
--- @param parent table The parent XML element
--- @param tagName string The tag name to count
--- @return number Count of matching children
function countChildren(parent, tagName)
if not parent._children then return 0 end
local count = 0
for _, child in ipairs(parent._children) do
if child._tag == tagName then count = count + 1 end
end
return count
end
-- ============================================================================
-- JSON HELPER FUNCTIONS
-- ============================================================================
--- Recursively visit all values in a JSON structure
--- @param data table JSON data (nested tables)
--- @param callback function Function called with (value, key, parent)
function visitJSON(data, callback)
local function visit(obj, key, parent)
callback(obj, key, parent)
if type(obj) == "table" then
for k, v in pairs(obj) do
visit(v, k, obj)
end
end
end
visit(data, nil, nil)
end
--- Find all values in JSON matching a predicate
--- @param data table JSON data
--- @param predicate function Function that takes (value, key, parent) and returns true/false
--- @return table Array of matching values
function findInJSON(data, predicate)
local results = {}
visitJSON(data, function(value, key, parent)
if predicate(value, key, parent) then table.insert(results, value) end
end)
return results
end
--- Modify all numeric values in JSON matching a condition
--- @param data table JSON data
--- @param predicate function Function that takes (value, key, parent) and returns true/false
--- @param modifier function Function that takes current value and returns new value
function modifyJSONNumbers(data, predicate, modifier)
visitJSON(data, function(value, key, parent)
if type(value) == "number" and predicate(value, key, parent) then
if parent and key then parent[key] = modifier(value) end
end
end)
end

29
processor/meta.go Normal file
View File

@@ -0,0 +1,29 @@
package processor
import (
_ "embed"
"fmt"
"os"
logger "git.site.quack-lab.dev/dave/cylogger"
)
//go:embed meta.lua
var metaFileContent string
var metaLogger = logger.Default.WithPrefix("meta")
// GenerateMetaFile generates meta.lua with function signatures for LuaLS autocomplete
func GenerateMetaFile(outputPath string) error {
metaLogger.Info("Generating meta.lua file for LuaLS autocomplete")
// Write the embedded meta file
err := os.WriteFile(outputPath, []byte(metaFileContent), 0644)
if err != nil {
metaLogger.Error("Failed to write meta.lua: %v", err)
return fmt.Errorf("failed to write meta.lua: %w", err)
}
metaLogger.Info("Successfully generated meta.lua at %q", outputPath)
return nil
}

245
processor/meta.lua Normal file
View File

@@ -0,0 +1,245 @@
---@meta
---@class ParserOptions
---@field delimiter string? The field delimiter (default: ",").
---@field hasheader boolean? If true, first non-comment row is treated as headers (default: false).
---@field hascomments boolean? If true, lines starting with '#' are skipped (default: false).
---@class XMLElement
---@field _tag string The XML tag name
---@field _attr {[string]: string}? XML attributes as key-value pairs
---@field _text string? Text content of the element
---@field _children XMLElement[]? Child elements
---@class JSONNode
---@field [string] string | number | boolean | nil | JSONNode | JSONArray JSON object fields
---@alias JSONArray (string | number | boolean | nil | JSONNode)[]
---@class CSVRow
---@field [integer] string Numeric indices for field access
---@field Headers string[]? Header row if hasheader was true
--- Returns the minimum of two numbers
---@param a number First number
---@param b number Second number
---@return number #Minimum value
function min(a, b) end
--- Returns the maximum of two numbers
---@param a number First number
---@param b number Second number
---@return number #Maximum value
function max(a, b) end
--- Rounds a number to n decimal places
---@param x number Number to round
---@param n number? Number of decimal places (default: 0)
---@return number #Rounded number
function round(x, n) end
--- Returns the floor of a number
---@param x number Number to floor
---@return number #Floored number
function floor(x) end
--- Returns the ceiling of a number
---@param x number Number to ceil
---@return number #Ceiled number
function ceil(x) end
--- Converts string to uppercase
---@param s string String to convert
---@return string #Uppercase string
function upper(s) end
--- Converts string to lowercase
---@param s string String to convert
---@return string #Lowercase string
function lower(s) end
--- Formats a string using Lua string.format
---@param s string Format string
---@param ... any Values to format
---@return string #Formatted string
function format(s, ...) end
--- Removes leading and trailing whitespace from string
---@param s string String to trim
---@return string #Trimmed string
function trim(s) end
--- Splits a string by separator
---@param inputstr string String to split
---@param sep string? Separator pattern (default: whitespace)
---@return string[] #Array of string parts
function strsplit(inputstr, sep) end
--- Prints table structure recursively
---@param table {[any]: any} Table to dump
---@param depth number? Current depth (default: 0)
function dump(table, depth) end
--- Validates options against a set of valid option keys.
---@param options ParserOptions? The options table to validate
function areOptionsValid(options) end
--- Parses CSV text into rows and fields using a minimal RFC 4180 state machine.
--- Requirements/assumptions:<br>
--- Input is a single string containing the entire CSV content.<br>
--- Field separators are specified by delimiter option (default: comma).<br>
--- Newlines between rows may be "\n" or "\r\n". "\r\n" is treated as one line break.<br>
--- Fields may be quoted with double quotes (").<br>
--- Inside quoted fields, doubled quotes ("") represent a literal quote character.<br>
--- No backslash escaping is supported (not part of RFC 4180).<br>
--- Newlines inside quoted fields are preserved as part of the field.<br>
--- Leading/trailing spaces are preserved; no trimming is performed.<br>
--- Empty fields and empty rows are preserved.<br>
--- The final row is emitted even if the text does not end with a newline.<br>
--- Lines starting with '#' (after optional leading whitespace) are treated as comments and skipped if hascomments is true.<br>
---@param csv string The CSV text to parse.
---@param options ParserOptions? Options for the parser
---@return CSVRow[] #A table (array) of rows; each row is a table with numeric indices and optionally header-named keys.
function fromCSV(csv, options) end
--- Converts a table of rows back to CSV text format (RFC 4180 compliant).<br>
--- Requirements:<br>
--- Input is a table (array) of rows, where each row is a table (array) of field values.<br>
--- Field values are converted to strings using tostring().<br>
--- Fields are quoted if they contain the delimiter, newlines, or double quotes.<br>
--- Double quotes inside quoted fields are doubled ("").<br>
--- Fields are joined with the specified delimiter; rows are joined with newlines.<br>
--- If includeHeaders is true and rows have a Headers field, headers are included as the first row.<br>
---@param rows CSVRow[] Array of rows, where each row is an array of field values.
---@param options ParserOptions? Options for the parser
---@return string #CSV-formatted text
function toCSV(rows, options) end
--- Converts string to number, returns 0 if invalid
---@param str string String to convert
---@return number #Numeric value or 0
function num(str) end
--- Converts number to string
---@param num number Number to convert
---@return string #String representation
function str(num) end
--- Checks if string is numeric
---@param str string String to check
---@return boolean #True if string is numeric
function is_number(str) end
--- Checks if table is a sequential array (1-indexed with no gaps)
---@param t {[integer]: any} Table to check
---@return boolean #True if table is an array
function isArray(t) end
--- Find all elements with a specific tag name (recursive search)
---@param root XMLElement The root XML element (with _tag, _attr, _children fields)
---@param tagName string The tag name to search for
---@return XMLElement[] #Array of matching elements
function findElements(root, tagName) end
--- Visit all elements recursively and call a function on each
---@param root XMLElement The root XML element
---@param callback fun(element: XMLElement, depth: number, path: string) Function to call with each element
function visitElements(root, callback) end
--- Get numeric value from XML element attribute
---@param element XMLElement XML element with _attr field
---@param attrName string Attribute name
---@return number? #The numeric value or nil if not found/not numeric
function getNumAttr(element, attrName) end
--- Set numeric value to XML element attribute
---@param element XMLElement XML element with _attr field
---@param attrName string Attribute name
---@param value number Numeric value to set
function setNumAttr(element, attrName, value) end
--- Modify numeric attribute by applying a function
---@param element XMLElement XML element
---@param attrName string Attribute name
---@param func fun(currentValue: number): number Function that takes current value and returns new value
---@return boolean #True if modification was made
function modifyNumAttr(element, attrName, func) end
--- Find all elements matching a predicate function
---@param root XMLElement The root XML element
---@param predicate fun(element: XMLElement): boolean Function that takes element and returns true/false
---@return XMLElement[] #Array of matching elements
function filterElements(root, predicate) end
--- Get text content of an element
---@param element XMLElement XML element
---@return string? #The text content or nil
function getText(element) end
--- Set text content of an element
---@param element XMLElement XML element
---@param text string Text content to set
function setText(element, text) end
--- Check if element has an attribute
---@param element XMLElement XML element
---@param attrName string Attribute name
---@return boolean #True if attribute exists
function hasAttr(element, attrName) end
--- Get attribute value as string
---@param element XMLElement XML element
---@param attrName string Attribute name
---@return string? #The attribute value or nil
function getAttr(element, attrName) end
--- Set attribute value
---@param element XMLElement XML element
---@param attrName string Attribute name
---@param value string | number | boolean Value to set (will be converted to string)
function setAttr(element, attrName, value) end
--- Find first element with a specific tag name (searches direct children only)
---@param parent XMLElement The parent XML element
---@param tagName string The tag name to search for
---@return XMLElement? #The first matching element or nil
function findFirstElement(parent, tagName) end
--- Add a child element to a parent
---@param parent XMLElement The parent XML element
---@param child XMLElement The child element to add
function addChild(parent, child) end
--- Remove all children with a specific tag name
---@param parent XMLElement The parent XML element
---@param tagName string The tag name to remove
---@return number #Count of removed children
function removeChildren(parent, tagName) end
--- Get all direct children with a specific tag name
---@param parent XMLElement The parent XML element
---@param tagName string The tag name to search for
---@return XMLElement[] #Array of matching children
function getChildren(parent, tagName) end
--- Count children with a specific tag name
---@param parent XMLElement The parent XML element
---@param tagName string The tag name to count
---@return number #Count of matching children
function countChildren(parent, tagName) end
--- Recursively visit all values in a JSON structure
---@param data JSONNode | JSONArray JSON data (nested tables)
---@param callback fun(value: string | number | boolean | nil | JSONNode | JSONArray, key: string?, parent: JSONNode?): nil Function called with (value, key, parent)
function visitJSON(data, callback) end
--- Find all values in JSON matching a predicate
---@param data JSONNode | JSONArray JSON data
---@param predicate fun(value: string | number | boolean | nil | JSONNode | JSONArray, key: string?, parent: JSONNode?): boolean Function that takes (value, key, parent) and returns true/false
---@return (string | number | boolean | nil | JSONNode | JSONArray)[] #Array of matching values
function findInJSON(data, predicate) end
--- Modify all numeric values in JSON matching a condition
---@param data JSONNode | JSONArray JSON data
---@param predicate fun(value: string | number | boolean | nil | JSONNode | JSONArray, key: string?, parent: JSONNode?): boolean Function that takes (value, key, parent) and returns true/false
---@param modifier fun(currentValue: number): number Function that takes current value and returns new value
function modifyJSONNumbers(data, predicate, modifier) end

View File

@@ -1,262 +1,188 @@
package processor
import (
_ "embed"
"fmt"
"log"
"io"
"net/http"
"os"
"path/filepath"
"regexp"
"strings"
"github.com/antchfx/xmlquery"
"cook/utils"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua"
)
// Processor defines the interface for all file processors
type Processor interface {
// Process handles processing a file with the given pattern and Lua expression
// Now implemented as a base function in processor.go
// Process(filename string, pattern string, luaExpr string) (int, int, error)
//go:embed luahelper.lua
var helperScript string
// ProcessContent handles processing a string content directly with the given pattern and Lua expression
// Returns the modified content, modification count, match count, and any error
ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error)
// processorLogger is a scoped logger for the processor package.
var processorLogger = logger.Default.WithPrefix("processor")
// ToLua converts processor-specific data to Lua variables
ToLua(L *lua.LState, data interface{}) error
// Maybe we make this an interface again for the shits and giggles
// We will see, it could easily be...
// FromLua retrieves modified data from Lua
FromLua(L *lua.LState) (interface{}, error)
}
var globalVariables = map[string]interface{}{}
// ModificationRecord tracks a single value modification
type ModificationRecord struct {
File string
OldValue string
NewValue string
Operation string
Context string
func SetVariables(vars map[string]interface{}) {
for k, v := range vars {
globalVariables[k] = v
}
}
func NewLuaState() (*lua.LState, error) {
newLStateLogger := processorLogger.WithPrefix("NewLuaState")
newLStateLogger.Debug("Creating new Lua state")
L := lua.NewState()
// defer L.Close()
// Load math library
newLStateLogger.Debug("Loading Lua math library")
L.Push(L.GetGlobal("require"))
L.Push(lua.LString("math"))
if err := L.PCall(1, 1, nil); err != nil {
newLStateLogger.Error("Failed to load Lua math library: %v", err)
return nil, fmt.Errorf("error loading Lua math library: %v", err)
}
newLStateLogger.Debug("Lua math library loaded")
// Initialize helper functions
newLStateLogger.Debug("Initializing Lua helper functions")
if err := InitLuaHelpers(L); err != nil {
newLStateLogger.Error("Failed to initialize Lua helper functions: %v", err)
return nil, err
}
newLStateLogger.Debug("Lua helper functions initialized")
// Inject global variables
if len(globalVariables) > 0 {
newLStateLogger.Debug("Injecting %d global variables into Lua state", len(globalVariables))
for k, v := range globalVariables {
switch val := v.(type) {
case int:
L.SetGlobal(k, lua.LNumber(float64(val)))
case int64:
L.SetGlobal(k, lua.LNumber(float64(val)))
case float32:
L.SetGlobal(k, lua.LNumber(float64(val)))
case float64:
L.SetGlobal(k, lua.LNumber(val))
case string:
L.SetGlobal(k, lua.LString(val))
case bool:
if val {
L.SetGlobal(k, lua.LTrue)
} else {
L.SetGlobal(k, lua.LFalse)
}
default:
// Fallback to string representation
L.SetGlobal(k, lua.LString(fmt.Sprintf("%v", val)))
}
}
}
newLStateLogger.Debug("New Lua state created successfully")
return L, nil
}
func Process(p Processor, filename string, pattern string, luaExpr string) (int, int, error) {
// Read file content
cwd, err := os.Getwd()
if err != nil {
return 0, 0, fmt.Errorf("error getting current working directory: %v", err)
}
fullPath := filepath.Join(cwd, filename)
content, err := os.ReadFile(fullPath)
if err != nil {
return 0, 0, fmt.Errorf("error reading file: %v", err)
}
fileContent := string(content)
// Process the content
modifiedContent, modCount, matchCount, err := p.ProcessContent(fileContent, pattern, luaExpr)
if err != nil {
return 0, 0, err
}
// If we made modifications, save the file
if modCount > 0 {
err = os.WriteFile(fullPath, []byte(modifiedContent), 0644)
if err != nil {
return 0, 0, fmt.Errorf("error writing file: %v", err)
}
}
return modCount, matchCount, nil
}
// ToLua converts a struct or map to a Lua table recursively
func ToLua(L *lua.LState, data interface{}) (lua.LValue, error) {
switch v := data.(type) {
case *xmlquery.Node:
luaTable := L.NewTable()
luaTable.RawSetString("text", lua.LString(v.Data))
// Should be a map, simple key value pairs
attr, err := ToLua(L, v.Attr)
if err != nil {
return nil, err
}
luaTable.RawSetString("attr", attr)
return luaTable, nil
case map[string]interface{}:
luaTable := L.NewTable()
for key, value := range v {
luaValue, err := ToLua(L, value)
if err != nil {
return nil, err
}
luaTable.RawSetString(key, luaValue)
}
return luaTable, nil
case []interface{}:
luaTable := L.NewTable()
for i, value := range v {
luaValue, err := ToLua(L, value)
if err != nil {
return nil, err
}
luaTable.RawSetInt(i+1, luaValue) // Lua arrays are 1-indexed
}
return luaTable, nil
case string:
return lua.LString(v), nil
case bool:
return lua.LBool(v), nil
case float64:
return lua.LNumber(v), nil
case nil:
return lua.LNil, nil
default:
return nil, fmt.Errorf("unsupported data type: %T", data)
}
}
// FromLua converts a Lua table to a struct or map recursively
func FromLua(L *lua.LState, luaValue lua.LValue) (interface{}, error) {
fromLuaLogger := processorLogger.WithPrefix("FromLua").WithField("luaType", luaValue.Type().String())
fromLuaLogger.Debug("Converting Lua value to Go interface")
switch v := luaValue.(type) {
// Well shit...
// Tables in lua are both maps and arrays
// As arrays they are ordered and as maps, obviously, not
// So when we parse them to a go map we fuck up the order for arrays
// We have to find a better way....
case *lua.LTable:
fromLuaLogger.Debug("Processing Lua table")
isArray, err := IsLuaTableArray(L, v)
if err != nil {
fromLuaLogger.Error("Failed to determine if Lua table is array: %v", err)
return nil, err
}
fromLuaLogger.Debug("Lua table is array: %t", isArray)
if isArray {
fromLuaLogger.Debug("Converting Lua table to Go array")
result := make([]interface{}, 0)
v.ForEach(func(key lua.LValue, value lua.LValue) {
converted, _ := FromLua(L, value)
result = append(result, converted)
})
fromLuaLogger.Trace("Converted Go array: %v", result)
return result, nil
} else {
fromLuaLogger.Debug("Converting Lua table to Go map")
result := make(map[string]interface{})
v.ForEach(func(key lua.LValue, value lua.LValue) {
converted, _ := FromLua(L, value)
result[key.String()] = converted
})
fromLuaLogger.Trace("Converted Go map: %v", result)
return result, nil
}
case lua.LString:
fromLuaLogger.Debug("Converting Lua string to Go string")
fromLuaLogger.Trace("Lua string: %q", string(v))
return string(v), nil
case lua.LBool:
fromLuaLogger.Debug("Converting Lua boolean to Go boolean")
fromLuaLogger.Trace("Lua boolean: %t", bool(v))
return bool(v), nil
case lua.LNumber:
fromLuaLogger.Debug("Converting Lua number to Go float64")
fromLuaLogger.Trace("Lua number: %f", float64(v))
return float64(v), nil
default:
fromLuaLogger.Debug("Unsupported Lua type, returning nil")
return nil, nil
}
}
func IsLuaTableArray(L *lua.LState, v *lua.LTable) (bool, error) {
isLuaTableArrayLogger := processorLogger.WithPrefix("IsLuaTableArray")
isLuaTableArrayLogger.Debug("Checking if Lua table is an array")
isLuaTableArrayLogger.Trace("Lua table input: %v", v)
L.SetGlobal("table_to_check", v)
// Use our predefined helper function from InitLuaHelpers
err := L.DoString(`is_array = isArray(table_to_check)`)
if err != nil {
isLuaTableArrayLogger.Error("Error determining if table is an array: %v", err)
return false, fmt.Errorf("error determining if table is array: %w", err)
}
// Check the result of our Lua function
isArray := L.GetGlobal("is_array")
// LVIsFalse returns true if a given LValue is a nil or false otherwise false.
if !lua.LVIsFalse(isArray) {
return true, nil
}
return false, nil
result := !lua.LVIsFalse(isArray)
isLuaTableArrayLogger.Debug("Lua table is array: %t", result)
isLuaTableArrayLogger.Trace("isArray result Lua value: %v", isArray)
return result, nil
}
// InitLuaHelpers initializes common Lua helper functions
func InitLuaHelpers(L *lua.LState) error {
helperScript := `
-- Custom Lua helpers for math operations
function min(a, b) return math.min(a, b) end
function max(a, b) return math.max(a, b) end
function round(x, n)
if n == nil then n = 0 end
return math.floor(x * 10^n + 0.5) / 10^n
end
function floor(x) return math.floor(x) end
function ceil(x) return math.ceil(x) end
function upper(s) return string.upper(s) end
function lower(s) return string.lower(s) end
initLuaHelpersLogger := processorLogger.WithPrefix("InitLuaHelpers")
initLuaHelpersLogger.Debug("Loading Lua helper functions")
-- String to number conversion helper
function num(str)
return tonumber(str) or 0
end
-- Number to string conversion
function str(num)
return tostring(num)
end
-- Check if string is numeric
function is_number(str)
return tonumber(str) ~= nil
end
function isArray(t)
if type(t) ~= "table" then return false end
local max = 0
local count = 0
for k, _ in pairs(t) do
if type(k) ~= "number" or k < 1 or math.floor(k) ~= k then
return false
end
max = math.max(max, k)
count = count + 1
end
return max == count
end
modified = false
`
if err := L.DoString(helperScript); err != nil {
initLuaHelpersLogger.Error("Failed to load Lua helper functions: %v", err)
return fmt.Errorf("error loading helper functions: %v", err)
}
initLuaHelpersLogger.Debug("Lua helper functions loaded")
initLuaHelpersLogger.Debug("Setting up Lua print function to Go")
L.SetGlobal("print", L.NewFunction(printToGo))
L.SetGlobal("fetch", L.NewFunction(fetch))
L.SetGlobal("re", L.NewFunction(EvalRegex))
initLuaHelpersLogger.Debug("Lua print and fetch functions bound to Go")
return nil
}
// Helper utility functions
// LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string {
s = strings.ReplaceAll(s, "\n", "\\n")
if len(s) <= maxLen {
return s
}
return s[:maxLen-3] + "..."
}
func PrependLuaAssignment(luaExpr string) string {
prependLuaAssignmentLogger := processorLogger.WithPrefix("PrependLuaAssignment").WithField("originalLuaExpr", luaExpr)
prependLuaAssignmentLogger.Debug("Prepending Lua assignment if necessary")
// Auto-prepend v1 for expressions starting with operators
if strings.HasPrefix(luaExpr, "*") ||
strings.HasPrefix(luaExpr, "/") ||
@@ -265,28 +191,83 @@ func PrependLuaAssignment(luaExpr string) string {
strings.HasPrefix(luaExpr, "^") ||
strings.HasPrefix(luaExpr, "%") {
luaExpr = "v1 = v1" + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1 = v1' due to operator prefix")
} else if strings.HasPrefix(luaExpr, "=") {
// Handle direct assignment with = operator
luaExpr = "v1 " + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1' due to direct assignment operator")
}
// Add assignment if needed
if !strings.Contains(luaExpr, "=") {
luaExpr = "v1 = " + luaExpr
prependLuaAssignmentLogger.Debug("Prepended 'v1 =' as no assignment was found")
}
prependLuaAssignmentLogger.Trace("Final Lua expression after prepending: %q", luaExpr)
return luaExpr
}
// LoadExternalLuaFile loads Lua code from an external file
func LoadExternalLuaFile(luaPath string, sourceDir string) (string, error) {
loadLuaLogger := processorLogger.WithPrefix("LoadExternalLuaFile").WithField("luaPath", luaPath).WithField("sourceDir", sourceDir)
loadLuaLogger.Debug("Loading external Lua file")
// Resolve path: if relative, resolve relative to sourceDir; if absolute, use as-is
var resolvedPath string
if filepath.IsAbs(luaPath) {
resolvedPath = luaPath
} else {
if sourceDir == "" {
// No source directory, use current working directory
cwd, err := os.Getwd()
if err != nil {
loadLuaLogger.Error("Failed to get current working directory: %v", err)
return "", fmt.Errorf("failed to get current working directory: %w", err)
}
resolvedPath = filepath.Join(cwd, luaPath)
} else {
resolvedPath = filepath.Join(sourceDir, luaPath)
}
}
// Normalize path
resolvedPath = filepath.Clean(resolvedPath)
loadLuaLogger.Debug("Resolved Lua file path: %q", resolvedPath)
// Read the file
content, err := os.ReadFile(resolvedPath)
if err != nil {
loadLuaLogger.Error("Failed to read Lua file %q: %v", resolvedPath, err)
return "", fmt.Errorf("failed to read Lua file %q: %w", luaPath, err)
}
loadLuaLogger.Debug("Successfully loaded %d bytes from Lua file %q", len(content), resolvedPath)
return string(content), nil
}
// BuildLuaScript prepares a Lua expression from shorthand notation
func BuildLuaScript(luaExpr string) string {
func BuildLuaScript(luaExpr string, sourceDir string) string {
buildLuaScriptLogger := processorLogger.WithPrefix("BuildLuaScript").WithField("inputLuaExpr", luaExpr)
buildLuaScriptLogger.Debug("Building full Lua script from expression")
// Check if this is an external Lua file reference
if strings.HasPrefix(luaExpr, "@") {
luaPath := strings.TrimPrefix(luaExpr, "@")
externalLua, err := LoadExternalLuaFile(luaPath, sourceDir)
if err != nil {
buildLuaScriptLogger.Error("Failed to load external Lua file: %v", err)
// Return error script that will fail at runtime
return fmt.Sprintf(`error("Failed to load external Lua file: %v")`, err)
}
luaExpr = externalLua
buildLuaScriptLogger.Debug("Loaded external Lua file, %d characters", len(luaExpr))
}
// Perform $var substitutions from globalVariables
luaExpr = replaceVariables(luaExpr)
luaExpr = PrependLuaAssignment(luaExpr)
// This allows the user to specify whether or not they modified a value
// If they do nothing we assume they did modify (no return at all)
// If they return before our return then they themselves specify what they did
// If nothing is returned lua assumes nil
// So we can say our value was modified if the return value is either nil or true
// If the return value is false then the user wants to keep the original
fullScript := fmt.Sprintf(`
function run()
%s
@@ -294,36 +275,334 @@ func BuildLuaScript(luaExpr string) string {
local res = run()
modified = res == nil or res
`, luaExpr)
buildLuaScriptLogger.Trace("Generated full Lua script: %q", utils.LimitString(fullScript, 200))
return fullScript
}
// BuildJSONLuaScript prepares a Lua expression for JSON mode
func BuildJSONLuaScript(luaExpr string, sourceDir string) string {
buildJSONLuaScriptLogger := processorLogger.WithPrefix("BuildJSONLuaScript").WithField("inputLuaExpr", luaExpr)
buildJSONLuaScriptLogger.Debug("Building full Lua script for JSON mode from expression")
// Check if this is an external Lua file reference
if strings.HasPrefix(luaExpr, "@") {
luaPath := strings.TrimPrefix(luaExpr, "@")
externalLua, err := LoadExternalLuaFile(luaPath, sourceDir)
if err != nil {
buildJSONLuaScriptLogger.Error("Failed to load external Lua file: %v", err)
// Return error script that will fail at runtime
return fmt.Sprintf(`error("Failed to load external Lua file: %v")`, err)
}
luaExpr = externalLua
buildJSONLuaScriptLogger.Debug("Loaded external Lua file, %d characters", len(luaExpr))
}
// Perform $var substitutions from globalVariables
luaExpr = replaceVariables(luaExpr)
fullScript := fmt.Sprintf(`
function run()
%s
end
local res = run()
modified = res == nil or res
`, luaExpr)
buildJSONLuaScriptLogger.Trace("Generated full JSON Lua script: %q", utils.LimitString(fullScript, 200))
return fullScript
}
func replaceVariables(expr string) string {
// $varName -> literal value
varNameRe := regexp.MustCompile(`\$(\w+)`)
return varNameRe.ReplaceAllStringFunc(expr, func(m string) string {
name := varNameRe.FindStringSubmatch(m)[1]
if v, ok := globalVariables[name]; ok {
switch val := v.(type) {
case int, int64, float32, float64:
return fmt.Sprintf("%v", val)
case bool:
if val {
return "true"
} else {
return "false"
}
case string:
// Quote strings for Lua literal
return fmt.Sprintf("%q", val)
default:
return fmt.Sprintf("%q", fmt.Sprintf("%v", val))
}
}
return m
})
}
func printToGo(L *lua.LState) int {
// Get the number of arguments passed to the Lua print function
n := L.GetTop()
// Create a slice to hold the arguments
args := make([]interface{}, n)
for i := 1; i <= n; i++ {
args[i-1] = L.Get(i) // Get the argument from Lua stack
printToGoLogger := processorLogger.WithPrefix("printToGo")
printToGoLogger.Debug("Lua print function called, redirecting to Go logger")
top := L.GetTop()
args := make([]interface{}, top)
for i := 1; i <= top; i++ {
args[i-1] = L.Get(i)
}
// Print the arguments to Go's stdout
log.Print("Lua: ")
log.Println(args...)
return 0 // No return values
// Format the message with proper spacing between arguments
var parts []string
for _, arg := range args {
parts = append(parts, fmt.Sprintf("%v", arg))
}
message := strings.Join(parts, " ")
printToGoLogger.Trace("Lua print message: %q", message)
// Use the LUA log level with a script tag
logger.Lua("%s", message)
printToGoLogger.Debug("Message logged from Lua")
return 0
}
// Max returns the maximum of two integers
func Max(a, b int) int {
if a > b {
return a
func fetch(L *lua.LState) int {
fetchLogger := processorLogger.WithPrefix("fetch")
fetchLogger.Debug("Lua fetch function called")
// Get URL from first argument
url := L.ToString(1)
if url == "" {
fetchLogger.Error("Fetch failed: URL is required")
L.Push(lua.LNil)
L.Push(lua.LString("URL is required"))
return 2
}
return b
fetchLogger.Debug("Fetching URL: %q", url)
// Get options from second argument if provided
var method = "GET"
var headers = make(map[string]string)
var body = ""
if L.GetTop() > 1 {
options := L.ToTable(2)
if options != nil {
fetchLogger.Debug("Processing fetch options")
// Get method
if methodVal := options.RawGetString("method"); methodVal != lua.LNil {
method = methodVal.String()
fetchLogger.Trace("Method from options: %q", method)
}
// Get headers
if headersVal := options.RawGetString("headers"); headersVal != lua.LNil {
if headersTable, ok := headersVal.(*lua.LTable); ok {
fetchLogger.Trace("Processing headers table")
headersTable.ForEach(func(key lua.LValue, value lua.LValue) {
headers[key.String()] = value.String()
fetchLogger.Trace("Header: %q = %q", key.String(), value.String())
})
}
fetchLogger.Trace("All headers: %v", headers)
}
// Get body
if bodyVal := options.RawGetString("body"); bodyVal != lua.LNil {
body = bodyVal.String()
fetchLogger.Trace("Body from options: %q", utils.LimitString(body, 100))
}
}
}
fetchLogger.Debug("Fetch request details: Method=%q, URL=%q, BodyLength=%d, Headers=%v", method, url, len(body), headers)
// Create HTTP request
req, err := http.NewRequest(method, url, strings.NewReader(body))
if err != nil {
fetchLogger.Error("Error creating HTTP request: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error creating request: %v", err)))
return 2
}
// Set headers
for key, value := range headers {
req.Header.Set(key, value)
}
fetchLogger.Debug("HTTP request created and headers set")
fetchLogger.Trace("HTTP Request: %+v", req)
// Make request
client := &http.Client{}
resp, err := client.Do(req)
if err != nil {
fetchLogger.Error("Error making HTTP request: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error making request: %v", err)))
return 2
}
defer func() {
fetchLogger.Debug("Closing HTTP response body")
resp.Body.Close()
}()
fetchLogger.Debug("HTTP request executed. Status Code: %d", resp.StatusCode)
// Read response body
bodyBytes, err := io.ReadAll(resp.Body)
if err != nil {
fetchLogger.Error("Error reading response body: %v", err)
L.Push(lua.LNil)
L.Push(lua.LString(fmt.Sprintf("Error reading response: %v", err)))
return 2
}
fetchLogger.Trace("Response body length: %d", len(bodyBytes))
// Create response table
responseTable := L.NewTable()
responseTable.RawSetString("status", lua.LNumber(resp.StatusCode))
responseTable.RawSetString("statusText", lua.LString(resp.Status))
responseTable.RawSetString("ok", lua.LBool(resp.StatusCode >= 200 && resp.StatusCode < 300))
responseTable.RawSetString("body", lua.LString(string(bodyBytes)))
fetchLogger.Debug("Created Lua response table")
// Set headers in response
headersTable := L.NewTable()
for key, values := range resp.Header {
headersTable.RawSetString(key, lua.LString(values[0]))
fetchLogger.Trace("Response header: %q = %q", key, values[0])
}
responseTable.RawSetString("headers", headersTable)
fetchLogger.Trace("Full response table: %v", responseTable)
L.Push(responseTable)
fetchLogger.Debug("Pushed response table to Lua stack")
return 1
}
// Min returns the minimum of two integers
func Min(a, b int) int {
if a < b {
return a
func EvalRegex(L *lua.LState) int {
evalRegexLogger := processorLogger.WithPrefix("evalRegex")
evalRegexLogger.Debug("Lua evalRegex function called")
pattern := L.ToString(1)
input := L.ToString(2)
evalRegexLogger.Debug("Pattern: %q, Input: %q", pattern, input)
re := regexp.MustCompile(pattern)
matches := re.FindStringSubmatch(input)
evalRegexLogger.Debug("Go regex matches: %v (count: %d)", matches, len(matches))
evalRegexLogger.Debug("Matches is nil: %t", matches == nil)
if len(matches) > 0 {
matchesTable := L.NewTable()
for i, match := range matches {
matchesTable.RawSetInt(i+1, lua.LString(match))
evalRegexLogger.Debug("Set table[%d] = %q", i+1, match)
}
L.Push(matchesTable)
} else {
L.Push(lua.LNil)
}
return b
evalRegexLogger.Debug("Pushed matches table to Lua stack")
return 1
}
// GetLuaFunctionsHelp returns a comprehensive help string for all available Lua functions
func GetLuaFunctionsHelp() string {
return `Lua Functions Available in Global Environment:
MATH FUNCTIONS:
min(a, b) - Returns the minimum of two numbers
max(a, b) - Returns the maximum of two numbers
round(x, n) - Rounds x to n decimal places (default 0)
floor(x) - Returns the floor of x
ceil(x) - Returns the ceiling of x
STRING FUNCTIONS:
upper(s) - Converts string to uppercase
lower(s) - Converts string to lowercase
format(s, ...) - Formats string using Lua string.format
trim(s) - Removes leading/trailing whitespace
strsplit(inputstr, sep) - Splits string by separator (default: whitespace)
fromCSV(csv, options) - Parses CSV text into rows of fields
options: {delimiter=",", hasheader=false, hascomments=false}
toCSV(rows, options) - Converts table of rows to CSV text format
options: {delimiter=",", hasheader=false}
num(str) - Converts string to number (returns 0 if invalid)
str(num) - Converts number to string
is_number(str) - Returns true if string is numeric
TABLE FUNCTIONS:
dump(table, depth) - Prints table structure recursively
isArray(t) - Returns true if table is a sequential array
XML HELPER FUNCTIONS:
findElements(root, tagName) - Find all elements with specific tag name (recursive)
findFirstElement(parent, tagName) - Find first direct child with specific tag name
visitElements(root, callback) - Visit all elements recursively
callback(element, depth, path)
filterElements(root, predicate) - Find elements matching condition
predicate(element) returns true/false
getNumAttr(element, attrName) - Get numeric attribute value
setNumAttr(element, attrName, value) - Set numeric attribute value
modifyNumAttr(element, attrName, func)- Modify numeric attribute with function
func(currentValue) returns newValue
hasAttr(element, attrName) - Check if attribute exists
getAttr(element, attrName) - Get attribute value as string
setAttr(element, attrName, value) - Set attribute value
getText(element) - Get element text content
setText(element, text) - Set element text content
addChild(parent, child) - Add child element to parent
removeChildren(parent, tagName) - Remove all children with specific tag name
getChildren(parent, tagName) - Get all direct children with specific tag name
countChildren(parent, tagName) - Count direct children with specific tag name
JSON HELPER FUNCTIONS:
visitJSON(data, callback) - Visit all values in JSON structure
callback(value, key, parent)
findInJSON(data, predicate) - Find values matching condition
predicate(value, key, parent) returns true/false
modifyJSONNumbers(data, predicate, modifier) - Modify numeric values
predicate(value, key, parent) returns true/false
modifier(currentValue) returns newValue
HTTP FUNCTIONS:
fetch(url, options) - Makes HTTP request, returns response table
options: {method="GET", headers={}, body=""}
returns: {status, statusText, ok, body, headers}
REGEX FUNCTIONS:
re(pattern, input) - Applies regex pattern to input string
returns: table with matches (index 0 = full match, 1+ = groups)
UTILITY FUNCTIONS:
print(...) - Prints arguments to Go logger
EXAMPLES:
-- Math
round(3.14159, 2) -> 3.14
min(5, 3) -> 3
-- String
strsplit("a,b,c", ",") -> {"a", "b", "c"}
upper("hello") -> "HELLO"
num("123") -> 123
-- XML (where root is XML element with _tag, _attr, _children fields)
local items = findElements(root, "Item")
for _, item in ipairs(items) do
modifyNumAttr(item, "Weight", function(w) return w * 2 end)
end
-- JSON (where data is parsed JSON object)
visitJSON(data, function(value, key, parent)
if type(value) == "number" and key == "price" then
parent[key] = value * 1.5
end
end)
-- HTTP
local response = fetch("https://api.example.com/data")
if response.ok then
print(response.body)
end`
}

View File

@@ -0,0 +1,218 @@
package processor
import (
"net/http"
"net/http/httptest"
"testing"
"github.com/stretchr/testify/assert"
lua "github.com/yuin/gopher-lua"
)
// Test replaceVariables function
func TestReplaceVariables(t *testing.T) {
// Setup global variables
globalVariables = map[string]interface{}{
"multiplier": 2.5,
"prefix": "TEST_",
"enabled": true,
"disabled": false,
"count": 42,
}
defer func() {
globalVariables = make(map[string]interface{})
}()
tests := []struct {
name string
input string
expected string
}{
{
name: "Replace numeric variable",
input: "v1 * $multiplier",
expected: "v1 * 2.5",
},
{
name: "Replace string variable",
input: `s1 = $prefix .. "value"`,
expected: `s1 = "TEST_" .. "value"`,
},
{
name: "Replace boolean true",
input: "enabled = $enabled",
expected: "enabled = true",
},
{
name: "Replace boolean false",
input: "disabled = $disabled",
expected: "disabled = false",
},
{
name: "Replace integer",
input: "count = $count",
expected: "count = 42",
},
{
name: "Multiple replacements",
input: "$count * $multiplier",
expected: "42 * 2.5",
},
{
name: "No variables",
input: "v1 * 2",
expected: "v1 * 2",
},
{
name: "Undefined variable",
input: "v1 * $undefined",
expected: "v1 * $undefined",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result := replaceVariables(tt.input)
assert.Equal(t, tt.expected, result)
})
}
}
// Test SetVariables with all type cases
func TestSetVariablesAllTypes(t *testing.T) {
vars := map[string]interface{}{
"int_val": 42,
"int64_val": int64(100),
"float32_val": float32(3.14),
"float64_val": 2.718,
"bool_true": true,
"bool_false": false,
"string_val": "hello",
}
SetVariables(vars)
// Create Lua state to verify
L, err := NewLuaState()
assert.NoError(t, err)
defer L.Close()
// Verify int64
int64Val := L.GetGlobal("int64_val")
assert.Equal(t, lua.LTNumber, int64Val.Type())
assert.Equal(t, 100.0, float64(int64Val.(lua.LNumber)))
// Verify float32
float32Val := L.GetGlobal("float32_val")
assert.Equal(t, lua.LTNumber, float32Val.Type())
assert.InDelta(t, 3.14, float64(float32Val.(lua.LNumber)), 0.01)
// Verify bool true
boolTrue := L.GetGlobal("bool_true")
assert.Equal(t, lua.LTBool, boolTrue.Type())
assert.True(t, bool(boolTrue.(lua.LBool)))
// Verify bool false
boolFalse := L.GetGlobal("bool_false")
assert.Equal(t, lua.LTBool, boolFalse.Type())
assert.False(t, bool(boolFalse.(lua.LBool)))
// Verify string
stringVal := L.GetGlobal("string_val")
assert.Equal(t, lua.LTString, stringVal.Type())
assert.Equal(t, "hello", string(stringVal.(lua.LString)))
}
// Test HTTP fetch with test server
func TestFetchWithTestServer(t *testing.T) {
// Create test HTTP server
server := httptest.NewServer(http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) {
// Verify request
assert.Equal(t, "GET", r.Method)
// Send response
w.WriteHeader(http.StatusOK)
w.Write([]byte(`{"status": "success"}`))
}))
defer server.Close()
// Test fetch
L := lua.NewState()
defer L.Close()
L.SetGlobal("fetch", L.NewFunction(fetch))
script := `
response = fetch("` + server.URL + `")
assert(response ~= nil, "Expected response")
assert(response.ok == true, "Expected ok to be true")
assert(response.status == 200, "Expected status 200")
assert(response.body == '{"status": "success"}', "Expected correct body")
`
err := L.DoString(script)
assert.NoError(t, err)
}
func TestFetchWithTestServerPOST(t *testing.T) {
// Create test HTTP server
receivedBody := ""
server := httptest.NewServer(http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) {
assert.Equal(t, "POST", r.Method)
assert.Equal(t, "application/json", r.Header.Get("Content-Type"))
// Read body
buf := make([]byte, 1024)
n, _ := r.Body.Read(buf)
receivedBody = string(buf[:n])
w.WriteHeader(http.StatusCreated)
w.Write([]byte(`{"created": true}`))
}))
defer server.Close()
L := lua.NewState()
defer L.Close()
L.SetGlobal("fetch", L.NewFunction(fetch))
script := `
local opts = {
method = "POST",
headers = {["Content-Type"] = "application/json"},
body = '{"test": "data"}'
}
response = fetch("` + server.URL + `", opts)
assert(response ~= nil, "Expected response")
assert(response.ok == true, "Expected ok to be true")
assert(response.status == 201, "Expected status 201")
`
err := L.DoString(script)
assert.NoError(t, err)
assert.Equal(t, `{"test": "data"}`, receivedBody)
}
func TestFetchWithTestServer404(t *testing.T) {
// Create test HTTP server that returns 404
server := httptest.NewServer(http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) {
w.WriteHeader(http.StatusNotFound)
w.Write([]byte(`{"error": "not found"}`))
}))
defer server.Close()
L := lua.NewState()
defer L.Close()
L.SetGlobal("fetch", L.NewFunction(fetch))
script := `
response = fetch("` + server.URL + `")
assert(response ~= nil, "Expected response")
assert(response.ok == false, "Expected ok to be false for 404")
assert(response.status == 404, "Expected status 404")
`
err := L.DoString(script)
assert.NoError(t, err)
}

View File

@@ -0,0 +1,366 @@
package processor
import (
"testing"
"github.com/stretchr/testify/assert"
lua "github.com/yuin/gopher-lua"
)
func TestSetVariables(t *testing.T) {
// Test with various variable types
vars := map[string]interface{}{
"multiplier": 2.5,
"prefix": "TEST_",
"enabled": true,
"count": 42,
}
SetVariables(vars)
// Create a new Lua state to verify variables are set
L, err := NewLuaState()
assert.NoError(t, err)
defer L.Close()
// Verify the variables are accessible
multiplier := L.GetGlobal("multiplier")
assert.Equal(t, lua.LTNumber, multiplier.Type())
assert.Equal(t, 2.5, float64(multiplier.(lua.LNumber)))
prefix := L.GetGlobal("prefix")
assert.Equal(t, lua.LTString, prefix.Type())
assert.Equal(t, "TEST_", string(prefix.(lua.LString)))
enabled := L.GetGlobal("enabled")
assert.Equal(t, lua.LTBool, enabled.Type())
assert.True(t, bool(enabled.(lua.LBool)))
count := L.GetGlobal("count")
assert.Equal(t, lua.LTNumber, count.Type())
assert.Equal(t, 42.0, float64(count.(lua.LNumber)))
}
func TestSetVariablesEmpty(t *testing.T) {
// Test with empty map
vars := map[string]interface{}{}
SetVariables(vars)
// Should not panic
L, err := NewLuaState()
assert.NoError(t, err)
defer L.Close()
}
func TestSetVariablesNil(t *testing.T) {
// Test with nil map
SetVariables(nil)
// Should not panic
L, err := NewLuaState()
assert.NoError(t, err)
defer L.Close()
}
func TestGetLuaFunctionsHelp(t *testing.T) {
help := GetLuaFunctionsHelp()
// Verify help is not empty
assert.NotEmpty(t, help)
// Verify it contains documentation for key functions
assert.Contains(t, help, "MATH FUNCTIONS")
assert.Contains(t, help, "STRING FUNCTIONS")
assert.Contains(t, help, "TABLE FUNCTIONS")
assert.Contains(t, help, "XML HELPER FUNCTIONS")
assert.Contains(t, help, "JSON HELPER FUNCTIONS")
assert.Contains(t, help, "HTTP FUNCTIONS")
assert.Contains(t, help, "REGEX FUNCTIONS")
assert.Contains(t, help, "UTILITY FUNCTIONS")
assert.Contains(t, help, "EXAMPLES")
// Verify specific functions are documented
assert.Contains(t, help, "min(a, b)")
assert.Contains(t, help, "max(a, b)")
assert.Contains(t, help, "round(x, n)")
assert.Contains(t, help, "fetch(url, options)")
assert.Contains(t, help, "findElements(root, tagName)")
assert.Contains(t, help, "visitJSON(data, callback)")
assert.Contains(t, help, "re(pattern, input)")
assert.Contains(t, help, "print(...)")
}
func TestFetchFunction(t *testing.T) {
L := lua.NewState()
defer L.Close()
// Register the fetch function
L.SetGlobal("fetch", L.NewFunction(fetch))
// Test 1: Missing URL should return nil and error
err := L.DoString(`
result, err = fetch("")
assert(result == nil, "Expected nil result for empty URL")
assert(err ~= nil, "Expected error for empty URL")
`)
assert.NoError(t, err)
// Test 2: Invalid URL should return error
err = L.DoString(`
result, err = fetch("not-a-valid-url")
assert(result == nil, "Expected nil result for invalid URL")
assert(err ~= nil, "Expected error for invalid URL")
`)
assert.NoError(t, err)
}
func TestFetchFunctionWithOptions(t *testing.T) {
L := lua.NewState()
defer L.Close()
// Register the fetch function
L.SetGlobal("fetch", L.NewFunction(fetch))
// Test with options (should fail gracefully with invalid URL)
err := L.DoString(`
local opts = {
method = "POST",
headers = {["Content-Type"] = "application/json"},
body = '{"test": "data"}'
}
result, err = fetch("http://invalid-domain-that-does-not-exist.local", opts)
-- Should get error due to invalid domain
assert(result == nil, "Expected nil result for invalid domain")
assert(err ~= nil, "Expected error for invalid domain")
`)
assert.NoError(t, err)
}
func TestPrependLuaAssignment(t *testing.T) {
tests := []struct {
name string
input string
expected string
}{
{
name: "Simple assignment",
input: "10",
expected: "v1 = 10",
},
{
name: "Expression",
input: "v1 * 2",
expected: "v1 = v1 * 2",
},
{
name: "Assignment with equal sign",
input: "= 5",
expected: "v1 = 5",
},
{
name: "Complex expression",
input: "math.floor(v1 / 2)",
expected: "v1 = math.floor(v1 / 2)",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result := PrependLuaAssignment(tt.input)
assert.Equal(t, tt.expected, result)
})
}
}
func TestBuildJSONLuaScript(t *testing.T) {
tests := []struct {
name string
input string
contains []string
}{
{
name: "Simple JSON modification",
input: "data.value = data.value * 2; modified = true",
contains: []string{
"data.value = data.value * 2",
"modified = true",
},
},
{
name: "Complex JSON script",
input: "for i, item in ipairs(data.items) do item.price = item.price * 1.5 end; modified = true",
contains: []string{
"for i, item in ipairs(data.items)",
"modified = true",
},
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result := BuildJSONLuaScript(tt.input, "")
for _, substr := range tt.contains {
assert.Contains(t, result, substr)
}
})
}
}
func TestPrintToGo(t *testing.T) {
L := lua.NewState()
defer L.Close()
// Register the print function
L.SetGlobal("print", L.NewFunction(printToGo))
// Test printing various types
err := L.DoString(`
print("Hello, World!")
print(42)
print(true)
print(3.14)
`)
assert.NoError(t, err)
}
func TestEvalRegex(t *testing.T) {
L := lua.NewState()
defer L.Close()
// Register the regex function
L.SetGlobal("re", L.NewFunction(EvalRegex))
// Test 1: Simple match
err := L.DoString(`
matches = re("(\\d+)", "The answer is 42")
assert(matches ~= nil, "Expected matches")
assert(matches[1] == "42", "Expected full match to be 42")
assert(matches[2] == "42", "Expected capture group to be 42")
`)
assert.NoError(t, err)
// Test 2: No match
err = L.DoString(`
matches = re("(\\d+)", "No numbers here")
assert(matches == nil, "Expected nil for no match")
`)
assert.NoError(t, err)
// Test 3: Multiple capture groups
err = L.DoString(`
matches = re("(\\w+)\\s+(\\d+)", "item 123")
assert(matches ~= nil, "Expected matches")
assert(matches[1] == "item 123", "Expected full match")
assert(matches[2] == "item", "Expected first capture group")
assert(matches[3] == "123", "Expected second capture group")
`)
assert.NoError(t, err)
}
func TestEstimatePatternComplexity(t *testing.T) {
tests := []struct {
name string
pattern string
minExpected int
}{
{
name: "Simple literal",
pattern: "hello",
minExpected: 1,
},
{
name: "With capture group",
pattern: "(\\d+)",
minExpected: 2,
},
{
name: "Complex pattern",
pattern: "(?P<name>\\w+)\\s+(?P<value>\\d+\\.\\d+)",
minExpected: 3,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
complexity := estimatePatternComplexity(tt.pattern)
assert.GreaterOrEqual(t, complexity, tt.minExpected)
})
}
}
func TestParseNumeric(t *testing.T) {
tests := []struct {
name string
input string
expected float64
shouldOk bool
}{
{"Integer", "42", 42.0, true},
{"Float", "3.14", 3.14, true},
{"Negative", "-10", -10.0, true},
{"Invalid", "not a number", 0, false},
{"Empty", "", 0, false},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, ok := parseNumeric(tt.input)
assert.Equal(t, tt.shouldOk, ok)
if tt.shouldOk {
assert.Equal(t, tt.expected, result)
}
})
}
}
func TestFormatNumeric(t *testing.T) {
tests := []struct {
name string
input float64
expected string
}{
{"Integer value", 42.0, "42"},
{"Float value", 3.14, "3.14"},
{"Negative integer", -10.0, "-10"},
{"Negative float", -3.14, "-3.14"},
{"Zero", 0.0, "0"},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result := formatNumeric(tt.input)
assert.Equal(t, tt.expected, result)
})
}
}
func TestLuaHelperFunctionsDocumentation(t *testing.T) {
help := GetLuaFunctionsHelp()
// All main function categories should be documented
expectedCategories := []string{
"MATH FUNCTIONS",
"STRING FUNCTIONS",
"XML HELPER FUNCTIONS",
"JSON HELPER FUNCTIONS",
}
for _, category := range expectedCategories {
assert.Contains(t, help, category, "Help should contain category: %s", category)
}
// Verify some key functions are mentioned
keyFunctions := []string{
"findElements",
"visitElements",
"visitJSON",
"round",
"fetch",
}
for _, fn := range keyFunctions {
assert.Contains(t, help, fn, "Help should mention function: %s", fn)
}
}

147
processor/processor_test.go Normal file
View File

@@ -0,0 +1,147 @@
package processor_test
import (
"testing"
"github.com/stretchr/testify/assert"
lua "github.com/yuin/gopher-lua"
"cook/processor"
)
// Happy Path: Function correctly returns all regex capture groups as Lua table when given valid pattern and input.
func TestEvalRegex_CaptureGroupsReturned(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `(\w+)-(\d+)`
input := "test-42"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
result := processor.EvalRegex(L)
assert.Equal(t, 1, result, "Expected return value to be 1 (one value pushed to Lua stack)")
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
expected := []string{"test-42", "test", "42"}
for i, v := range expected {
val := tbl.RawGetInt(i + 1)
assert.Equal(t, lua.LString(v), val, "Expected index %d to be %q", i+1, v)
}
}
// Happy Path: Function returns nil when regex pattern does not match input string.
func TestEvalRegex_NoMatchReturnsNil(t *testing.T) {
L := lua.NewState()
defer L.Close()
L.Push(lua.LString(`(foo)(bar)`))
L.Push(lua.LString("no-match-here"))
result := processor.EvalRegex(L)
assert.Equal(t, 1, result, "Expected return value to be 1 (one value pushed to Lua stack)")
out := L.Get(-1)
// Should be nil when no matches found
assert.Equal(t, lua.LNil, out, "Expected nil when no matches found")
}
// Happy Path: Function handles patterns with no capture groups by returning the full match in the Lua table.
func TestEvalRegex_NoCaptureGroups(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `foo\d+`
input := "foo123"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
result := processor.EvalRegex(L)
assert.Equal(t, 1, result, "Expected return value to be 1 (one value pushed to Lua stack)")
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
fullMatch := tbl.RawGetInt(1)
assert.Equal(t, lua.LString("foo123"), fullMatch)
// There should be only the full match (index 1)
count := 0
tbl.ForEach(func(k, v lua.LValue) {
count++
})
assert.Equal(t, 1, count)
}
// Edge Case: Function handles invalid regex pattern by letting regexp.MustCompile panic (which is expected behavior)
func TestEvalRegex_InvalidPattern(t *testing.T) {
L := lua.NewState()
defer L.Close()
pattern := `([a-z` // invalid regex
L.Push(lua.LString(pattern))
L.Push(lua.LString("someinput"))
// This should panic due to invalid regex pattern
assert.Panics(t, func() {
processor.EvalRegex(L)
}, "Expected panic for invalid regex pattern")
}
// Edge Case: Function returns nil when input string is empty and pattern doesn't match.
func TestEvalRegex_EmptyInputString(t *testing.T) {
L := lua.NewState()
defer L.Close()
L.Push(lua.LString(`(foo)`))
L.Push(lua.LString(""))
result := processor.EvalRegex(L)
assert.Equal(t, 1, result, "Expected return value to be 1 (one value pushed to Lua stack)")
out := L.Get(-1)
// Should be nil when no matches found
assert.Equal(t, lua.LNil, out, "Expected nil when input is empty and pattern doesn't match")
}
// Edge Case: Function handles nil or missing arguments gracefully without causing a runtime panic.
func TestEvalRegex_MissingArguments(t *testing.T) {
L := lua.NewState()
defer L.Close()
defer func() {
if r := recover(); r != nil {
t.Errorf("Did not expect panic when arguments are missing, got: %v", r)
}
}()
// No arguments pushed at all
processor.EvalRegex(L)
// Should just not match anything or produce empty table, but must not panic
}
func TestEvalComplexRegex(t *testing.T) {
// Test complex regex pattern with multiple capture groups
L := lua.NewState()
defer L.Close()
pattern := `^((Bulk_)?(Pistol|Rifle).*?Round.*?)$`
input := "Pistol_Round"
L.Push(lua.LString(pattern))
L.Push(lua.LString(input))
processor.EvalRegex(L)
out := L.Get(-1)
tbl, ok := out.(*lua.LTable)
if !ok {
t.Fatalf("Expected Lua table, got %T", out)
}
// Pattern should match: ["Pistol_Round", "Pistol_Round", "", "Pistol"]
// This creates 4 elements in the matches array, not 1
expectedCount := 4
actualCount := 0
tbl.ForEach(func(k, v lua.LValue) {
actualCount++
})
assert.Equal(t, expectedCount, actualCount, "Expected %d matches for pattern %q with input %q", expectedCount, pattern, input)
}

View File

@@ -1,138 +1,107 @@
package processor
import (
"cook/utils"
"fmt"
"log"
"regexp"
"strconv"
"strings"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua"
)
// RegexProcessor implements the Processor interface using regex patterns
type RegexProcessor struct{}
// regexLogger is a scoped logger for the processor/regex package.
var regexLogger = logger.Default.WithPrefix("processor/regex")
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func (p *RegexProcessor) ToLua(L *lua.LState, data interface{}) error {
captures, ok := data.([]string)
if !ok {
return fmt.Errorf("expected []string for captures, got %T", data)
}
// Set variables for each capture group, starting from v1/s1 for the first capture
for i := 0; i < len(captures); i++ {
// Set string version (always available as s1, s2, etc.)
L.SetGlobal(fmt.Sprintf("s%d", i+1), lua.LString(captures[i]))
// Try to convert to number and set v1, v2, etc.
if val, err := strconv.ParseFloat(captures[i], 64); err == nil {
L.SetGlobal(fmt.Sprintf("v%d", i+1), lua.LNumber(val))
}
}
return nil
type CaptureGroup struct {
Name string
Value string
Updated string
Range [2]int
}
// FromLua implements the Processor interface for RegexProcessor
func (p *RegexProcessor) FromLua(L *lua.LState) (interface{}, error) {
// Get the modified values after Lua execution
modifications := make(map[int]string)
// ProcessRegex applies regex replacement with Lua processing.
// The filename here exists ONLY so we can pass it to the lua environment.
// It's not used for anything else.
func ProcessRegex(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
processRegexLogger := regexLogger.WithPrefix("ProcessRegex").WithField("commandName", command.Name).WithField("file", filename)
processRegexLogger.Debug("Starting regex processing for file")
processRegexLogger.Trace("Initial file content length: %d", len(content))
processRegexLogger.Trace("Command details: %+v", command)
// Check for modifications to v1-v12 and s1-s12
for i := 0; i < 12; i++ {
// Check both v and s variables to see if any were modified
vVarName := fmt.Sprintf("v%d", i+1)
sVarName := fmt.Sprintf("s%d", i+1)
var commands []utils.ReplaceCommand
// Start timing the regex processing
startTime := time.Now()
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
// We don't HAVE to do this multiple times for a pattern
// But it's quick enough for us to not care
pattern := resolveRegexPlaceholders(command.Regex)
processRegexLogger.Debug("Resolved regex placeholders. Pattern: %s", pattern)
// If our value is a number then it's very likely we want it to be a number
// And not a string
// If we do want it to be a string we will cast it into a string in lua
// wait that wouldn't work... Casting v to a string would not load it here
if vLuaVal.Type() == lua.LTNumber {
modifications[i] = vLuaVal.String()
continue
}
if sLuaVal.Type() == lua.LTString {
modifications[i] = sLuaVal.String()
continue
}
}
return modifications, nil
}
type NamedCapture struct {
Name string
Value string
Range [2]int
}
// ProcessContent applies regex replacement with Lua processing
func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr string) (string, int, int, error) {
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
log.Printf("Pattern modified to include (?s): %s", pattern)
}
pattern = strings.ReplaceAll(pattern, "!num", `"?(\d*\.?\d+)"?`)
pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
// !rep(pattern, count) repeats the pattern n times
// Inserting !any between each repetition
pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
parts := repPattern.FindStringSubmatch(match)
if len(parts) != 3 {
return match
}
repeatedPattern := parts[1]
count := parts[2]
repetitions, _ := strconv.Atoi(count)
return strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
})
// I'm not too happy about having to trim regex, we could have meaningful whitespace or newlines
// But it's a compromise that allows us to use | in yaml
// Otherwise we would have to escape every god damn pair of quotation marks
// And a bunch of other shit
pattern = strings.TrimSpace(pattern)
processRegexLogger.Debug("Trimmed regex pattern: %s", pattern)
patternCompileStart := time.Now()
compiledPattern, err := regexp.Compile(pattern)
if err != nil {
log.Printf("Error compiling pattern: %v", err)
return "", 0, 0, fmt.Errorf("error compiling pattern: %v", err)
processRegexLogger.Error("Error compiling pattern %q: %v", pattern, err)
return commands, fmt.Errorf("error compiling pattern: %v", err)
}
log.Printf("Compiled pattern successfully: %s", pattern)
processRegexLogger.Debug("Compiled pattern successfully in %v. Pattern: %s", time.Since(patternCompileStart), pattern)
previous := luaExpr
luaExpr = BuildLuaScript(luaExpr)
log.Printf("Changing Lua expression from: %s to: %s", previous, luaExpr)
// Initialize Lua environment
modificationCount := 0
// Same here, it's just string concatenation, it won't kill us
// More important is that we don't fuck up the command
// But we shouldn't be able to since it's passed by value
previousLuaExpr := command.Lua
luaExpr := BuildLuaScript(command.Lua, command.SourceDir)
processRegexLogger.Debug("Transformed Lua expression: %q → %q", previousLuaExpr, luaExpr)
processRegexLogger.Trace("Full Lua script: %q", utils.LimitString(luaExpr, 200))
// Process all regex matches
result := content
matchFindStart := time.Now()
indices := compiledPattern.FindAllStringSubmatchIndex(content, -1)
log.Printf("Found %d matches in the content", len(indices))
matchFindDuration := time.Since(matchFindStart)
processRegexLogger.Debug("Found %d matches in content of length %d (search took %v)",
len(indices), len(content), matchFindDuration)
processRegexLogger.Trace("Match indices: %v", indices)
// Log pattern complexity metrics
patternComplexity := estimatePatternComplexity(pattern)
processRegexLogger.Debug("Pattern complexity estimate: %d", patternComplexity)
if len(indices) == 0 {
processRegexLogger.Warning("No matches found for regex: %s", pattern)
processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
return commands, nil
}
// We walk backwards because we're replacing something with something else that might be longer
// And in the case it is longer than the original all indicces past that change will be fucked up
// By going backwards we fuck up all the indices to the end of the file that we don't care about
// Because there either aren't any (last match) or they're already modified (subsequent matches)
for i := len(indices) - 1; i >= 0; i-- {
for i, matchIndices := range indices {
matchLogger := processRegexLogger.WithField("matchNum", i+1)
matchLogger.Debug("Processing match %d of %d", i+1, len(indices))
matchLogger.Trace("Match indices: %v (match position %d-%d)", matchIndices, matchIndices[0], matchIndices[1])
L, err := NewLuaState()
if err != nil {
log.Printf("Error creating Lua state: %v", err)
return "", 0, 0, fmt.Errorf("error creating Lua state: %v", err)
matchLogger.Error("Error creating Lua state: %v", err)
return commands, fmt.Errorf("error creating Lua state: %v", err)
}
// Hmm... Maybe we don't want to defer this..
L.SetGlobal("file", lua.LString(filename))
// Hmm... Maybe we don't want to defer this..
// Maybe we want to close them every iteration
// We'll leave it as is for now
defer L.Close()
log.Printf("Lua state created successfully")
matchIndices := indices[i]
log.Printf("Processing match indices: %v", matchIndices)
matchLogger.Trace("Lua state created successfully for match %d", i+1)
// Why we're doing this whole song and dance of indices is to properly handle empty matches
// Plus it's a little cleaner to surgically replace our matches
@@ -141,128 +110,390 @@ func (p *RegexProcessor) ProcessContent(content string, pattern string, luaExpr
// So when we're cutting open the array we say 0:7 + modified + 7:end
// As if concatenating in the middle of the array
// Plus it supports lookarounds
match := content[matchIndices[0]:matchIndices[1]]
log.Printf("Matched content: %s", match)
matchContent := content[matchIndices[0]:matchIndices[1]]
matchPreview := utils.LimitString(matchContent, 50)
matchLogger.Trace("Matched content: %q (length: %d)", matchPreview, len(matchContent))
groups := matchIndices[2:]
if len(groups) <= 0 {
log.Println("No capture groups for lua to chew on")
matchLogger.Warning("No capture groups found for match %q and regex %q", matchPreview, pattern)
continue
}
if len(groups)%2 == 1 {
log.Println("Odd number of indices of groups, what the fuck?")
matchLogger.Warning("Invalid number of group indices (%d), should be even: %v", len(groups), groups)
continue
}
// Count how many valid groups we have
validGroups := 0
for j := 0; j < len(groups); j += 2 {
if groups[j] != -1 && groups[j+1] != -1 {
validGroups++
}
}
matchLogger.Debug("Found %d valid capture groups in match", validGroups)
for _, index := range groups {
if index == -1 {
// return "", 0, 0, fmt.Errorf("negative indices encountered: %v. This indicates that there was an issue with the match indices, possibly due to an empty match or an unexpected pattern. Please check the regex pattern and input content.", matchIndices)
log.Printf("Negative indices encountered: %v. This indicates that there was an issue with the match indices, possibly due to an empty match or an unexpected pattern. This is not an error but it's possibly not what you want.", matchIndices)
matchLogger.Warning("Negative index encountered in match indices %v. This may indicate an issue with the regex pattern or an empty/optional capture group.", matchIndices)
continue
}
}
captures := make([]string, 0, len(groups)/2)
for j := 0; j < len(groups); j += 2 {
if groups[j] == -1 || groups[j+1] == -1 {
continue
}
captures = append(captures, content[groups[j]:groups[j+1]])
}
log.Printf("Captured groups: %v", captures)
// We have to use array to preserve order
// Very important for the reconstruction step
// Because we must overwrite the values in reverse order
// See comments a few dozen lines above for more details
namedCaptures := make([]NamedCapture, 0, len(groups)/2)
captureGroups := make([]*CaptureGroup, 0, len(groups)/2)
groupNames := compiledPattern.SubexpNames()[1:]
for i, name := range groupNames {
if name == "" {
start := groups[i*2]
end := groups[i*2+1]
if start == -1 || end == -1 {
matchLogger.Debug("Skipping empty or unmatched capture group #%d (name: %q)", i+1, name)
continue
}
if groups[i*2] == -1 || groups[i*2+1] == -1 {
continue
}
namedCaptures = append(namedCaptures, NamedCapture{
value := content[start:end]
captureGroups = append(captureGroups, &CaptureGroup{
Name: name,
Value: captures[i],
Range: [2]int{groups[i*2], groups[i*2+1]},
Value: value,
Range: [2]int{start, end},
})
// Include name info in log if available
if name != "" {
matchLogger.Trace("Capture group '%s': %q (pos %d-%d)", name, value, start, end)
} else {
matchLogger.Trace("Capture group #%d: %q (pos %d-%d)", i+1, value, start, end)
}
}
log.Printf("Named captures: %v", namedCaptures)
// Use the DeduplicateGroups flag to control whether to deduplicate capture groups
if !command.NoDedup {
matchLogger.Debug("Deduplicating capture groups as specified in command settings")
captureGroups = deduplicateGroups(captureGroups)
matchLogger.Trace("Capture groups after deduplication: %v", captureGroups)
} else {
matchLogger.Debug("Skipping deduplication of capture groups (NoDedup is true)")
}
if err := p.ToLua(L, captures); err != nil {
log.Printf("Error setting Lua variables: %v", err)
if err := toLua(L, captureGroups); err != nil {
matchLogger.Error("Failed to set Lua variables for capture groups: %v", err)
continue
}
log.Println("Lua variables set successfully")
for _, capture := range namedCaptures {
if capture.Name == "" {
continue
}
if val, err := strconv.ParseFloat(capture.Value, 64); err == nil {
L.SetGlobal(capture.Name, lua.LNumber(val))
} else {
L.SetGlobal(capture.Name, lua.LString(capture.Value))
}
}
matchLogger.Debug("Set %d capture groups as Lua variables", len(captureGroups))
matchLogger.Trace("Lua globals set for capture groups")
if err := L.DoString(luaExpr); err != nil {
log.Printf("Error executing Lua code %s for group %s: %v", luaExpr, captures, err)
matchLogger.Error("Lua script execution failed: %v\nScript: %s\nCapture Groups: %+v",
err, utils.LimitString(luaExpr, 200), captureGroups)
continue
}
log.Println("Lua code executed successfully")
matchLogger.Debug("Lua script executed successfully")
// Get modifications from Lua
modResult, err := p.FromLua(L)
updatedCaptureGroups, err := fromLua(L, captureGroups)
if err != nil {
log.Printf("Error getting modifications: %v", err)
continue
}
// Apply modifications to the matched text
modsMap, ok := modResult.(map[int]string)
if !ok || len(modsMap) == 0 {
log.Println("No modifications to apply")
matchLogger.Error("Failed to retrieve modifications from Lua: %v", err)
continue
}
matchLogger.Debug("Retrieved updated values from Lua")
matchLogger.Trace("Updated capture groups from Lua: %v", updatedCaptureGroups)
replacement := ""
replacementVar := L.GetGlobal("replacement")
if replacementVar.Type() != lua.LTNil {
replacement = replacementVar.String()
matchLogger.Debug("Using global replacement variable from Lua: %q", replacement)
}
if replacement == "" {
// Apply the modifications to the original match
replacement = match
for i := len(modsMap) - 1; i >= 0; i-- {
newVal := modsMap[i]
log.Printf("Applying modification: %s", newVal)
// Indices of the group are relative to content
// To relate them to match we have to subtract the match start index
groupStart := groups[i*2] - matchIndices[0]
groupEnd := groups[i*2+1] - matchIndices[0]
replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
}
for i := len(namedCaptures) - 1; i >= 0; i-- {
capture := namedCaptures[i]
if capture.Name == "" {
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
matchLogger.Debug("Skipping match - no modifications indicated by Lua script")
continue
}
if replacement == "" {
// Count groups that were actually modified
modifiedGroupsCount := 0
for _, capture := range updatedCaptureGroups {
if capture.Value != capture.Updated {
modifiedGroupsCount++
}
}
matchLogger.Info("%d of %d capture groups identified for modification", modifiedGroupsCount, len(updatedCaptureGroups))
for _, capture := range updatedCaptureGroups {
if capture.Value == capture.Updated {
matchLogger.Debug("Capture group unchanged: %s", utils.LimitString(capture.Value, 50))
continue
}
groupStart := capture.Range[0] - matchIndices[0]
groupEnd := capture.Range[1] - matchIndices[0]
luaValue := L.GetGlobal(capture.Name).String()
replacement = replacement[:groupStart] + luaValue + replacement[groupEnd:]
// Log what changed with context
matchLogger.Debug("Capture group %q scheduled for modification: %q → %q",
capture.Name, utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
// Indices of the group are relative to content
// To relate them to match we have to subtract the match start index
// replacement = replacement[:groupStart] + newVal + replacement[groupEnd:]
commands = append(commands, utils.ReplaceCommand{
From: capture.Range[0],
To: capture.Range[1],
With: capture.Updated,
})
matchLogger.Trace("Added replacement command: %+v", commands[len(commands)-1])
}
} else {
matchLogger.Debug("Using full replacement string from Lua: %q", utils.LimitString(replacement, 50))
commands = append(commands, utils.ReplaceCommand{
From: matchIndices[0],
To: matchIndices[1],
With: replacement,
})
matchLogger.Trace("Added full replacement command: %+v", commands[len(commands)-1])
}
modificationCount++
result = result[:matchIndices[0]] + replacement + result[matchIndices[1]:]
log.Printf("Modification count updated: %d", modificationCount)
}
log.Printf("Process completed with %d modifications", modificationCount)
return result, modificationCount, len(indices), nil
processRegexLogger.Debug("Total regex processing time: %v", time.Since(startTime))
processRegexLogger.Debug("Generated %d total modifications", len(commands))
return commands, nil
}
func deduplicateGroups(captureGroups []*CaptureGroup) []*CaptureGroup {
deduplicateGroupsLogger := regexLogger.WithPrefix("deduplicateGroups")
deduplicateGroupsLogger.Debug("Starting deduplication of capture groups")
deduplicateGroupsLogger.Trace("Input capture groups: %v", captureGroups)
// Preserve input order and drop any group that overlaps with an already accepted group
accepted := make([]*CaptureGroup, 0, len(captureGroups))
for _, group := range captureGroups {
groupLogger := deduplicateGroupsLogger.WithField("groupName", group.Name).WithField("groupRange", group.Range)
groupLogger.Debug("Processing capture group")
overlaps := false
for _, kept := range accepted {
// Overlap if start < keptEnd and end > keptStart (adjacent is allowed)
if group.Range[0] < kept.Range[1] && group.Range[1] > kept.Range[0] {
overlaps = true
break
}
}
if overlaps {
groupLogger.Warning("Overlapping capture group detected and skipped.")
continue
}
groupLogger.Debug("Capture group does not overlap with previously accepted groups. Adding.")
accepted = append(accepted, group)
}
deduplicateGroupsLogger.Debug("Finished deduplication. Original %d groups, %d deduplicated.", len(captureGroups), len(accepted))
deduplicateGroupsLogger.Trace("Deduplicated groups: %v", accepted)
return accepted
}
// The order of these replaces is important
// This one handles !num-s inside of named capture groups
// If it were not here our !num in a named capture group would
// Expand to another capture group in the capture group
// We really only want one (our named) capture group
func resolveRegexPlaceholders(pattern string) string {
resolveLogger := regexLogger.WithPrefix("resolveRegexPlaceholders").WithField("originalPattern", utils.LimitString(pattern, 100))
resolveLogger.Debug("Resolving regex placeholders in pattern")
// Handle special pattern modifications
if !strings.HasPrefix(pattern, "(?s)") {
pattern = "(?s)" + pattern
resolveLogger.Debug("Prepended '(?s)' to pattern for single-line mode")
}
namedGroupNum := regexp.MustCompile(`(?:(\?<[^>]+>)(!num))`)
pattern = namedGroupNum.ReplaceAllStringFunc(pattern, func(match string) string {
funcLogger := resolveLogger.WithPrefix("namedGroupNumReplace").WithField("match", utils.LimitString(match, 50))
funcLogger.Debug("Processing named group !num placeholder")
parts := namedGroupNum.FindStringSubmatch(match)
if len(parts) != 3 {
funcLogger.Warning("Unexpected number of submatches for namedGroupNum: %d. Returning original match.", len(parts))
return match
}
replacement := `-?\d*\.?\d+`
funcLogger.Trace("Replacing !num in named group with: %q", replacement)
return parts[1] + replacement
})
resolveLogger.Debug("Handled named group !num placeholders")
pattern = strings.ReplaceAll(pattern, "!num", `(-?\d*\.?\d+)`)
resolveLogger.Debug("Replaced !num with numeric capture group")
pattern = strings.ReplaceAll(pattern, "!any", `.*?`)
resolveLogger.Debug("Replaced !any with non-greedy wildcard")
pattern = strings.ReplaceAll(pattern, "\n", "\r?\n")
resolveLogger.Debug("Added optional carriage return support for Windows line endings")
repPattern := regexp.MustCompile(`!rep\(([^,]+),\s*(\d+)\)`)
// !rep(pattern, count) repeats the pattern n times
// Inserting !any between each repetition
pattern = repPattern.ReplaceAllStringFunc(pattern, func(match string) string {
funcLogger := resolveLogger.WithPrefix("repPatternReplace").WithField("match", utils.LimitString(match, 50))
funcLogger.Debug("Processing !rep placeholder")
parts := repPattern.FindStringSubmatch(match)
if len(parts) != 3 {
funcLogger.Warning("Unexpected number of submatches for repPattern: %d. Returning original match.", len(parts))
return match
}
repeatedPattern := parts[1]
countStr := parts[2]
repetitions, err := strconv.Atoi(countStr)
if err != nil {
funcLogger.Error("Failed to parse repetition count %q: %v. Returning original match.", countStr, err)
return match
}
var finalReplacement string
if repetitions > 0 {
finalReplacement = strings.Repeat(repeatedPattern+".*?", repetitions-1) + repeatedPattern
} else {
finalReplacement = ""
}
funcLogger.Trace("Replaced !rep with %d repetitions of %q: %q", repetitions, utils.LimitString(repeatedPattern, 30), utils.LimitString(finalReplacement, 100))
return finalReplacement
})
resolveLogger.Debug("Handled !rep placeholders")
resolveLogger.Debug("Finished resolving regex placeholders")
resolveLogger.Trace("Final resolved pattern: %q", utils.LimitString(pattern, 100))
return pattern
}
// ToLua sets capture groups as Lua variables (v1, v2, etc. for numeric values and s1, s2, etc. for strings)
func toLua(L *lua.LState, data interface{}) error {
toLuaLogger := regexLogger.WithPrefix("toLua")
toLuaLogger.Debug("Setting capture groups as Lua variables")
captureGroups, ok := data.([]*CaptureGroup)
if !ok {
toLuaLogger.Error("Invalid data type for toLua. Expected []*CaptureGroup, got %T", data)
return fmt.Errorf("expected []*CaptureGroup for captures, got %T", data)
}
toLuaLogger.Trace("Input capture groups: %v", captureGroups)
groupindex := 0
for _, capture := range captureGroups {
groupLogger := toLuaLogger.WithField("captureGroup", capture.Name).WithField("value", utils.LimitString(capture.Value, 50))
groupLogger.Debug("Processing capture group for Lua")
if capture.Name == "" {
// We don't want to change the name of the capture group
// Even if it's empty
tempName := fmt.Sprintf("%d", groupindex+1)
groupindex++
groupLogger.Debug("Unnamed capture group, assigning temporary name: %q", tempName)
L.SetGlobal("s"+tempName, lua.LString(capture.Value))
groupLogger.Trace("Set Lua global s%s = %q", tempName, capture.Value)
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal("v"+tempName, lua.LNumber(val))
groupLogger.Trace("Set Lua global v%s = %f", tempName, val)
} else {
groupLogger.Trace("Value %q is not numeric, skipping v%s assignment", capture.Value, tempName)
}
} else {
val, err := strconv.ParseFloat(capture.Value, 64)
if err == nil {
L.SetGlobal(capture.Name, lua.LNumber(val))
groupLogger.Trace("Set Lua global %s = %f (numeric)", capture.Name, val)
} else {
L.SetGlobal(capture.Name, lua.LString(capture.Value))
groupLogger.Trace("Set Lua global %s = %q (string)", capture.Name, capture.Value)
}
}
}
toLuaLogger.Debug("Finished setting capture groups as Lua variables")
return nil
}
// FromLua implements the Processor interface for RegexProcessor
func fromLua(L *lua.LState, captureGroups []*CaptureGroup) ([]*CaptureGroup, error) {
fromLuaLogger := regexLogger.WithPrefix("fromLua")
fromLuaLogger.Debug("Retrieving modifications from Lua for capture groups")
fromLuaLogger.Trace("Initial capture groups: %v", captureGroups)
captureIndex := 0
for _, capture := range captureGroups {
groupLogger := fromLuaLogger.WithField("originalCaptureName", capture.Name).WithField("originalValue", utils.LimitString(capture.Value, 50))
groupLogger.Debug("Processing capture group to retrieve updated value")
if capture.Name == "" {
// This case means it was an unnamed capture group originally.
// We need to reconstruct the original temporary name to fetch its updated value.
// The name will be set to an integer if it was empty, then incremented.
// So, we use the captureIndex to get the correct 'vX' and 'sX' variables.
tempName := fmt.Sprintf("%d", captureIndex+1)
groupLogger.Debug("Retrieving updated value for unnamed group (temp name: %q)", tempName)
vVarName := fmt.Sprintf("v%s", tempName)
sVarName := fmt.Sprintf("s%s", tempName)
captureIndex++
vLuaVal := L.GetGlobal(vVarName)
sLuaVal := L.GetGlobal(sVarName)
groupLogger.Trace("Lua values for unnamed group: v=%v, s=%v", vLuaVal, sLuaVal)
if sLuaVal.Type() == lua.LTString {
capture.Updated = sLuaVal.String()
groupLogger.Trace("Updated value from s%s (string): %q", tempName, capture.Updated)
}
// Numbers have priority
if vLuaVal.Type() == lua.LTNumber {
capture.Updated = vLuaVal.String()
groupLogger.Trace("Updated value from v%s (numeric): %q", tempName, capture.Updated)
}
} else {
// Easy shit, directly use the named capture group
updatedValue := L.GetGlobal(capture.Name)
if updatedValue.Type() != lua.LTNil {
capture.Updated = updatedValue.String()
groupLogger.Trace("Updated value for named group %q: %q", capture.Name, capture.Updated)
} else {
groupLogger.Debug("Named capture group %q not found in Lua globals or is nil. Keeping original value.", capture.Name)
capture.Updated = capture.Value // Keep original if not found or nil
}
}
groupLogger.Debug("Finished processing capture group. Original: %q, Updated: %q", utils.LimitString(capture.Value, 50), utils.LimitString(capture.Updated, 50))
}
fromLuaLogger.Debug("Finished retrieving modifications from Lua")
fromLuaLogger.Trace("Final updated capture groups: %v", captureGroups)
return captureGroups, nil
}
// estimatePatternComplexity gives a rough estimate of regex pattern complexity
// This can help identify potentially problematic patterns
func estimatePatternComplexity(pattern string) int {
estimateComplexityLogger := regexLogger.WithPrefix("estimatePatternComplexity").WithField("pattern", utils.LimitString(pattern, 100))
estimateComplexityLogger.Debug("Estimating regex pattern complexity")
complexity := len(pattern)
// Add complexity for potentially expensive operations
complexity += strings.Count(pattern, ".*") * 10 // Greedy wildcard
complexity += strings.Count(pattern, ".*?") * 5 // Non-greedy wildcard
complexity += strings.Count(pattern, "[^") * 3 // Negated character class
complexity += strings.Count(pattern, "\\b") * 2 // Word boundary
complexity += strings.Count(pattern, "(") * 2 // Capture groups
complexity += strings.Count(pattern, "(?:") * 1 // Non-capture groups
complexity += strings.Count(pattern, "\\1") * 3 // Backreferences
complexity += strings.Count(pattern, "{") * 2 // Counted repetition
estimateComplexityLogger.Debug("Estimated pattern complexity: %d", complexity)
return complexity
}

View File

@@ -0,0 +1,87 @@
package processor
import (
"cook/utils"
"regexp"
"testing"
"github.com/stretchr/testify/assert"
)
// Test named capture group fallback when value is not in Lua
func TestNamedCaptureGroupFallback(t *testing.T) {
pattern := `value = (?P<myvalue>\d+)`
input := `value = 42`
// Don't set myvalue in Lua, but do something else so we get a match
lua := `v1 = v1 * 2 -- Set v1 but not myvalue, test fallback`
cmd := utils.ModifyCommand{
Name: "test_fallback",
Regex: pattern,
Lua: lua,
}
re := regexp.MustCompile(pattern)
matches := re.FindStringSubmatchIndex(input)
assert.NotNil(t, matches)
replacements, err := ProcessRegex(input, cmd, "test.txt")
// Should not error
assert.NoError(t, err)
// Since only v1 is set, myvalue should keep original
// Should have 1 replacement for v1
if replacements != nil {
assert.GreaterOrEqual(t, len(replacements), 0)
}
}
// Test named capture groups with nil value in Lua
func TestNamedCaptureGroupNilInLua(t *testing.T) {
pattern := `value = (?P<num>\d+)`
input := `value = 123`
// Set num to nil explicitly, and also set v1 to get a modification
lua := `v1 = v1 .. "_test"; num = nil -- v1 modified, num set to nil`
cmd := utils.ModifyCommand{
Name: "test_nil",
Regex: pattern,
Lua: lua,
}
replacements, err := ProcessRegex(input, cmd, "test.txt")
// Should not error
assert.NoError(t, err)
// Should have replacements for v1, num should fallback to original
if replacements != nil {
assert.GreaterOrEqual(t, len(replacements), 0)
}
}
// Test multiple named capture groups with some undefined
func TestMixedNamedCaptureGroups(t *testing.T) {
pattern := `(?P<key>\w+) = (?P<value>\d+)`
input := `count = 100`
lua := `key = key .. "_modified" -- Only modify key, leave value undefined`
cmd := utils.ModifyCommand{
Name: "test_mixed",
Regex: pattern,
Lua: lua,
}
replacements, err := ProcessRegex(input, cmd, "test.txt")
assert.NoError(t, err)
assert.NotNil(t, replacements)
// Apply replacements
result, _ := utils.ExecuteModifications(replacements, input)
// key should be modified, value should remain unchanged
assert.Contains(t, result, "count_modified")
assert.Contains(t, result, "100")
}

File diff suppressed because it is too large Load Diff

View File

@@ -0,0 +1,847 @@
package processor
import (
"cook/utils"
"testing"
"github.com/google/go-cmp/cmp"
)
func TestSurgicalJSONEditing(t *testing.T) {
tests := []struct {
name string
content string
luaCode string
expected string
}{
{
name: "Modify single field",
content: `{
"name": "test",
"value": 42,
"description": "original"
}`,
luaCode: `
data.value = 84
modified = true
`,
expected: `{
"name": "test",
"value": 84,
"description": "original"
}`,
},
{
name: "Add new field",
content: `{
"name": "test",
"value": 42
}`,
luaCode: `
data.newField = "added"
modified = true
`,
expected: `{
"name": "test",
"value": 42
,"newField": "added"}`, // sjson.Set() adds new fields in compact format
},
{
name: "Modify nested field",
content: `{
"config": {
"settings": {
"enabled": false,
"timeout": 30
}
}
}`,
luaCode: `
data.config.settings.enabled = true
data.config.settings.timeout = 60
modified = true
`,
expected: `{
"config": {
"settings": {
"enabled": true,
"timeout": 60
}
}
}`,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
command := utils.ModifyCommand{
Name: "test",
Lua: tt.luaCode,
}
commands, err := ProcessJSON(tt.content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := tt.content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, tt.expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
// Check the actual result matches expected
if result != tt.expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", tt.expected, result)
}
})
}
}
func TestSurgicalJSONPreservesFormatting(t *testing.T) {
// Test that surgical editing preserves the original formatting structure
content := `{
"Defaults": {
"Behaviour": "None",
"Description": "",
"DisplayName": "",
"FlavorText": "",
"Icon": "None",
"MaxStack": 1,
"Override_Glow_Icon": "None",
"Weight": 0,
"bAllowZeroWeight": false
},
"RowStruct": "/Script/Icarus.ItemableData",
"Rows": [
{
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"MaxStack": 1000000,
"Name": "Item_Fiber",
"Weight": 10
}
]
}`
expected := `{
"Defaults": {
"Behaviour": "None",
"Description": "",
"DisplayName": "",
"FlavorText": "",
"Icon": "None",
"MaxStack": 1,
"Override_Glow_Icon": "None",
"Weight": 0,
"bAllowZeroWeight": false
},
"RowStruct": "/Script/Icarus.ItemableData",
"Rows": [
{
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"MaxStack": 1000000,
"Name": "Item_Fiber",
"Weight": 500
}
]
}`
command := utils.ModifyCommand{
Name: "test",
Lua: `
-- Modify the weight of the first item
data.Rows[1].Weight = 500
modified = true
`,
}
commands, err := ProcessJSON(content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
// Check that the result matches expected (preserves formatting and changes weight)
if result != expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
}
}
func TestSurgicalJSONPreservesFormatting2(t *testing.T) {
// Test that surgical editing preserves the original formatting structure
content := `
{
"RowStruct": "/Script/Icarus.ProcessorRecipe",
"Defaults": {
"bForceDisableRecipe": false,
"Requirement": {
"RowName": "None",
"DataTableName": "D_Talents"
},
"SessionRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"CharacterRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"RequiredMillijoules": 2500,
"RecipeSets": [],
"ResourceCostMultipliers": [],
"Inputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Container": {
"Value": "None"
},
"ResourceInputs": [],
"bSelectOutputItemRandomly": false,
"bContainsContainer": false,
"ItemIconOverride": {
"ItemStaticData": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"ItemDynamicData": [],
"ItemCustomStats": [],
"CustomProperties": {
"StaticWorldStats": [],
"StaticWorldHeldStats": [],
"Stats": [],
"Alterations": [],
"LivingItemSlots": []
},
"DatabaseGUID": "",
"ItemOwnerLookupId": -1,
"RuntimeTags": {
"GameplayTags": []
}
},
"Outputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemTemplate"
},
"Count": 1,
"DynamicProperties": []
}
],
"ResourceOutputs": [],
"Refundable": "Inherit",
"ExperienceMultiplier": 1,
"Audio": {
"RowName": "None",
"DataTableName": "D_CraftingAudioData"
}
},
"Rows": [
{
"Name": "Biofuel1",
"RecipeSets": [
{
"RowName": "Composter",
"DataTableName": "D_RecipeSets"
}
],
"Inputs": [
{
"Element": {
"RowName": "Raw_Meat",
"DataTableName": "D_ItemsStatic"
},
"Count": 2,
"DynamicProperties": []
},
{
"Element": {
"RowName": "Tree_Sap",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Outputs": [],
"Audio": {
"RowName": "Composter"
},
"ResourceOutputs": [
{
"Type": {
"Value": "Biofuel"
},
"RequiredUnits": 100
}
]
}
]
}
`
expected := `
{
"RowStruct": "/Script/Icarus.ProcessorRecipe",
"Defaults": {
"bForceDisableRecipe": false,
"Requirement": {
"RowName": "None",
"DataTableName": "D_Talents"
},
"SessionRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"CharacterRequirement": {
"RowName": "None",
"DataTableName": "D_CharacterFlags"
},
"RequiredMillijoules": 2500,
"RecipeSets": [],
"ResourceCostMultipliers": [],
"Inputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"Count": 1,
"DynamicProperties": []
}
],
"Container": {
"Value": "None"
},
"ResourceInputs": [],
"bSelectOutputItemRandomly": false,
"bContainsContainer": false,
"ItemIconOverride": {
"ItemStaticData": {
"RowName": "None",
"DataTableName": "D_ItemsStatic"
},
"ItemDynamicData": [],
"ItemCustomStats": [],
"CustomProperties": {
"StaticWorldStats": [],
"StaticWorldHeldStats": [],
"Stats": [],
"Alterations": [],
"LivingItemSlots": []
},
"DatabaseGUID": "",
"ItemOwnerLookupId": -1,
"RuntimeTags": {
"GameplayTags": []
}
},
"Outputs": [
{
"Element": {
"RowName": "None",
"DataTableName": "D_ItemTemplate"
},
"Count": 1,
"DynamicProperties": []
}
],
"ResourceOutputs": [],
"Refundable": "Inherit",
"ExperienceMultiplier": 1,
"Audio": {
"RowName": "None",
"DataTableName": "D_CraftingAudioData"
}
},
"Rows": [
{
"Name": "Biofuel1",
"RecipeSets": [
{
"RowName": "Composter",
"DataTableName": "D_RecipeSets"
}
],
"Inputs": [
{
"Element": {
"RowName": "Raw_Meat",
"DataTableName": "D_ItemsStatic"
},
"Count": 2,
"DynamicProperties": []
}
],
"Outputs": [],
"Audio": {
"RowName": "Composter"
},
"ResourceOutputs": [
{
"Type": {
"Value": "Biofuel"
},
"RequiredUnits": 100
}
]
}
]
}
`
command := utils.ModifyCommand{
Name: "test",
Lua: `
-- Define regex patterns for matching recipe names
local function matchesPattern(name, pattern)
local matches = re(pattern, name)
-- Check if matches table has any content (index 0 or 1 should exist if there's a match)
return matches and (matches[0] or matches[1])
end
-- Selection pattern for recipes that get multiplied
local selectionPattern = "(?-s)(Bulk_)?(Pistol|Rifle).*?Round.*?|(Carbon|Composite)_Paste.*|(Gold|Copper)_Wire|(Ironw|Copper)_Nail|(Platinum|Steel|Cold_Steel|Titanium)_Ingot|.*?Shotgun_Shell.*?|.*_Arrow|.*_Bolt|.*_Fertilizer_?\\d*|.*_Grenade|.*_Pill|.*_Tonic|Aluminum|Ammo_Casing|Animal_Fat|Carbon_Fiber|Composites|Concrete_Mix|Cured_Leather_?\\d?|Electronics|Epoxy_?\\d?|Glass\\d?|Gunpowder\\w*|Health_.*|Titanium_Plate|Organic_Resin|Platinum_Sheath|Refined_[a-zA-Z]+|Rope|Shotgun_Casing|Steel_Bloom\\d?|Tree_Sap\\w*"
-- Ingot pattern for recipes that get count set to 1
local ingotPattern = "(?-s)(Platinum|Steel|Cold_Steel|Titanium)_Ingot|Aluminum|Refined_[a-zA-Z]+|Glass\\d?"
local factor = 16
local bonus = 0.5
for _, row in ipairs(data.Rows) do
local recipeName = row.Name
-- Special case: Biofuel recipes - remove Tree_Sap input
if string.find(recipeName, "Biofuel") then
if row.Inputs then
for i = #row.Inputs, 1, -1 do
local input = row.Inputs[i]
if input.Element and input.Element.RowName and string.find(input.Element.RowName, "Tree_Sap") then
table.remove(row.Inputs, i)
print("Removing input 'Tree_Sap' from processor recipe '" .. recipeName .. "'")
end
end
end
end
-- Ingot recipes: set input and output counts to 1
if matchesPattern(recipeName, ingotPattern) then
if row.Inputs then
for _, input in ipairs(row.Inputs) do
input.Count = 1
end
end
if row.Outputs then
for _, output in ipairs(row.Outputs) do
output.Count = 1
end
end
end
-- Selected recipes: multiply inputs by factor, outputs by factor * (1 + bonus)
if matchesPattern(recipeName, selectionPattern) then
if row.Inputs then
for _, input in ipairs(row.Inputs) do
local oldCount = input.Count
input.Count = input.Count * factor
print("Recipe " .. recipeName .. " Input.Count: " .. oldCount .. " -> " .. input.Count)
end
end
if row.Outputs then
for _, output in ipairs(row.Outputs) do
local oldCount = output.Count
output.Count = math.floor(output.Count * factor * (1 + bonus))
print("Recipe " .. recipeName .. " Output.Count: " .. oldCount .. " -> " .. output.Count)
end
end
end
end
`,
}
commands, err := ProcessJSON(content, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := content
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
// Check that the result matches expected (preserves formatting and changes weight)
if result != expected {
t.Errorf("Expected:\n%s\n\nGot:\n%s", expected, result)
}
}
func TestRetardedJSONEditing(t *testing.T) {
original := `{
"RowStruct": "/Script/Icarus.ItemableData",
"Defaults": {
"Behaviour": "None",
"DisplayName": "",
"Icon": "None",
"Override_Glow_Icon": "None",
"Description": "",
"FlavorText": "",
"Weight": 0,
"bAllowZeroWeight": false,
"MaxStack": 1
},
"Rows": [
{
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Weight": 10,
"MaxStack": 200,
"Name": "Item_Fiber"
}
]
}`
expected := `{
"RowStruct": "/Script/Icarus.ItemableData",
"Defaults": {
"Behaviour": "None",
"DisplayName": "",
"Icon": "None",
"Override_Glow_Icon": "None",
"Description": "",
"FlavorText": "",
"Weight": 0,
"bAllowZeroWeight": false,
"MaxStack": 1
},
"Rows": [
{
"DisplayName": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-DisplayName\", \"Fiber\")",
"Icon": "/Game/Assets/2DArt/UI/Items/Item_Icons/Resources/ITEM_Fibre.ITEM_Fibre",
"Description": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-Description\", \"A bundle of soft fiber, highly useful.\")",
"FlavorText": "NSLOCTEXT(\"D_Itemable\", \"Item_Fiber-FlavorText\", \"Fiber is collected from bast, the strong inner bark of certain flowering plants.\")",
"Weight": 10,
"MaxStack": 1000000,
"Name": "Item_Fiber"
}
]
}`
command := utils.ModifyCommand{
Name: "test",
Lua: `
for _, row in ipairs(data.Rows) do
if row.MaxStack then
if string.find(row.Name, "Carrot") or string.find(row.Name, "Potato") then
row.MaxStack = 25
else
row.MaxStack = row.MaxStack * 10000
if row.MaxStack > 1000000 then
row.MaxStack = 1000000
end
end
end
end
`,
}
commands, err := ProcessJSON(original, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := original
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
// Check that the weight was changed
if result != expected {
t.Errorf("Expected:\n%s\nGot:\n%s", expected, result)
}
}
func TestRetardedJSONEditing2(t *testing.T) {
original := `
{
"Rows": [
{
"Name": "Deep_Mining_Drill_Biofuel",
"Meshable": {
"RowName": "Mesh_Deep_Mining_Drill_Biofuel"
},
"Itemable": {
"RowName": "Item_Deep_Mining_Drill_Biofuel"
},
"Interactable": {
"RowName": "Deployable"
},
"Focusable": {
"RowName": "Focusable_1H"
},
"Highlightable": {
"RowName": "Generic"
},
"Actionable": {
"RowName": "Deployable"
},
"Usable": {
"RowName": "Place"
},
"Deployable": {
"RowName": "Deep_Mining_Drill_Biofuel"
},
"Durable": {
"RowName": "Deployable_750"
},
"Inventory": {
"RowName": "Deep_Mining_Drill_Biofuel"
},
"Decayable": {
"RowName": "Decay_MetaItem"
},
"Generator": {
"RowName": "Deep_Mining_Biofuel_Drill"
},
"Resource": {
"RowName": "Simple_Internal_Flow_Only"
},
"Manual_Tags": {
"GameplayTags": [
{
"TagName": "Item.Machine"
}
]
},
"Generated_Tags": {
"GameplayTags": [
{
"TagName": "Item.Machine"
},
{
"TagName": "Traits.Meshable"
},
{
"TagName": "Traits.Itemable"
},
{
"TagName": "Traits.Interactable"
},
{
"TagName": "Traits.Highlightable"
},
{
"TagName": "Traits.Actionable"
},
{
"TagName": "Traits.Usable"
},
{
"TagName": "Traits.Deployable"
},
{
"TagName": "Traits.Durable"
},
{
"TagName": "Traits.Inventory"
}
],
"ParentTags": []
}
}
]
}
`
expected := `
{
"Rows": [
{
"Name": "Deep_Mining_Drill_Biofuel",
"Meshable": {
"RowName": "Mesh_Deep_Mining_Drill_Biofuel"
},
"Itemable": {
"RowName": "Item_Deep_Mining_Drill_Biofuel"
},
"Interactable": {
"RowName": "Deployable"
},
"Focusable": {
"RowName": "Focusable_1H"
},
"Highlightable": {
"RowName": "Generic"
},
"Actionable": {
"RowName": "Deployable"
},
"Usable": {
"RowName": "Place"
},
"Deployable": {
"RowName": "Deep_Mining_Drill_Biofuel"
},
"Durable": {
"RowName": "Deployable_750"
},
"Inventory": {
"RowName": "Deep_Mining_Drill_Biofuel"
},
"Decayable": {
"RowName": "Decay_MetaItem"
},
"Generator": {
"RowName": "Deep_Mining_Biofuel_Drill"
},
"Resource": {
"RowName": "Simple_Internal_Flow_Only"
},
"Manual_Tags": {
"GameplayTags": [
{
"TagName": "Item.Machine"
}
]
},
"Generated_Tags": {
"GameplayTags": [
{
"TagName": "Item.Machine"
},
{
"TagName": "Traits.Meshable"
},
{
"TagName": "Traits.Itemable"
},
{
"TagName": "Traits.Interactable"
},
{
"TagName": "Traits.Highlightable"
},
{
"TagName": "Traits.Actionable"
},
{
"TagName": "Traits.Usable"
},
{
"TagName": "Traits.Deployable"
},
{
"TagName": "Traits.Durable"
},
{
"TagName": "Traits.Inventory"
}
],
"ParentTags": []
}
,"AdditionalStats": {"(Value=\"BaseDeepMiningDrillSpeed_+%\")":4000}}
]
}
`
command := utils.ModifyCommand{
Name: "test",
Lua: `
for i, row in ipairs(data.Rows) do
-- Special case: Deep_Mining_Drill_Biofuel
if string.find(row.Name, "Deep_Mining_Drill_Biofuel") then
print("[DEBUG] Special case: Deep_Mining_Drill_Biofuel")
if not row.AdditionalStats then
print("[DEBUG] Creating AdditionalStats table for Deep_Mining_Drill_Biofuel")
row.AdditionalStats = {}
end
print("[DEBUG] Setting BaseDeepMiningDrillSpeed_+% to 4000")
row.AdditionalStats["(Value=\\\"BaseDeepMiningDrillSpeed_+%\\\")"] = 4000
end
end
`,
}
commands, err := ProcessJSON(original, command, "test.json")
if err != nil {
t.Fatalf("ProcessJSON failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected at least one command")
}
// Apply the commands
result := original
for _, cmd := range commands {
result = result[:cmd.From] + cmd.With + result[cmd.To:]
}
diff := cmp.Diff(result, expected)
if diff != "" {
t.Errorf("Differences:\n%s", diff)
}
if result != expected {
t.Errorf("Expected:\n%s\nGot:\n%s", expected, result)
}
}

View File

@@ -1,412 +1,533 @@
package processor
import (
"cook/utils"
"encoding/xml"
"fmt"
"log"
"modify/processor/xpath"
"io"
"sort"
"strconv"
"strings"
"github.com/antchfx/xmlquery"
logger "git.site.quack-lab.dev/dave/cylogger"
lua "github.com/yuin/gopher-lua"
)
// XMLProcessor implements the Processor interface for XML documents
type XMLProcessor struct{}
var xmlLogger = logger.Default.WithPrefix("processor/xml")
// ProcessContent implements the Processor interface for XMLProcessor
func (p *XMLProcessor) ProcessContent(content string, path string, luaExpr string) (string, int, int, error) {
// Parse XML document
// We can't really use encoding/xml here because it requires a pre defined struct
// And we HAVE TO parse dynamic unknown XML
doc, err := xmlquery.Parse(strings.NewReader(content))
if err != nil {
return content, 0, 0, fmt.Errorf("error parsing XML: %v", err)
}
// Find nodes matching the XPath pattern
nodes, err := xpath.Get(doc, path)
if err != nil {
return content, 0, 0, fmt.Errorf("error executing XPath: %v", err)
}
matchCount := len(nodes)
if matchCount == 0 {
return content, 0, 0, nil
}
// Apply modifications to each node
modCount := 0
for _, node := range nodes {
L, err := NewLuaState()
if err != nil {
return content, 0, 0, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
err = p.ToLua(L, node)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error converting to Lua: %v", err)
}
err = L.DoString(BuildLuaScript(luaExpr))
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error executing Lua: %v", err)
}
result, err := p.FromLua(L)
if err != nil {
return content, modCount, matchCount, fmt.Errorf("error getting result from Lua: %v", err)
}
log.Printf("%#v", result)
modified := false
modified = L.GetGlobal("modified").String() == "true"
if !modified {
log.Printf("No changes made to node at path: %s", node.Data)
continue
}
// Apply modification based on the result
if updatedValue, ok := result.(string); ok {
// If the result is a simple string, update the node value directly
xpath.Set(doc, path, updatedValue)
} else if nodeData, ok := result.(map[string]interface{}); ok {
// If the result is a map, apply more complex updates
updateNodeFromMap(node, nodeData)
}
modCount++
}
// Serialize the modified XML document to string
if doc.FirstChild != nil && doc.FirstChild.Type == xmlquery.DeclarationNode {
// If we have an XML declaration, start with it
declaration := doc.FirstChild.OutputXML(true)
// Remove the firstChild (declaration) before serializing the rest of the document
doc.FirstChild = doc.FirstChild.NextSibling
return ConvertToNamedEntities(declaration + doc.OutputXML(true)), modCount, matchCount, nil
}
// Convert numeric entities to named entities for better readability
return ConvertToNamedEntities(doc.OutputXML(true)), modCount, matchCount, nil
// XMLElement represents a parsed XML element with position tracking
type XMLElement struct {
Tag string
Attributes map[string]XMLAttribute
Text string
Children []*XMLElement
StartPos int64
EndPos int64
TextStart int64
TextEnd int64
}
func (p *XMLProcessor) ToLua(L *lua.LState, data interface{}) error {
table, err := p.ToLuaTable(L, data)
if err != nil {
return err
}
L.SetGlobal("v", table)
return nil
// XMLAttribute represents an attribute with its position in the source
type XMLAttribute struct {
Value string
ValueStart int64
ValueEnd int64
}
// ToLua converts XML node values to Lua variables
func (p *XMLProcessor) ToLuaTable(L *lua.LState, data interface{}) (lua.LValue, error) {
// Check if data is an xmlquery.Node
node, ok := data.(*xmlquery.Node)
if !ok {
return nil, fmt.Errorf("expected xmlquery.Node, got %T", data)
}
// parseXMLWithPositions parses XML while tracking byte positions of all elements and attributes
func parseXMLWithPositions(content string) (*XMLElement, error) {
decoder := xml.NewDecoder(strings.NewReader(content))
var root *XMLElement
var stack []*XMLElement
var lastPos int64
// Create a simple table with essential data
table := L.NewTable()
// For element nodes, just provide basic info
L.SetField(table, "type", lua.LString(nodeTypeToString(node.Type)))
L.SetField(table, "name", lua.LString(node.Data))
L.SetField(table, "value", lua.LString(node.InnerText()))
// Add children if any
children := L.NewTable()
for child := node.FirstChild; child != nil; child = child.NextSibling {
childTable, err := p.ToLuaTable(L, child)
if err == nil {
children.Append(childTable)
for {
token, err := decoder.Token()
if err == io.EOF {
break
}
}
L.SetField(table, "children", children)
attrs := L.NewTable()
if len(node.Attr) > 0 {
for _, attr := range node.Attr {
L.SetField(attrs, attr.Name.Local, lua.LString(attr.Value))
if err != nil {
return nil, fmt.Errorf("failed to parse XML: %v", err)
}
}
L.SetField(table, "attr", attrs)
return table, nil
}
offset := decoder.InputOffset()
// FromLua gets modified values from Lua
func (p *XMLProcessor) FromLua(L *lua.LState) (interface{}, error) {
luaValue := L.GetGlobal("v")
switch t := token.(type) {
case xml.StartElement:
// Find the actual start position of this element by searching for "<tagname"
tagSearchPattern := "<" + t.Name.Local
startPos := int64(strings.LastIndex(content[:offset], tagSearchPattern))
// Handle string values directly
if luaValue.Type() == lua.LTString {
return luaValue.String(), nil
}
// Handle tables (for attributes and more complex updates)
if luaValue.Type() == lua.LTTable {
return luaTableToMap(L, luaValue.(*lua.LTable)), nil
}
return luaValue.String(), nil
}
// Simple helper to convert a Lua table to a Go map
func luaTableToMap(L *lua.LState, table *lua.LTable) map[string]interface{} {
result := make(map[string]interface{})
table.ForEach(func(k, v lua.LValue) {
if k.Type() == lua.LTString {
key := k.String()
if v.Type() == lua.LTTable {
result[key] = luaTableToMap(L, v.(*lua.LTable))
} else {
result[key] = v.String()
element := &XMLElement{
Tag: t.Name.Local,
Attributes: make(map[string]XMLAttribute),
StartPos: startPos,
Children: []*XMLElement{},
}
}
})
return result
}
// Parse attributes - search within the tag boundaries
if len(t.Attr) > 0 {
tagEnd := offset
tagSection := content[startPos:tagEnd]
// Simple helper to convert node type to string
func nodeTypeToString(nodeType xmlquery.NodeType) string {
switch nodeType {
case xmlquery.ElementNode:
return "element"
case xmlquery.TextNode:
return "text"
case xmlquery.AttributeNode:
return "attribute"
default:
return "other"
}
}
// Helper function to update an XML node from a map
func updateNodeFromMap(node *xmlquery.Node, data map[string]interface{}) {
// Update node value if present
if value, ok := data["value"]; ok {
if strValue, ok := value.(string); ok {
// For element nodes, replace text content
if node.Type == xmlquery.ElementNode {
// Find the first text child if it exists
var textNode *xmlquery.Node
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type == xmlquery.TextNode {
textNode = child
break
}
}
if textNode != nil {
// Update existing text node
textNode.Data = strValue
} else {
// Create new text node
newText := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: strValue,
Parent: node,
}
// Insert at beginning of children
if node.FirstChild != nil {
newText.NextSibling = node.FirstChild
node.FirstChild.PrevSibling = newText
node.FirstChild = newText
} else {
node.FirstChild = newText
node.LastChild = newText
}
}
} else if node.Type == xmlquery.TextNode {
// Directly update text node
node.Data = strValue
} else if node.Type == xmlquery.AttributeNode {
// Update attribute value
if node.Parent != nil {
for i, attr := range node.Parent.Attr {
if attr.Name.Local == node.Data {
node.Parent.Attr[i].Value = strValue
break
for _, attr := range t.Attr {
// Find attribute in the tag section: attrname="value"
attrPattern := attr.Name.Local + `="`
attrIdx := strings.Index(tagSection, attrPattern)
if attrIdx >= 0 {
valueStart := startPos + int64(attrIdx) + int64(len(attrPattern))
valueEnd := valueStart + int64(len(attr.Value))
element.Attributes[attr.Name.Local] = XMLAttribute{
Value: attr.Value,
ValueStart: valueStart,
ValueEnd: valueEnd,
}
}
}
}
if len(stack) > 0 {
parent := stack[len(stack)-1]
parent.Children = append(parent.Children, element)
} else {
root = element
}
stack = append(stack, element)
lastPos = offset
case xml.CharData:
rawText := string(t)
text := strings.TrimSpace(rawText)
if len(stack) > 0 && text != "" {
current := stack[len(stack)-1]
current.Text = text
// The text content is between lastPos (after >) and offset (before </)
// Search for the trimmed text within the raw content
textInContent := content[lastPos:offset]
trimmedStart := strings.Index(textInContent, text)
if trimmedStart >= 0 {
current.TextStart = lastPos + int64(trimmedStart)
current.TextEnd = current.TextStart + int64(len(text))
}
}
lastPos = offset
case xml.EndElement:
if len(stack) > 0 {
current := stack[len(stack)-1]
current.EndPos = offset
stack = stack[:len(stack)-1]
}
lastPos = offset
}
}
// Update attributes if present
if attrs, ok := data["attr"].(map[string]interface{}); ok && node.Type == xmlquery.ElementNode {
for name, value := range attrs {
if strValue, ok := value.(string); ok {
// Look for existing attribute
found := false
for i, attr := range node.Attr {
if attr.Name.Local == name {
node.Attr[i].Value = strValue
found = true
break
}
}
return root, nil
}
// Add new attribute if not found
if !found {
node.Attr = append(node.Attr, xmlquery.Attr{
Name: struct {
Space, Local string
}{Local: name},
Value: strValue,
})
}
// XMLChange represents a detected difference between original and modified XML structures
type XMLChange struct {
Type string // "text", "attribute", "add_element", "remove_element"
Path string
OldValue string
NewValue string
StartPos int64
EndPos int64
InsertText string
}
func findXMLChanges(original, modified *XMLElement, path string) []XMLChange {
var changes []XMLChange
// Check text content changes
if original.Text != modified.Text {
changes = append(changes, XMLChange{
Type: "text",
Path: path,
OldValue: original.Text,
NewValue: modified.Text,
StartPos: original.TextStart,
EndPos: original.TextEnd,
})
}
// Check attribute changes
for attrName, origAttr := range original.Attributes {
if modAttr, exists := modified.Attributes[attrName]; exists {
if origAttr.Value != modAttr.Value {
changes = append(changes, XMLChange{
Type: "attribute",
Path: path + "/@" + attrName,
OldValue: origAttr.Value,
NewValue: modAttr.Value,
StartPos: origAttr.ValueStart,
EndPos: origAttr.ValueEnd,
})
}
} else {
// Attribute removed
changes = append(changes, XMLChange{
Type: "remove_attribute",
Path: path + "/@" + attrName,
OldValue: origAttr.Value,
StartPos: origAttr.ValueStart - int64(len(attrName)+2), // Include attr=" part
EndPos: origAttr.ValueEnd + 1, // Include closing "
})
}
}
// Check for added attributes
for attrName, modAttr := range modified.Attributes {
if _, exists := original.Attributes[attrName]; !exists {
changes = append(changes, XMLChange{
Type: "add_attribute",
Path: path + "/@" + attrName,
NewValue: modAttr.Value,
StartPos: original.StartPos, // Will be adjusted to insert after tag name
InsertText: fmt.Sprintf(` %s="%s"`, attrName, modAttr.Value),
})
}
}
// Check children recursively
origChildMap := make(map[string][]*XMLElement)
for _, child := range original.Children {
origChildMap[child.Tag] = append(origChildMap[child.Tag], child)
}
modChildMap := make(map[string][]*XMLElement)
for _, child := range modified.Children {
modChildMap[child.Tag] = append(modChildMap[child.Tag], child)
}
// Compare children by tag name
processedTags := make(map[string]bool)
for tag, origChildren := range origChildMap {
processedTags[tag] = true
modChildren := modChildMap[tag]
// Match children by index
maxLen := len(origChildren)
if len(modChildren) > maxLen {
maxLen = len(modChildren)
}
for i := 0; i < maxLen; i++ {
childPath := fmt.Sprintf("%s/%s[%d]", path, tag, i)
if i < len(origChildren) && i < len(modChildren) {
// Both exist, compare recursively
childChanges := findXMLChanges(origChildren[i], modChildren[i], childPath)
changes = append(changes, childChanges...)
} else if i < len(origChildren) {
// Child removed
changes = append(changes, XMLChange{
Type: "remove_element",
Path: childPath,
StartPos: origChildren[i].StartPos,
EndPos: origChildren[i].EndPos,
})
}
}
// Handle added children
if len(modChildren) > len(origChildren) {
for i := len(origChildren); i < len(modChildren); i++ {
childPath := fmt.Sprintf("%s/%s[%d]", path, tag, i)
// Generate XML text for the new element
xmlText := serializeXMLElement(modChildren[i], " ")
changes = append(changes, XMLChange{
Type: "add_element",
Path: childPath,
InsertText: xmlText,
StartPos: original.EndPos - int64(len(original.Tag)+3), // Before closing tag
})
}
}
}
return changes
}
// Helper function to get a string representation of node type
func nodeTypeName(nodeType xmlquery.NodeType) string {
switch nodeType {
case xmlquery.ElementNode:
return "element"
case xmlquery.TextNode:
return "text"
case xmlquery.AttributeNode:
return "attribute"
case xmlquery.CommentNode:
return "comment"
case xmlquery.DeclarationNode:
return "declaration"
default:
return "unknown"
// serializeXMLElement converts an XMLElement back to XML text
func serializeXMLElement(elem *XMLElement, indent string) string {
var sb strings.Builder
sb.WriteString(indent)
sb.WriteString("<")
sb.WriteString(elem.Tag)
// Write attributes
attrNames := make([]string, 0, len(elem.Attributes))
for name := range elem.Attributes {
attrNames = append(attrNames, name)
}
sort.Strings(attrNames)
for _, name := range attrNames {
attr := elem.Attributes[name]
sb.WriteString(fmt.Sprintf(` %s="%s"`, name, attr.Value))
}
if elem.Text == "" && len(elem.Children) == 0 {
sb.WriteString(" />")
return sb.String()
}
sb.WriteString(">")
if elem.Text != "" {
sb.WriteString(elem.Text)
}
if len(elem.Children) > 0 {
sb.WriteString("\n")
for _, child := range elem.Children {
sb.WriteString(serializeXMLElement(child, indent+" "))
sb.WriteString("\n")
}
sb.WriteString(indent)
}
sb.WriteString("</")
sb.WriteString(elem.Tag)
sb.WriteString(">")
return sb.String()
}
// ConvertToNamedEntities replaces numeric XML entities with their named counterparts
func ConvertToNamedEntities(xml string) string {
// Basic XML entities
replacements := map[string]string{
// Basic XML entities
"&#34;": "&quot;", // double quote
"&#39;": "&apos;", // single quote
"&#60;": "&lt;", // less than
"&#62;": "&gt;", // greater than
"&#38;": "&amp;", // ampersand
// applyXMLChanges generates ReplaceCommands from detected XML changes
func applyXMLChanges(changes []XMLChange) []utils.ReplaceCommand {
var commands []utils.ReplaceCommand
// Common symbols
"&#160;": "&nbsp;", // non-breaking space
"&#169;": "&copy;", // copyright
"&#174;": "&reg;", // registered trademark
"&#8364;": "&euro;", // euro
"&#163;": "&pound;", // pound
"&#165;": "&yen;", // yen
"&#162;": "&cent;", // cent
"&#167;": "&sect;", // section
"&#8482;": "&trade;", // trademark
"&#9824;": "&spades;", // spade
"&#9827;": "&clubs;", // club
"&#9829;": "&hearts;", // heart
"&#9830;": "&diams;", // diamond
for _, change := range changes {
switch change.Type {
case "text":
commands = append(commands, utils.ReplaceCommand{
From: int(change.StartPos),
To: int(change.EndPos),
With: change.NewValue,
})
// Special characters
"&#161;": "&iexcl;", // inverted exclamation
"&#191;": "&iquest;", // inverted question
"&#171;": "&laquo;", // left angle quotes
"&#187;": "&raquo;", // right angle quotes
"&#183;": "&middot;", // middle dot
"&#8226;": "&bull;", // bullet
"&#8230;": "&hellip;", // horizontal ellipsis
"&#8242;": "&prime;", // prime
"&#8243;": "&Prime;", // double prime
"&#8254;": "&oline;", // overline
"&#8260;": "&frasl;", // fraction slash
case "attribute":
commands = append(commands, utils.ReplaceCommand{
From: int(change.StartPos),
To: int(change.EndPos),
With: change.NewValue,
})
// Math symbols
"&#177;": "&plusmn;", // plus-minus
"&#215;": "&times;", // multiplication
"&#247;": "&divide;", // division
"&#8734;": "&infin;", // infinity
"&#8776;": "&asymp;", // almost equal
"&#8800;": "&ne;", // not equal
"&#8804;": "&le;", // less than or equal
"&#8805;": "&ge;", // greater than or equal
"&#8721;": "&sum;", // summation
"&#8730;": "&radic;", // square root
"&#8747;": "&int;", // integral
case "add_attribute":
// Insert after tag name, before > or />
commands = append(commands, utils.ReplaceCommand{
From: int(change.StartPos),
To: int(change.StartPos),
With: change.InsertText,
})
// Accented characters
"&#192;": "&Agrave;", // A grave
"&#193;": "&Aacute;", // A acute
"&#194;": "&Acirc;", // A circumflex
"&#195;": "&Atilde;", // A tilde
"&#196;": "&Auml;", // A umlaut
"&#197;": "&Aring;", // A ring
"&#198;": "&AElig;", // AE ligature
"&#199;": "&Ccedil;", // C cedilla
"&#200;": "&Egrave;", // E grave
"&#201;": "&Eacute;", // E acute
"&#202;": "&Ecirc;", // E circumflex
"&#203;": "&Euml;", // E umlaut
"&#204;": "&Igrave;", // I grave
"&#205;": "&Iacute;", // I acute
"&#206;": "&Icirc;", // I circumflex
"&#207;": "&Iuml;", // I umlaut
"&#208;": "&ETH;", // Eth
"&#209;": "&Ntilde;", // N tilde
"&#210;": "&Ograve;", // O grave
"&#211;": "&Oacute;", // O acute
"&#212;": "&Ocirc;", // O circumflex
"&#213;": "&Otilde;", // O tilde
"&#214;": "&Ouml;", // O umlaut
"&#216;": "&Oslash;", // O slash
"&#217;": "&Ugrave;", // U grave
"&#218;": "&Uacute;", // U acute
"&#219;": "&Ucirc;", // U circumflex
"&#220;": "&Uuml;", // U umlaut
"&#221;": "&Yacute;", // Y acute
"&#222;": "&THORN;", // Thorn
"&#223;": "&szlig;", // Sharp s
"&#224;": "&agrave;", // a grave
"&#225;": "&aacute;", // a acute
"&#226;": "&acirc;", // a circumflex
"&#227;": "&atilde;", // a tilde
"&#228;": "&auml;", // a umlaut
"&#229;": "&aring;", // a ring
"&#230;": "&aelig;", // ae ligature
"&#231;": "&ccedil;", // c cedilla
"&#232;": "&egrave;", // e grave
"&#233;": "&eacute;", // e acute
"&#234;": "&ecirc;", // e circumflex
"&#235;": "&euml;", // e umlaut
"&#236;": "&igrave;", // i grave
"&#237;": "&iacute;", // i acute
"&#238;": "&icirc;", // i circumflex
"&#239;": "&iuml;", // i umlaut
"&#240;": "&eth;", // eth
"&#241;": "&ntilde;", // n tilde
"&#242;": "&ograve;", // o grave
"&#243;": "&oacute;", // o acute
"&#244;": "&ocirc;", // o circumflex
"&#245;": "&otilde;", // o tilde
"&#246;": "&ouml;", // o umlaut
"&#248;": "&oslash;", // o slash
"&#249;": "&ugrave;", // u grave
"&#250;": "&uacute;", // u acute
"&#251;": "&ucirc;", // u circumflex
"&#252;": "&uuml;", // u umlaut
"&#253;": "&yacute;", // y acute
"&#254;": "&thorn;", // thorn
"&#255;": "&yuml;", // y umlaut
case "remove_attribute":
commands = append(commands, utils.ReplaceCommand{
From: int(change.StartPos),
To: int(change.EndPos),
With: "",
})
case "add_element":
commands = append(commands, utils.ReplaceCommand{
From: int(change.StartPos),
To: int(change.StartPos),
With: "\n" + change.InsertText,
})
case "remove_element":
commands = append(commands, utils.ReplaceCommand{
From: int(change.StartPos),
To: int(change.EndPos),
With: "",
})
}
}
result := xml
for numeric, named := range replacements {
result = strings.ReplaceAll(result, numeric, named)
}
return result
return commands
}
// deepCopyXMLElement creates a deep copy of an XMLElement
func deepCopyXMLElement(elem *XMLElement) *XMLElement {
if elem == nil {
return nil
}
copied := &XMLElement{
Tag: elem.Tag,
Text: elem.Text,
StartPos: elem.StartPos,
EndPos: elem.EndPos,
TextStart: elem.TextStart,
TextEnd: elem.TextEnd,
Attributes: make(map[string]XMLAttribute),
Children: make([]*XMLElement, len(elem.Children)),
}
for k, v := range elem.Attributes {
copied.Attributes[k] = v
}
for i, child := range elem.Children {
copied.Children[i] = deepCopyXMLElement(child)
}
return copied
}
// Helper function to parse numeric values
func parseNumeric(s string) (float64, bool) {
if f, err := strconv.ParseFloat(s, 64); err == nil {
return f, true
}
return 0, false
}
// Helper function to format numeric values
func formatNumeric(f float64) string {
if f == float64(int64(f)) {
return strconv.FormatInt(int64(f), 10)
}
return strconv.FormatFloat(f, 'f', -1, 64)
}
// ProcessXML applies Lua processing to XML content with surgical editing
func ProcessXML(content string, command utils.ModifyCommand, filename string) ([]utils.ReplaceCommand, error) {
processXMLLogger := xmlLogger.WithPrefix("ProcessXML").WithField("commandName", command.Name).WithField("file", filename)
processXMLLogger.Debug("Starting XML processing for file")
// Parse XML with position tracking
originalElem, err := parseXMLWithPositions(content)
if err != nil {
processXMLLogger.Error("Failed to parse XML: %v", err)
return nil, fmt.Errorf("failed to parse XML: %v", err)
}
processXMLLogger.Debug("Successfully parsed XML content")
// Create Lua state
L, err := NewLuaState()
if err != nil {
processXMLLogger.Error("Error creating Lua state: %v", err)
return nil, fmt.Errorf("error creating Lua state: %v", err)
}
defer L.Close()
// Set filename global
L.SetGlobal("file", lua.LString(filename))
// Create modifiable copy
modifiedElem := deepCopyXMLElement(originalElem)
// Convert to Lua table and set as global
luaTable := xmlElementToLuaTable(L, modifiedElem)
L.SetGlobal("root", luaTable)
processXMLLogger.Debug("Set XML data as Lua global 'root'")
// Build and execute Lua script
luaExpr := BuildJSONLuaScript(command.Lua, command.SourceDir) // Reuse JSON script builder
processXMLLogger.Debug("Built Lua script from expression: %q", command.Lua)
if err := L.DoString(luaExpr); err != nil {
processXMLLogger.Error("Lua script execution failed: %v\nScript: %s", err, luaExpr)
return nil, fmt.Errorf("lua script execution failed: %v", err)
}
processXMLLogger.Debug("Lua script executed successfully")
// Check if modification flag is set
modifiedVal := L.GetGlobal("modified")
if modifiedVal.Type() != lua.LTBool || !lua.LVAsBool(modifiedVal) {
processXMLLogger.Debug("Skipping - no modifications indicated by Lua script")
return nil, nil
}
// Get the modified data back from Lua
modifiedTable := L.GetGlobal("root")
if modifiedTable.Type() != lua.LTTable {
processXMLLogger.Error("Expected 'root' to be a table after Lua processing")
return nil, fmt.Errorf("expected 'root' to be a table after Lua processing")
}
// Apply Lua modifications back to XMLElement
luaTableToXMLElement(L, modifiedTable.(*lua.LTable), modifiedElem)
// Find changes between original and modified
changes := findXMLChanges(originalElem, modifiedElem, "")
processXMLLogger.Debug("Found %d changes", len(changes))
if len(changes) == 0 {
return nil, nil
}
// Generate surgical replace commands
commands := applyXMLChanges(changes)
processXMLLogger.Debug("Generated %d replace commands", len(commands))
return commands, nil
}
// xmlElementToLuaTable converts an XMLElement to a Lua table
func xmlElementToLuaTable(L *lua.LState, elem *XMLElement) *lua.LTable {
table := L.CreateTable(0, 4)
table.RawSetString("_tag", lua.LString(elem.Tag))
if len(elem.Attributes) > 0 {
attrs := L.CreateTable(0, len(elem.Attributes))
for name, attr := range elem.Attributes {
attrs.RawSetString(name, lua.LString(attr.Value))
}
table.RawSetString("_attr", attrs)
}
if len(elem.Children) > 0 {
children := L.CreateTable(len(elem.Children), 0)
for i, child := range elem.Children {
children.RawSetInt(i+1, xmlElementToLuaTable(L, child))
}
table.RawSetString("_children", children)
}
return table
}
// luaTableToXMLElement applies Lua table modifications back to XMLElement
func luaTableToXMLElement(L *lua.LState, table *lua.LTable, elem *XMLElement) {
// Update attributes
if attrVal := table.RawGetString("_attr"); attrVal.Type() == lua.LTTable {
attrTable := attrVal.(*lua.LTable)
// Clear and rebuild attributes
elem.Attributes = make(map[string]XMLAttribute)
attrTable.ForEach(func(key lua.LValue, value lua.LValue) {
if key.Type() == lua.LTString && value.Type() == lua.LTString {
attrName := string(key.(lua.LString))
attrValue := string(value.(lua.LString))
elem.Attributes[attrName] = XMLAttribute{Value: attrValue}
}
})
}
// Update children
if childrenVal := table.RawGetString("_children"); childrenVal.Type() == lua.LTTable {
childrenTable := childrenVal.(*lua.LTable)
newChildren := []*XMLElement{}
// Iterate over array indices
for i := 1; ; i++ {
childVal := childrenTable.RawGetInt(i)
if childVal.Type() == lua.LTNil {
break
}
if childVal.Type() == lua.LTTable {
if i-1 < len(elem.Children) {
// Update existing child
luaTableToXMLElement(L, childVal.(*lua.LTable), elem.Children[i-1])
newChildren = append(newChildren, elem.Children[i-1])
}
}
}
elem.Children = newChildren
}
}

View File

@@ -0,0 +1,346 @@
package processor
import (
"strings"
"testing"
"cook/utils"
)
// TestRealWorldGameXML tests with game-like XML structure
func TestRealWorldGameXML(t *testing.T) {
original := `<?xml version="1.0" encoding="utf-8"?>
<Items>
<Item name="Fiber" identifier="Item_Fiber" category="Resource">
<Icon texture="Items/Fiber.png" />
<Weight value="0.01" />
<MaxStack value="1000" />
<Description text="Soft plant fibers useful for crafting." />
</Item>
<Item name="Wood" identifier="Item_Wood" category="Resource">
<Icon texture="Items/Wood.png" />
<Weight value="0.05" />
<MaxStack value="500" />
<Description text="Basic building material." />
</Item>
</Items>`
// Parse
origElem, err := parseXMLWithPositions(original)
if err != nil {
t.Fatalf("Failed to parse: %v", err)
}
// Modify: Double all MaxStack values and change Wood weight
modElem := deepCopyXMLElement(origElem)
// Fiber MaxStack: 1000 → 2000
fiberItem := modElem.Children[0]
fiberMaxStack := fiberItem.Children[2]
valueAttr := fiberMaxStack.Attributes["value"]
valueAttr.Value = "2000"
fiberMaxStack.Attributes["value"] = valueAttr
// Wood MaxStack: 500 → 1000
woodItem := modElem.Children[1]
woodMaxStack := woodItem.Children[2]
valueAttr2 := woodMaxStack.Attributes["value"]
valueAttr2.Value = "1000"
woodMaxStack.Attributes["value"] = valueAttr2
// Wood Weight: 0.05 → 0.10
woodWeight := woodItem.Children[1]
weightAttr := woodWeight.Attributes["value"]
weightAttr.Value = "0.10"
woodWeight.Attributes["value"] = weightAttr
// Generate changes
changes := findXMLChanges(origElem, modElem, "")
if len(changes) != 3 {
t.Fatalf("Expected 3 changes, got %d", len(changes))
}
// Apply
commands := applyXMLChanges(changes)
result, _ := utils.ExecuteModifications(commands, original)
// Verify changes
if !strings.Contains(result, `<MaxStack value="2000"`) {
t.Errorf("Failed to update Fiber MaxStack")
}
if !strings.Contains(result, `<MaxStack value="1000"`) {
t.Errorf("Failed to update Wood MaxStack")
}
if !strings.Contains(result, `<Weight value="0.10"`) {
t.Errorf("Failed to update Wood Weight")
}
// Verify formatting preserved (check XML declaration and indentation)
if !strings.HasPrefix(result, `<?xml version="1.0" encoding="utf-8"?>`) {
t.Errorf("XML declaration not preserved")
}
if !strings.Contains(result, "\n <Item") {
t.Errorf("Indentation not preserved")
}
}
// TestAddRemoveMultipleChildren tests adding and removing multiple elements
func TestAddRemoveMultipleChildren(t *testing.T) {
original := `<inventory>
<item name="sword" />
<item name="shield" />
<item name="potion" />
<item name="scroll" />
</inventory>`
// Parse
origElem, err := parseXMLWithPositions(original)
if err != nil {
t.Fatalf("Failed to parse: %v", err)
}
// Remove middle two items, add a new one
modElem := deepCopyXMLElement(origElem)
// Remove shield and potion (indices 1 and 2)
modElem.Children = []*XMLElement{
modElem.Children[0], // sword
modElem.Children[3], // scroll
}
// Add a new item
newItem := &XMLElement{
Tag: "item",
Attributes: map[string]XMLAttribute{
"name": {Value: "helmet"},
},
Children: []*XMLElement{},
}
modElem.Children = append(modElem.Children, newItem)
// Generate changes
changes := findXMLChanges(origElem, modElem, "")
// The algorithm compares by matching indices:
// orig[0]=sword vs mod[0]=sword (no change)
// orig[1]=shield vs mod[1]=scroll (treated as replace - shows as attribute changes)
// orig[2]=potion vs mod[2]=helmet (treated as replace)
// orig[3]=scroll (removed)
// This is fine - the actual edits will be correct
if len(changes) == 0 {
t.Fatalf("Expected changes, got none")
}
// Apply
commands := applyXMLChanges(changes)
result, _ := utils.ExecuteModifications(commands, original)
// Verify
if strings.Contains(result, `name="shield"`) {
t.Errorf("Shield not removed")
}
if strings.Contains(result, `name="potion"`) {
t.Errorf("Potion not removed")
}
if !strings.Contains(result, `name="sword"`) {
t.Errorf("Sword incorrectly removed")
}
if !strings.Contains(result, `name="scroll"`) {
t.Errorf("Scroll incorrectly removed")
}
if !strings.Contains(result, `name="helmet"`) {
t.Errorf("Helmet not added")
}
}
// TestModifyAttributesAndText tests changing both attributes and text content
func TestModifyAttributesAndText(t *testing.T) {
original := `<weapon>
<item type="sword" damage="10">Iron Sword</item>
<item type="axe" damage="15">Battle Axe</item>
</weapon>`
// Parse
origElem, err := parseXMLWithPositions(original)
if err != nil {
t.Fatalf("Failed to parse: %v", err)
}
// Modify both items
modElem := deepCopyXMLElement(origElem)
// First item: change damage and text
item1 := modElem.Children[0]
dmgAttr := item1.Attributes["damage"]
dmgAttr.Value = "20"
item1.Attributes["damage"] = dmgAttr
item1.Text = "Steel Sword"
// Second item: change damage and type
item2 := modElem.Children[1]
dmgAttr2 := item2.Attributes["damage"]
dmgAttr2.Value = "30"
item2.Attributes["damage"] = dmgAttr2
typeAttr := item2.Attributes["type"]
typeAttr.Value = "greataxe"
item2.Attributes["type"] = typeAttr
// Generate and apply changes
changes := findXMLChanges(origElem, modElem, "")
commands := applyXMLChanges(changes)
result, _ := utils.ExecuteModifications(commands, original)
// Verify
if !strings.Contains(result, `damage="20"`) {
t.Errorf("First item damage not updated")
}
if !strings.Contains(result, "Steel Sword") {
t.Errorf("First item text not updated")
}
if !strings.Contains(result, `damage="30"`) {
t.Errorf("Second item damage not updated")
}
if !strings.Contains(result, `type="greataxe"`) {
t.Errorf("Second item type not updated")
}
if strings.Contains(result, "Iron Sword") {
t.Errorf("Old text still present")
}
}
// TestSelfClosingTagPreservation tests that self-closing tags work correctly
func TestSelfClosingTagPreservation(t *testing.T) {
original := `<root>
<item name="test" />
<empty></empty>
</root>`
// Parse
origElem, err := parseXMLWithPositions(original)
if err != nil {
t.Fatalf("Failed to parse: %v", err)
}
// Modify first item's attribute
modElem := deepCopyXMLElement(origElem)
item := modElem.Children[0]
nameAttr := item.Attributes["name"]
nameAttr.Value = "modified"
item.Attributes["name"] = nameAttr
// Generate and apply changes
changes := findXMLChanges(origElem, modElem, "")
commands := applyXMLChanges(changes)
result, _ := utils.ExecuteModifications(commands, original)
// Verify the change was made
if !strings.Contains(result, `name="modified"`) {
t.Errorf("Attribute not updated: %s", result)
}
}
// TestNumericAttributeModification tests numeric attribute changes
func TestNumericAttributeModification(t *testing.T) {
original := `<stats health="100" mana="50" stamina="75.5" />`
// Parse
origElem, err := parseXMLWithPositions(original)
if err != nil {
t.Fatalf("Failed to parse: %v", err)
}
// Double all numeric values
modElem := deepCopyXMLElement(origElem)
// Helper to modify numeric attributes
modifyNumericAttr := func(attrName string, multiplier float64) {
if attr, exists := modElem.Attributes[attrName]; exists {
if val, ok := parseNumeric(attr.Value); ok {
attr.Value = formatNumeric(val * multiplier)
modElem.Attributes[attrName] = attr
}
}
}
modifyNumericAttr("health", 2.0)
modifyNumericAttr("mana", 2.0)
modifyNumericAttr("stamina", 2.0)
// Generate and apply changes
changes := findXMLChanges(origElem, modElem, "")
if len(changes) != 3 {
t.Fatalf("Expected 3 changes, got %d", len(changes))
}
commands := applyXMLChanges(changes)
result, _ := utils.ExecuteModifications(commands, original)
// Verify numeric changes
if !strings.Contains(result, `health="200"`) {
t.Errorf("Health not doubled: %s", result)
}
if !strings.Contains(result, `mana="100"`) {
t.Errorf("Mana not doubled: %s", result)
}
if !strings.Contains(result, `stamina="151"`) {
t.Errorf("Stamina not doubled: %s", result)
}
}
// TestMinimalGitDiff verifies that only changed parts are modified
func TestMinimalGitDiff(t *testing.T) {
original := `<config>
<setting name="volume" value="50" />
<setting name="brightness" value="75" />
<setting name="contrast" value="100" />
</config>`
// Parse
origElem, err := parseXMLWithPositions(original)
if err != nil {
t.Fatalf("Failed to parse: %v", err)
}
// Change only brightness
modElem := deepCopyXMLElement(origElem)
brightnessItem := modElem.Children[1]
valueAttr := brightnessItem.Attributes["value"]
valueAttr.Value = "90"
brightnessItem.Attributes["value"] = valueAttr
// Generate changes
changes := findXMLChanges(origElem, modElem, "")
// Should be exactly 1 change
if len(changes) != 1 {
t.Fatalf("Expected exactly 1 change for minimal diff, got %d", len(changes))
}
if changes[0].OldValue != "75" || changes[0].NewValue != "90" {
t.Errorf("Wrong change detected: %v", changes[0])
}
// Apply
commands := applyXMLChanges(changes)
result, _ := utils.ExecuteModifications(commands, original)
// Calculate diff size (rough approximation)
diffChars := len(changes[0].OldValue) + len(changes[0].NewValue)
if diffChars > 10 {
t.Errorf("Diff too large: %d characters changed (expected < 10)", diffChars)
}
// Verify only brightness changed
if !strings.Contains(result, `value="50"`) {
t.Errorf("Volume incorrectly modified")
}
if !strings.Contains(result, `value="90"`) {
t.Errorf("Brightness not modified")
}
if !strings.Contains(result, `value="100"`) {
t.Errorf("Contrast incorrectly modified")
}
}

165
processor/xml_real_test.go Normal file
View File

@@ -0,0 +1,165 @@
package processor
import (
"os"
"strings"
"testing"
"cook/utils"
)
func TestRealAfflictionsXML(t *testing.T) {
// Read the real Afflictions.xml file
content, err := os.ReadFile("../testfiles/Afflictions.xml")
if err != nil {
t.Fatalf("Failed to read Afflictions.xml: %v", err)
}
original := string(content)
// Test 1: Double all maxstrength values using helper functions
command := utils.ModifyCommand{
Name: "double_maxstrength",
Lua: `
-- Double all maxstrength attributes in Affliction elements
local afflictions = findElements(root, "Affliction")
for _, affliction in ipairs(afflictions) do
modifyNumAttr(affliction, "maxstrength", function(val) return val * 2 end)
end
modified = true
`,
}
commands, err := ProcessXML(original, command, "Afflictions.xml")
if err != nil {
t.Fatalf("ProcessXML failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected modifications but got none")
}
t.Logf("Generated %d surgical modifications", len(commands))
// Apply modifications
result, count := utils.ExecuteModifications(commands, original)
t.Logf("Applied %d modifications", count)
// Verify specific changes
if !strings.Contains(result, `maxstrength="20"`) {
t.Errorf("Expected to find maxstrength=\"20\" (doubled from 10)")
}
if !strings.Contains(result, `maxstrength="480"`) {
t.Errorf("Expected to find maxstrength=\"480\" (doubled from 240)")
}
if !strings.Contains(result, `maxstrength="12"`) {
t.Errorf("Expected to find maxstrength=\"12\" (doubled from 6)")
}
// Verify formatting preserved (XML declaration should be there)
if !strings.Contains(result, `<?xml`) {
t.Errorf("XML declaration not preserved")
}
// Count lines to ensure structure preserved
origLines := len(strings.Split(original, "\n"))
resultLines := len(strings.Split(result, "\n"))
if origLines != resultLines {
t.Errorf("Line count changed: original %d, result %d", origLines, resultLines)
}
}
func TestRealAfflictionsAttributes(t *testing.T) {
// Read the real file
content, err := os.ReadFile("../testfiles/Afflictions.xml")
if err != nil {
t.Fatalf("Failed to read Afflictions.xml: %v", err)
}
original := string(content)
// Test 2: Modify resistance values using helper functions
command := utils.ModifyCommand{
Name: "increase_resistance",
Lua: `
-- Increase all minresistance and maxresistance by 50%
local effects = findElements(root, "Effect")
for _, effect in ipairs(effects) do
modifyNumAttr(effect, "minresistance", function(val) return val * 1.5 end)
modifyNumAttr(effect, "maxresistance", function(val) return val * 1.5 end)
end
modified = true
`,
}
commands, err := ProcessXML(original, command, "Afflictions.xml")
if err != nil {
t.Fatalf("ProcessXML failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected modifications but got none")
}
t.Logf("Generated %d surgical modifications", len(commands))
// Apply modifications
_, count := utils.ExecuteModifications(commands, original)
t.Logf("Applied %d modifications", count)
// Verify we made resistance modifications
if count < 10 {
t.Errorf("Expected at least 10 resistance modifications, got %d", count)
}
}
func TestRealAfflictionsNestedModifications(t *testing.T) {
// Read the real file
content, err := os.ReadFile("../testfiles/Afflictions.xml")
if err != nil {
t.Fatalf("Failed to read Afflictions.xml: %v", err)
}
original := string(content)
// Test 3: Modify nested Effect attributes using helper functions
command := utils.ModifyCommand{
Name: "modify_effects",
Lua: `
-- Double all amount values in ReduceAffliction elements
local reduces = findElements(root, "ReduceAffliction")
for _, reduce in ipairs(reduces) do
modifyNumAttr(reduce, "amount", function(val) return val * 2 end)
end
modified = true
`,
}
commands, err := ProcessXML(original, command, "Afflictions.xml")
if err != nil {
t.Fatalf("ProcessXML failed: %v", err)
}
if len(commands) == 0 {
t.Fatal("Expected modifications but got none")
}
t.Logf("Generated %d surgical modifications for nested elements", len(commands))
// Apply modifications
result, count := utils.ExecuteModifications(commands, original)
t.Logf("Applied %d modifications", count)
// Verify nested changes (0.001 * 2 = 0.002)
if !strings.Contains(result, `amount="0.002"`) {
t.Errorf("Expected to find amount=\"0.002\" (0.001 * 2)")
}
// Verify we modified the nested elements
if count < 8 {
t.Errorf("Expected at least 8 amount modifications, got %d", count)
}
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,4 +0,0 @@
// The package is now using github.com/antchfx/xmlquery for XPath parsing.
// The parsing functionality tests have been removed since we're now
// delegating XPath parsing to the xmlquery library.
package xpath

View File

@@ -1,4 +0,0 @@
// The package is now using github.com/antchfx/xmlquery for XPath parsing.
// The parsing functionality tests have been removed since we're now
// delegating XPath parsing to the xmlquery library.
package xpath

View File

@@ -1,133 +0,0 @@
package xpath
import (
"errors"
"fmt"
"github.com/antchfx/xmlquery"
)
// Get retrieves nodes from XML data using an XPath expression
func Get(node *xmlquery.Node, path string) ([]*xmlquery.Node, error) {
if node == nil {
return nil, errors.New("nil node provided")
}
// Execute xpath query directly
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return nil, fmt.Errorf("failed to execute XPath query: %v", err)
}
return nodes, nil
}
// Set updates a single node in the XML data using an XPath expression
func Set(node *xmlquery.Node, path string, value interface{}) error {
if node == nil {
return errors.New("nil node provided")
}
// Find the node to update
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return fmt.Errorf("failed to execute XPath query: %v", err)
}
if len(nodes) == 0 {
return fmt.Errorf("no nodes found for path: %s", path)
}
// Update the first matching node
updateNodeValue(nodes[0], value)
return nil
}
// SetAll updates all nodes that match the XPath expression
func SetAll(node *xmlquery.Node, path string, value interface{}) error {
if node == nil {
return errors.New("nil node provided")
}
// Find all nodes to update
nodes, err := xmlquery.QueryAll(node, path)
if err != nil {
return fmt.Errorf("failed to execute XPath query: %v", err)
}
if len(nodes) == 0 {
return fmt.Errorf("no nodes found for path: %s", path)
}
// Update all matching nodes
for _, matchNode := range nodes {
updateNodeValue(matchNode, value)
}
return nil
}
// Helper function to update a node's value
func updateNodeValue(node *xmlquery.Node, value interface{}) {
strValue := fmt.Sprintf("%v", value)
// Handle different node types
switch node.Type {
case xmlquery.AttributeNode:
// For attribute nodes, update the attribute value
parent := node.Parent
if parent != nil {
for i, attr := range parent.Attr {
if attr.Name.Local == node.Data {
parent.Attr[i].Value = strValue
break
}
}
}
case xmlquery.TextNode:
// For text nodes, update the text content
node.Data = strValue
case xmlquery.ElementNode:
// For element nodes, clear existing text children and add a new text node
// First, remove all existing text children
var nonTextChildren []*xmlquery.Node
for child := node.FirstChild; child != nil; child = child.NextSibling {
if child.Type != xmlquery.TextNode {
nonTextChildren = append(nonTextChildren, child)
}
}
// Clear all children
node.FirstChild = nil
node.LastChild = nil
// Add a new text node
textNode := &xmlquery.Node{
Type: xmlquery.TextNode,
Data: strValue,
Parent: node,
}
// Set the text node as the first child
node.FirstChild = textNode
node.LastChild = textNode
// Add back non-text children
for _, child := range nonTextChildren {
child.Parent = node
// If this is the first child being added back
if node.FirstChild == textNode && node.LastChild == textNode {
node.FirstChild.NextSibling = child
child.PrevSibling = node.FirstChild
node.LastChild = child
} else {
// Add to the end of the chain
node.LastChild.NextSibling = child
child.PrevSibling = node.LastChild
node.LastChild = child
}
}
}
}

View File

@@ -1,474 +0,0 @@
package xpath
import (
"strings"
"testing"
"github.com/antchfx/xmlquery"
)
// Parse test XML data once at the beginning for use in multiple tests
func parseTestXML(t *testing.T, xmlData string) *xmlquery.Node {
doc, err := xmlquery.Parse(strings.NewReader(xmlData))
if err != nil {
t.Fatalf("Failed to parse test XML: %v", err)
}
return doc
}
// XML test data as a string for our tests
var testXML = `
<store>
<book category="fiction">
<title lang="en">The Fellowship of the Ring</title>
<author>J.R.R. Tolkien</author>
<year>1954</year>
<price>22.99</price>
</book>
<book category="fiction">
<title lang="en">The Two Towers</title>
<author>J.R.R. Tolkien</author>
<year>1954</year>
<price>23.45</price>
</book>
<book category="technical">
<title lang="en">Learning XML</title>
<author>Erik T. Ray</author>
<year>2003</year>
<price>39.95</price>
</book>
<bicycle>
<color>red</color>
<price>199.95</price>
</bicycle>
</store>
`
func TestEvaluator(t *testing.T) {
// Parse the test XML data once for all test cases
doc := parseTestXML(t, testXML)
tests := []struct {
name string
path string
error bool
}{
{
name: "simple_element_access",
path: "/store/bicycle/color",
},
{
name: "recursive_element_access",
path: "//price",
},
{
name: "wildcard_element_access",
path: "/store/book/*",
},
{
name: "attribute_exists_predicate",
path: "//title[@lang]",
},
{
name: "attribute_equals_predicate",
path: "//title[@lang='en']",
},
{
name: "value_comparison_predicate",
path: "/store/book[price>35.00]/title",
error: true,
},
{
name: "last_predicate",
path: "/store/book[last()]/title",
error: true,
},
{
name: "last_minus_predicate",
path: "/store/book[last()-1]/title",
error: true,
},
{
name: "position_predicate",
path: "/store/book[position()<3]/title",
error: true,
},
{
name: "invalid_index",
path: "/store/book[10]/title",
error: true,
},
{
name: "nonexistent_element",
path: "/store/nonexistent",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := Get(doc, tt.path)
// Handle expected errors
if tt.error {
if err == nil && len(result) == 0 {
// If we expected an error but got empty results instead, that's okay
return
}
if err != nil {
// If we got an error as expected, that's okay
return
}
} else if err != nil {
// If we didn't expect an error but got one, that's a test failure
t.Errorf("Get(%q) returned unexpected error: %v", tt.path, err)
return
}
// Special cases where we don't care about exact matches
switch tt.name {
case "wildcard_element_access":
// Just check that we got some elements
if len(result) == 0 {
t.Errorf("Expected multiple elements for wildcard, got none")
}
return
case "attribute_exists_predicate", "attribute_equals_predicate":
// Just check that we got some titles
if len(result) == 0 {
t.Errorf("Expected titles with lang attribute, got none")
}
// Ensure all are title elements
for _, node := range result {
if node.Data != "title" {
t.Errorf("Expected title elements, got: %s", node.Data)
}
}
return
case "nonexistent_element":
// Just check that we got empty results
if len(result) != 0 {
t.Errorf("Expected empty results for nonexistent element, got %d items", len(result))
}
return
}
// For other cases, just verify we got results
if len(result) == 0 {
t.Errorf("Expected results for path %s, got none", tt.path)
}
})
}
}
func TestEdgeCases(t *testing.T) {
t.Run("nil_node", func(t *testing.T) {
result, err := Get(nil, "/store/book")
if err == nil {
t.Errorf("Expected error for nil node")
return
}
if len(result) > 0 {
t.Errorf("Expected empty result, got %v", result)
}
})
t.Run("invalid_xml", func(t *testing.T) {
invalidXML, err := xmlquery.Parse(strings.NewReader("<invalid>xml"))
if err != nil {
// If parsing fails, that's expected
return
}
_, err = Get(invalidXML, "/store")
if err == nil {
t.Error("Expected error for invalid XML structure")
}
})
// For these tests with the simple XML, we expect just one result
simpleXML := `<root><book><title lang="en">Test</title></book></root>`
doc := parseTestXML(t, simpleXML)
t.Run("current_node", func(t *testing.T) {
result, err := Get(doc, "/root/book/.")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) > 1 {
t.Errorf("Expected at most 1 result, got %d", len(result))
}
if len(result) > 0 {
// Verify it's the book node
if result[0].Data != "book" {
t.Errorf("Expected book node, got %v", result[0].Data)
}
}
})
t.Run("attributes", func(t *testing.T) {
result, err := Get(doc, "/root/book/title/@lang")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 || result[0].InnerText() != "en" {
t.Errorf("Expected 'en', got %v", result[0].InnerText())
}
})
}
func TestGetWithPaths(t *testing.T) {
// Use a simplified, well-formed XML document
simpleXML := `<store>
<book category="fiction">
<title lang="en">The Book Title</title>
<author>Author Name</author>
<price>19.99</price>
</book>
<bicycle>
<color>red</color>
<price>199.95</price>
</bicycle>
</store>`
// Parse the XML for testing
doc := parseTestXML(t, simpleXML)
// Debug: Print the test XML
t.Logf("Test XML:\n%s", simpleXML)
tests := []struct {
name string
path string
expectedValue string
}{
{
name: "simple_element_access",
path: "/store/bicycle/color",
expectedValue: "red",
},
{
name: "attribute_access",
path: "/store/book/title/@lang",
expectedValue: "en",
},
{
name: "recursive_with_attribute",
path: "//title[@lang='en']",
expectedValue: "The Book Title",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
// Debug: Print the path we're looking for
t.Logf("Looking for path: %s", tt.path)
result, err := Get(doc, tt.path)
if err != nil {
t.Errorf("Get(%q) returned error: %v", tt.path, err)
return
}
// Debug: Print the results
t.Logf("Got %d results", len(result))
for i, r := range result {
t.Logf("Result %d: Node=%s, Value=%v", i, r.Data, r.InnerText())
}
// Check that we got results
if len(result) == 0 {
t.Errorf("Get(%q) returned no results", tt.path)
return
}
// For attribute access test, do more specific checks
if tt.name == "attribute_access" {
// Check the first result's value matches expected
if result[0].InnerText() != tt.expectedValue {
t.Errorf("Attribute value: got %v, expected %s", result[0].InnerText(), tt.expectedValue)
}
}
// For simple element access, check the text content
if tt.name == "simple_element_access" {
if text := result[0].InnerText(); text != tt.expectedValue {
t.Errorf("Element text: got %s, expected %s", text, tt.expectedValue)
}
}
// For recursive with attribute test, check title elements with lang="en"
if tt.name == "recursive_with_attribute" {
for _, node := range result {
// Check the node is a title
if node.Data != "title" {
t.Errorf("Expected title element, got %s", node.Data)
}
// Check text content
if text := node.InnerText(); text != tt.expectedValue {
t.Errorf("Text content: got %s, expected %s", text, tt.expectedValue)
}
// Check attributes - find the lang attribute
hasLang := false
for _, attr := range node.Attr {
if attr.Name.Local == "lang" && attr.Value == "en" {
hasLang = true
break
}
}
if !hasLang {
t.Errorf("Expected lang=\"en\" attribute, but it was not found")
}
}
}
})
}
}
func TestSet(t *testing.T) {
t.Run("simple element", func(t *testing.T) {
xmlData := `<root><name>John</name></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/name", "Jane")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(doc, "/root/name")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 {
t.Errorf("Expected 1 result, got %d", len(result))
return
}
// Check text content
if text := result[0].InnerText(); text != "Jane" {
t.Errorf("Expected text 'Jane', got '%s'", text)
}
})
t.Run("attribute", func(t *testing.T) {
xmlData := `<root><element id="123"></element></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/element/@id", "456")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change
result, err := Get(doc, "/root/element/@id")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 1 {
t.Errorf("Expected 1 result, got %d", len(result))
return
}
// For attributes, check the inner text
if text := result[0].InnerText(); text != "456" {
t.Errorf("Expected attribute value '456', got '%s'", text)
}
})
t.Run("indexed element", func(t *testing.T) {
xmlData := `<root><items><item>first</item><item>second</item></items></root>`
doc := parseTestXML(t, xmlData)
err := Set(doc, "/root/items/item[1]", "changed")
if err != nil {
t.Errorf("Set() returned error: %v", err)
return
}
// Verify the change using XPath that specifically targets the first item
result, err := Get(doc, "/root/items/item[1]")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
// Check if we have results
if len(result) == 0 {
t.Errorf("Expected at least one result for /root/items/item[1]")
return
}
// Check text content
if text := result[0].InnerText(); text != "changed" {
t.Errorf("Expected text 'changed', got '%s'", text)
}
})
}
func TestSetAll(t *testing.T) {
t.Run("multiple elements", func(t *testing.T) {
xmlData := `<root><items><item>first</item><item>second</item></items></root>`
doc := parseTestXML(t, xmlData)
err := SetAll(doc, "//item", "changed")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Verify all items are changed
result, err := Get(doc, "//item")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 2 {
t.Errorf("Expected 2 results, got %d", len(result))
return
}
// Check each node
for i, node := range result {
if text := node.InnerText(); text != "changed" {
t.Errorf("Item %d: expected text 'changed', got '%s'", i, text)
}
}
})
t.Run("attributes", func(t *testing.T) {
xmlData := `<root><item id="1"/><item id="2"/></root>`
doc := parseTestXML(t, xmlData)
err := SetAll(doc, "//item/@id", "new")
if err != nil {
t.Errorf("SetAll() returned error: %v", err)
return
}
// Verify all attributes are changed
result, err := Get(doc, "//item/@id")
if err != nil {
t.Errorf("Get() returned error: %v", err)
return
}
if len(result) != 2 {
t.Errorf("Expected 2 results, got %d", len(result))
return
}
// For attributes, check inner text
for i, node := range result {
if text := node.InnerText(); text != "new" {
t.Errorf("Attribute %d: expected value 'new', got '%s'", i, text)
}
}
})
}

View File

@@ -0,0 +1,137 @@
package regression
import (
"cook/processor"
"cook/utils"
"os"
"path/filepath"
"testing"
)
func ApiAdaptor(content string, regex string, lua string) (string, int, int, error) {
command := utils.ModifyCommand{
Regex: regex,
Lua: lua,
LogLevel: "TRACE",
}
commands, err := processor.ProcessRegex(content, command, "test")
if err != nil {
return "", 0, 0, err
}
result, modifications := utils.ExecuteModifications(commands, content)
return result, modifications, len(commands), nil
}
func TestTalentsMechanicOutOfRange(t *testing.T) {
given := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="20" color="gui.green"/>
<Replace tag="[duration]" value="10" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="1"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="10.0"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
actual := `<Talent identifier="quickfixer">
<Icon texture="Content/UI/TalentsIcons2.png" sheetindex="5,2" sheetelementsize="128,128"/>
<Description tag="talentdescription.quickfixer">
<Replace tag="[amount]" value="30" color="gui.green"/>
<Replace tag="[duration]" value="20" color="gui.green"/>
</Description>
<Description tag="talentdescription.repairmechanicaldevicestwiceasfast"/>
<AbilityGroupEffect abilityeffecttype="None">
<Abilities>
<CharacterAbilityGiveStat stattype="MechanicalRepairSpeed" value="2"/>
</Abilities>
</AbilityGroupEffect>
<AbilityGroupEffect abilityeffecttype="OnRepairComplete">
<Conditions>
<AbilityConditionItem tags="fabricator,door,engine,oxygengenerator,pump,turretammosource,deconstructor,medicalfabricator,ductblock"/>
</Conditions>
<Abilities>
<CharacterAbilityApplyStatusEffects>
<StatusEffects>
<StatusEffect type="OnAbility" target="Character" disabledeltatime="true">
<Affliction identifier="quickfixer" amount="20"/>
</StatusEffect>
</StatusEffects>
</CharacterAbilityApplyStatusEffects>
</Abilities>
</AbilityGroupEffect>
</Talent>`
result, mods, matches, err := ApiAdaptor(given, `<Talent identifier="quickfixer">!anyvalue="(?<movementspeed>!num)"!anyvalue="(?<duration>!num)"!anyvalue="(?<repairspeed>!num)"!anyamount="(?<durationv>!num)"`, "movementspeed=round(movementspeed*1.5, 2) duration=round(duration*2, 2) repairspeed=round(repairspeed*2, 2) durationv=duration")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
if matches != 4 {
t.Errorf("Expected 4 matches, got %d", matches)
}
if mods != 4 {
t.Errorf("Expected 4 modifications, got %d", mods)
}
if result != actual {
t.Errorf("expected %s, got %s", actual, result)
}
}
func TestIndexExplosions_ShouldNotPanic(t *testing.T) {
cwd, err := os.Getwd()
if err != nil {
t.Fatalf("Error getting current working directory: %v", err)
}
given, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItems.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
expected, err := os.ReadFile(filepath.Join(cwd, "..", "testfiles", "OutpostItemsExpected.xml"))
if err != nil {
t.Fatalf("Error reading file: %v", err)
}
result, _, _, err := ApiAdaptor(string(given), `(?-s)LightComponent!anyrange="(!num)"`, "*4")
if err != nil {
t.Fatalf("Error processing content: %v", err)
}
// We don't really care how many god damn matches there are as long as the result is correct
// if matches != 45 {
// t.Errorf("Expected 45 match, got %d", matches)
// }
//
// if mods != 45 {
// t.Errorf("Expected 45 modification, got %d", mods)
// }
if string(result) != string(expected) {
t.Errorf("expected %s, got %s", expected, result)
}
}

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

View File

@@ -1,12 +0,0 @@
<config>
<item>
<value>75</value>
<multiplier>2</multiplier>
<divider>4</divider>
</item>
<item>
<value>150</value>
<multiplier>3</multiplier>
<divider>2</divider>
</item>
</config>

View File

@@ -1,37 +0,0 @@
<?xml version="1.0" encoding="UTF-8"?>
<testdata>
<!-- Numeric values -->
<item>
<id>1</id>
<value>200</value>
<price>24.99</price>
<quantity>5</quantity>
</item>
<!-- Text values -->
<item>
<id>2</id>
<name>Test Product</name>
<description>This is a test product description</description>
<category>Test</category>
</item>
<!-- Mixed content -->
<item>
<id>3</id>
<name>Mixed Product</name>
<price>19.99</price>
<code>PRD-123</code>
<tags>sale,discount,new</tags>
</item>
<!-- Empty and special values -->
<item>
<id>4</id>
<value></value>
<specialChars>Hello &amp; World &lt; &gt; &quot; &apos;</specialChars>
<multiline>Line 1
Line 2
Line 3</multiline>
</item>
</testdata>

11
test_surgical.yml Normal file
View File

@@ -0,0 +1,11 @@
- name: SurgicalWeightTest
json: true
lua: |
-- This demonstrates surgical JSON editing
-- Only the Weight field of Item_Fiber will be modified
data.Rows[1].Weight = 999
modified = true
files:
- 'D_Itemable.json'
reset: false
loglevel: INFO

74
testfiles/Afflictions.xml Normal file
View File

@@ -0,0 +1,74 @@
<?xml version="1.0" encoding="utf-8"?>
<Afflictions>
<Affliction name="" identifier="Cozy_Fire" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="10" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="10" strengthchange="-1.0">
<ReduceAffliction type="damage" amount="0.001" />
<ReduceAffliction type="bleeding" amount="0.001" />
<ReduceAffliction type="burn" amount="0.001" />
<ReduceAffliction type="bloodloss" amount="0.001" />
</Effect>
<icon texture="%ModDir%/Placable/Cozy_Fire.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="The_Bast_Defense" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="10" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="10" strengthchange="-1.0" resistancefor="damage" minresistance="0.05" maxresistance="0.05"></Effect>
<icon texture="%ModDir%/Placable/The_Bast_Defense.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="Clairvoyance" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="240" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="240" strengthchange="-1.0" resistancefor="stun" minresistance="0.15" maxresistance="0.15"></Effect>
<icon texture="%ModDir%/Placable/Clairvoyance.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="Heart_Lamp" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="10" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="10" strengthchange="-1.0">
<ReduceAffliction type="damage" amount="0.001" />
<ReduceAffliction type="bleeding" amount="0.001" />
<ReduceAffliction type="burn" amount="0.001" />
<ReduceAffliction type="bloodloss" amount="0.001" />
</Effect>
<icon texture="%ModDir%/Placable/Heart_Lamp.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="Star_in_a_Bottle_buff" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="10" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="10" strengthchange="-1.0" resistancefor="stun" minresistance="0.1" maxresistance="0.1"></Effect>
<icon texture="%ModDir%/Placable/Star_in_a_Bottle_buff.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="HappyF" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="10" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="10" strengthchange="-1.0" resistancefor="stun" minresistance="0.05" maxresistance="0.05" minspeedmultiplier="1.1" maxspeedmultiplier="1.1"></Effect>
<icon texture="%ModDir%/Placable/Happy.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="SharpenedF" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="240" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="240" strengthchange="-1.0">
<StatValue stattype="MeleeAttackMultiplier" value="0.25" />
</Effect>
<icon texture="%ModDir%/Placable/Sharpened.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="Sugar_RushF" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="240" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="240" strengthchange="-1.0" minspeedmultiplier="1.2" maxspeedmultiplier="1.2">
<StatValue stattype="MeleeAttackSpeed" value="0.05" />
<StatValue stattype="RangedAttackSpeed" value="0.05" />
</Effect>
<icon texture="%ModDir%/Placable/Sugar_Rush.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="Crimson_Effigy_buff" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="240" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="240" strengthchange="-1.0" resistancefor="damage" minresistance="-0.1" maxresistance="-0.1">
<StatValue stattype="MeleeAttackSpeed" value="0.15" />
<StatValue stattype="RangedAttackSpeed" value="0.15" />
</Effect>
<icon texture="%ModDir%/Placable/Crimson_Effigy_buff.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="Corruption_Effigy_buff" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="240" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="240" strengthchange="-1.0" minvitalitydecrease="0.2" multiplybymaxvitality="true" maxvitalitydecrease="0.2" resistancefor="damage" minresistance="0.1" maxresistance="0.1">
<StatValue stattype="AttackMultiplier" value="0.2" />
</Effect>
<icon texture="%ModDir%/Placable/Corruption_Effigy_buff.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="Effigy_of_Decay_buff" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="240" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="240" strengthchange="-1.0" resistancefor="oxygenlow" minresistance="1" maxresistance="1">
<StatusEffect target="Character" SpeedMultiplier="1.1" OxygenAvailable="1000.0" setvalue="true" />
<AbilityFlag flagtype="ImmuneToPressure" />
</Effect>
<icon texture="%ModDir%/Placable/Effigy_of_Decay_buff.png" sourcerect="0,0,64,64" origin="0,0" />
</Affliction>
<Affliction name="" identifier="Chlorophyte_Extractinator" type="strengthbuff" limbspecific="false" isbuff="true" maxstrength="6" hideiconafterdelay="true">
<Effect minstrength="0" maxstrength="6" strengthchange="-1.0"></Effect>
<icon texture="%ModDir%/Extractinator/Chlorophyte_Extractinator.png" sourcerect="0,0,144,152" origin="0,0" />
</Affliction>
</Afflictions>

1252
testfiles/OutpostItems.xml Normal file

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -1 +0,0 @@
<config><item><value>100</value></item></config>

View File

@@ -0,0 +1,8 @@
- name: "JSONFormattingTest"
json: true
lua: |
data.version = "2.0.0"
data.enabled = true
data.settings.timeout = 60
return true
files: ["testfiles/test3.json"]

View File

@@ -0,0 +1,15 @@
# Test with global JSON flag (no json: true in commands)
- name: "JSONArrayMultiply"
lua: |
for i, item in ipairs(data.items) do
data.items[i].value = item.value * 2
end
return true
files: ["testfiles/test2.json"]
- name: "JSONObjectUpdate"
lua: |
data.version = "3.0.0"
data.enabled = false
return true
files: ["testfiles/test2.json"]

View File

@@ -0,0 +1,32 @@
# Global modifiers
- modifiers:
multiply: 2.0
new_version: "2.0.0"
# JSON mode examples
- name: "JSONArrayMultiply"
json: true
lua: |
for i, item in ipairs(data.items) do
data.items[i].value = item.value * $multiply
end
return true
files: ["testfiles/test.json"]
- name: "JSONObjectUpdate"
json: true
lua: |
data.version = $new_version
data.enabled = true
return true
files: ["testfiles/test.json"]
- name: "JSONNestedModify"
json: true
lua: |
if data.settings and data.settings.performance then
data.settings.performance.multiplier = data.settings.performance.multiplier * 1.5
data.settings.performance.enabled = true
end
return true
files: ["testfiles/test.json"]

30
testfiles/test.json Normal file
View File

@@ -0,0 +1,30 @@
{
"name": "test-config",
"version": "1.0.0",
"enabled": false,
"settings": {
"timeout": 30,
"retries": 3,
"performance": {
"multiplier": 1.0,
"enabled": false
}
},
"items": [
{
"id": 1,
"name": "item1",
"value": 10
},
{
"id": 2,
"name": "item2",
"value": 20
},
{
"id": 3,
"name": "item3",
"value": 30
}
]
}

30
testfiles/test2.json Normal file
View File

@@ -0,0 +1,30 @@
{
"enabled": false,
"items": [
{
"id": 1,
"name": "item1",
"value": 80
},
{
"id": 2,
"name": "item2",
"value": 160
},
{
"id": 3,
"name": "item3",
"value": 240
}
],
"name": "test-config",
"settings": {
"performance": {
"enabled": true,
"multiplier": 1.5
},
"retries": 3,
"timeout": 30
},
"version": "3.0.0"
}

25
testfiles/test3.json Normal file
View File

@@ -0,0 +1,25 @@
{
"enabled": true,
"items": [
{
"id": 1,
"name": "item1",
"value": 10
},
{
"id": 2,
"name": "item2",
"value": 20
}
],
"name": "test-config",
"settings": {
"performance": {
"enabled": false,
"multiplier": 1
},
"retries": 3,
"timeout": 60
},
"version": "2.0.0"
}

View File

@@ -0,0 +1,25 @@
{
"enabled": true,
"items": [
{
"id": 1,
"name": "item1",
"value": 10
},
{
"id": 2,
"name": "item2",
"value": 20
}
],
"name": "test-config",
"settings": {
"performance": {
"enabled": false,
"multiplier": 1
},
"retries": 3,
"timeout": 60
},
"version": "2.0.0"
}

25
testfiles/test4.json Normal file
View File

@@ -0,0 +1,25 @@
{
"name": "test-config",
"version": "1.0.0",
"enabled": false,
"settings": {
"timeout": 30,
"retries": 3,
"performance": {
"multiplier": 1.0,
"enabled": false
}
},
"items": [
{
"id": 1,
"name": "item1",
"value": 10
},
{
"id": 2,
"name": "item2",
"value": 20
}
]
}

502
toml_test.go Normal file
View File

@@ -0,0 +1,502 @@
package main
import (
"os"
"path/filepath"
"testing"
"cook/utils"
"github.com/stretchr/testify/assert"
)
func TestTOMLLoadBasic(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-basic-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create a simple TOML test file
tomlContent := `[[commands]]
name = "SimpleTest"
regex = "test = !num"
lua = "v1 * 2"
files = ["test.txt"]
[[commands]]
name = "AnotherTest"
regex = "value = (!num)"
lua = "v1 + 10"
files = ["*.txt"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, _, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 2, "Should load 2 commands from TOML")
// Verify first command
assert.Equal(t, "SimpleTest", commands[0].Name, "First command name should match")
assert.Equal(t, "test = !num", commands[0].Regex, "First command regex should match")
assert.Equal(t, "v1 * 2", commands[0].Lua, "First command Lua should match")
assert.Equal(t, []string{"test.txt"}, commands[0].Files, "First command files should match")
// Verify second command
assert.Equal(t, "AnotherTest", commands[1].Name, "Second command name should match")
assert.Equal(t, "value = (!num)", commands[1].Regex, "Second command regex should match")
assert.Equal(t, "v1 + 10", commands[1].Lua, "Second command Lua should match")
assert.Equal(t, []string{"*.txt"}, commands[1].Files, "Second command files should match")
}
func TestTOMLGlobalModifiers(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-global-modifiers-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create TOML content with global variables
tomlContent := `[variables]
multiplier = 3
prefix = "TEST_"
enabled = true
[[commands]]
name = "UseGlobalModifiers"
regex = "value = !num"
lua = "v1 * multiplier; s1 = prefix .. s1"
files = ["test.txt"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, variables, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 1, "Should load 1 command from TOML")
assert.Len(t, variables, 3, "Should load 3 variables")
// Verify variables
assert.Equal(t, int64(3), variables["multiplier"], "Multiplier should be 3")
assert.Equal(t, "TEST_", variables["prefix"], "Prefix should be TEST_")
assert.Equal(t, true, variables["enabled"], "Enabled should be true")
// Verify regular command
assert.Equal(t, "UseGlobalModifiers", commands[0].Name, "Regular command name should match")
assert.Equal(t, "value = !num", commands[0].Regex, "Regular command regex should match")
}
func TestTOMLMultilineRegex(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-multiline-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create TOML content with multiline regex using literal strings
tomlContent := `[variables]
factor = 2.5
[[commands]]
name = "MultilineTest"
regex = '''
\[config\.settings\]
depth = !num
width = !num
height = !num'''
lua = "v1 * factor"
files = ["test.conf"]
isolate = true
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Create test file that matches the multiline pattern
testContent := `[config.settings]
depth = 10
width = 20
height = 30
`
testFile := filepath.Join(tmpDir, "test.conf")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, variables, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 1, "Should load 1 command from TOML")
assert.Len(t, variables, 1, "Should load 1 variable")
// Verify the multiline regex command
multilineCmd := commands[0]
assert.Equal(t, "MultilineTest", multilineCmd.Name, "Command name should match")
assert.Contains(t, multilineCmd.Regex, "\\[config\\.settings\\]", "Regex should contain escaped brackets")
assert.Contains(t, multilineCmd.Regex, "depth = !num", "Regex should contain depth pattern")
assert.Contains(t, multilineCmd.Regex, "width = !num", "Regex should contain width pattern")
assert.Contains(t, multilineCmd.Regex, "height = !num", "Regex should contain height pattern")
assert.Contains(t, multilineCmd.Regex, "\n", "Regex should contain newlines")
assert.True(t, multilineCmd.Isolate, "Isolate should be true")
// Verify the regex preserves proper structure
expectedLines := []string{
"\\[config\\.settings\\]",
"depth = !num",
"width = !num",
"height = !num",
}
for _, line := range expectedLines {
assert.Contains(t, multilineCmd.Regex, line, "Regex should contain: "+line)
}
}
func TestTOMLComplexRegexPatterns(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-complex-regex-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create TOML content with complex regex patterns
tomlContent := `[[commands]]
name = "ComplexPatterns"
regexes = [
"\\[section\\.([^\\]]+)\\]",
"(?P<key>\\w+)\\s*=\\s*(?P<value>\\d+\\.\\d+)",
"network\\.(\\w+)\\.(enable|disable)"
]
lua = "if is_number(value) then value = num(value) * 1.1 end; return true"
files = ["*.conf", "*.ini"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, _, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 1, "Should load 1 command from TOML")
// Verify the complex regex command
cmd := commands[0]
assert.Equal(t, "ComplexPatterns", cmd.Name, "Command name should match")
assert.Len(t, cmd.Regexes, 3, "Should have 3 regex patterns")
// Verify each regex pattern
assert.Equal(t, `\[section\.([^\]]+)\]`, cmd.Regexes[0], "First regex should match section pattern")
assert.Equal(t, `(?P<key>\w+)\s*=\s*(?P<value>\d+\.\d+)`, cmd.Regexes[1], "Second regex should match key-value pattern")
assert.Equal(t, `network\.(\w+)\.(enable|disable)`, cmd.Regexes[2], "Third regex should match network pattern")
assert.Equal(t, []string{"*.conf", "*.ini"}, cmd.Files, "Files should match")
}
func TestTOMLJSONMode(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-json-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create TOML content with JSON mode commands
tomlContent := `[[commands]]
name = "JSONMultiply"
json = true
lua = "for i, item in ipairs(data.items) do data.items[i].value = item.value * 2 end; return true"
files = ["data.json"]
[[commands]]
name = "JSONObjectUpdate"
json = true
lua = "data.version = '2.0.0'; data.enabled = true; return true"
files = ["config.json"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test loading TOML commands
commands, _, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 2, "Should load 2 commands from TOML")
// Verify first JSON command
cmd1 := commands[0]
assert.Equal(t, "JSONMultiply", cmd1.Name, "First command name should match")
assert.True(t, cmd1.JSON, "First command should have JSON mode enabled")
assert.Equal(t, "for i, item in ipairs(data.items) do data.items[i].value = item.value * 2 end; return true", cmd1.Lua, "First command Lua should match")
assert.Equal(t, []string{"data.json"}, cmd1.Files, "First command files should match")
// Verify second JSON command
cmd2 := commands[1]
assert.Equal(t, "JSONObjectUpdate", cmd2.Name, "Second command name should match")
assert.True(t, cmd2.JSON, "Second command should have JSON mode enabled")
assert.Equal(t, "data.version = '2.0.0'; data.enabled = true; return true", cmd2.Lua, "Second command Lua should match")
assert.Equal(t, []string{"config.json"}, cmd2.Files, "Second command files should match")
}
func TestTOMLEndToEndIntegration(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-integration-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Create comprehensive TOML content
tomlContent := `[variables]
multiplier = 4
base_value = 100
[[commands]]
name = "IntegrationTest"
regex = '''
\[kinetics\.stressValues\.v2\.capacity\]
steam_engine = !num
water_wheel = !num
copper_valve_handle = !num'''
lua = "v1 * multiplier"
files = ["test.txt"]
isolate = true
[[commands]]
name = "SimplePattern"
regex = "enabled = (true|false)"
lua = "= false"
files = ["test.txt"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
if err != nil {
t.Fatalf("Failed to write TOML test file: %v", err)
}
// Create test file that matches the patterns
testContent := `[kinetics.stressValues.v2.capacity]
steam_engine = 256
water_wheel = 64
copper_valve_handle = 16
some_other_setting = enabled = true
`
testFile := filepath.Join(tmpDir, "test.txt")
err = os.WriteFile(testFile, []byte(testContent), 0644)
if err != nil {
t.Fatalf("Failed to write test file: %v", err)
}
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test the complete workflow using the main function
commands, variables, err := utils.LoadCommands([]string{"test.toml"})
assert.NoError(t, err, "Should load TOML commands without error")
assert.Len(t, commands, 2, "Should load 2 commands")
assert.Len(t, variables, 2, "Should load 2 variables")
// Associate files with commands
files := []string{"test.txt"}
associations, err := utils.AssociateFilesWithCommands(files, commands)
assert.NoError(t, err, "Should associate files with commands")
// Verify associations
association := associations["test.txt"]
assert.Len(t, association.IsolateCommands, 1, "Should have 1 isolate command")
assert.Len(t, association.Commands, 1, "Should have 1 regular command")
assert.Equal(t, "IntegrationTest", association.IsolateCommands[0].Name, "Isolate command should match")
assert.Equal(t, "SimplePattern", association.Commands[0].Name, "Regular command should match")
t.Logf("TOML integration test completed successfully")
t.Logf("Loaded %d commands from TOML", len(commands))
t.Logf("Associated commands: %d isolate, %d regular",
len(association.IsolateCommands), len(association.Commands))
}
func TestTOMLErrorHandling(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "toml-error-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test 1: Invalid TOML syntax
invalidTOML := `[[commands]]
name = "Invalid"
regex = "test = !num"
lua = "v1 * 2"
files = ["test.txt"
# Missing closing bracket
`
invalidFile := filepath.Join(tmpDir, "invalid.toml")
err = os.WriteFile(invalidFile, []byte(invalidTOML), 0644)
assert.NoError(t, err, "Should write invalid TOML file")
commands, _, err := utils.LoadCommandsFromTomlFiles("invalid.toml")
assert.Error(t, err, "Should return error for invalid TOML syntax")
assert.Nil(t, commands, "Should return nil commands for invalid TOML")
assert.Contains(t, err.Error(), "failed to unmarshal TOML file", "Error should mention TOML unmarshaling")
// Test 2: Non-existent file
commands, _, err = utils.LoadCommandsFromTomlFiles("nonexistent.toml")
assert.NoError(t, err, "Should handle non-existent file without error")
assert.Empty(t, commands, "Should return empty commands for non-existent file")
// Test 3: Empty TOML file returns no commands (not an error)
emptyFile := filepath.Join(tmpDir, "empty.toml")
err = os.WriteFile(emptyFile, []byte(""), 0644)
assert.NoError(t, err, "Should write empty TOML file")
commands, _, err = utils.LoadCommandsFromTomlFiles("empty.toml")
assert.NoError(t, err, "Empty TOML should not return error")
assert.Empty(t, commands, "Should return empty commands for empty TOML")
}
func TestYAMLToTOMLConversion(t *testing.T) {
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "yaml-to-toml-conversion-test")
if err != nil {
t.Fatalf("Failed to create temp dir: %v", err)
}
defer os.RemoveAll(tmpDir)
// Change to temp directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Create a test YAML file
yamlContent := `variables:
multiplier: 2.5
prefix: "CONV_"
commands:
- name: "ConversionTest"
regex: "value = !num"
lua: "v1 * 3"
files: ["test.txt"]
loglevel: DEBUG
- name: "AnotherTest"
regex: "enabled = (true|false)"
lua: "= false"
files: ["*.conf"]
`
yamlFile := filepath.Join(tmpDir, "test.yml")
err = os.WriteFile(yamlFile, []byte(yamlContent), 0644)
assert.NoError(t, err, "Should write YAML test file")
// Test conversion
err = utils.ConvertYAMLToTOML("test.yml")
assert.NoError(t, err, "Should convert YAML to TOML without error")
// Check that TOML file was created
tomlFile := filepath.Join(tmpDir, "test.toml")
_, err = os.Stat(tomlFile)
assert.NoError(t, err, "TOML file should exist after conversion")
// Read and verify TOML content
tomlData, err := os.ReadFile(tomlFile)
assert.NoError(t, err, "Should read TOML file")
tomlContent := string(tomlData)
assert.Contains(t, tomlContent, `name = "ConversionTest"`, "TOML should contain first command name")
assert.Contains(t, tomlContent, `name = "AnotherTest"`, "TOML should contain second command name")
assert.Contains(t, tomlContent, `[variables]`, "TOML should contain variables section")
assert.Contains(t, tomlContent, `multiplier = 2.5`, "TOML should contain multiplier")
assert.Contains(t, tomlContent, `prefix = "CONV_"`, "TOML should contain prefix")
// Test that converted TOML loads correctly
commands, variables, err := utils.LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err, "Should load converted TOML without error")
assert.Len(t, commands, 2, "Should load 2 commands from converted TOML")
assert.Len(t, variables, 2, "Should have 2 variables")
// Variables are now loaded separately, not as part of commands
// Test skip functionality - run conversion again
err = utils.ConvertYAMLToTOML("test.yml")
assert.NoError(t, err, "Should handle existing TOML file without error")
// Verify original TOML file wasn't modified
originalTomlData, err := os.ReadFile(tomlFile)
assert.NoError(t, err, "Should read TOML file again")
assert.Equal(t, tomlData, originalTomlData, "TOML file content should be unchanged")
t.Logf("YAML to TOML conversion test completed successfully")
}

162
utils/db.go Normal file
View File

@@ -0,0 +1,162 @@
package utils
import (
"errors"
"path/filepath"
"time"
logger "git.site.quack-lab.dev/dave/cylogger"
"gorm.io/driver/sqlite"
"gorm.io/gorm"
gormlogger "gorm.io/gorm/logger"
)
// dbLogger is a scoped logger for the utils/db package.
var dbLogger = logger.Default.WithPrefix("utils/db")
type DB interface {
DB() *gorm.DB
Raw(sql string, args ...any) *gorm.DB
SaveFile(filePath string, fileData []byte) error
GetFile(filePath string) ([]byte, error)
GetAllFiles() ([]FileSnapshot, error)
RemoveAllFiles() error
}
type FileSnapshot struct {
Date time.Time `gorm:"primaryKey"`
FilePath string `gorm:"primaryKey"`
FileData []byte `gorm:"type:blob"`
}
type DBWrapper struct {
db *gorm.DB
}
var globalDB *DBWrapper
func GetDB() (DB, error) {
getDBLogger := dbLogger.WithPrefix("GetDB")
getDBLogger.Debug("Attempting to get database connection")
var err error
dbFile := filepath.Join("data.sqlite")
getDBLogger.Debug("Opening database file: %q", dbFile)
getDBLogger.Trace("Database configuration: PrepareStmt=true, GORM logger=Silent")
db, err := gorm.Open(sqlite.Open(dbFile), &gorm.Config{
// SkipDefaultTransaction: true,
PrepareStmt: true,
Logger: gormlogger.Default.LogMode(gormlogger.Silent),
})
if err != nil {
getDBLogger.Error("Failed to open database file %q: %v", dbFile, err)
return nil, err
}
getDBLogger.Debug("Database opened successfully, running auto migration for FileSnapshot model")
if err := db.AutoMigrate(&FileSnapshot{}); err != nil {
getDBLogger.Error("Auto migration failed for FileSnapshot model: %v", err)
return nil, err
}
getDBLogger.Info("Database initialized and migrated successfully")
globalDB = &DBWrapper{db: db}
getDBLogger.Debug("Database wrapper initialized and cached globally")
return globalDB, nil
}
// Just a wrapper
func (db *DBWrapper) Raw(sql string, args ...any) *gorm.DB {
rawLogger := dbLogger.WithPrefix("Raw").WithField("sql", sql)
rawLogger.Debug("Executing raw SQL query with args: %v", args)
return db.db.Raw(sql, args...)
}
func (db *DBWrapper) DB() *gorm.DB {
dbLogger.WithPrefix("DB").Debug("Returning GORM DB instance")
return db.db
}
func (db *DBWrapper) FileExists(filePath string) (bool, error) {
fileExistsLogger := dbLogger.WithPrefix("FileExists").WithField("filePath", filePath)
fileExistsLogger.Debug("Checking if file exists in database")
var count int64
err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).Count(&count).Error
if err != nil {
fileExistsLogger.Error("Error checking if file exists: %v", err)
return false, err
}
fileExistsLogger.Debug("File exists: %t", count > 0)
return count > 0, err
}
func (db *DBWrapper) SaveFile(filePath string, fileData []byte) error {
saveFileLogger := dbLogger.WithPrefix("SaveFile").WithField("filePath", filePath).WithField("dataSize", len(fileData))
saveFileLogger.Debug("Attempting to save file to database")
saveFileLogger.Trace("File data length: %d", len(fileData))
exists, err := db.FileExists(filePath)
if err != nil {
saveFileLogger.Error("Error checking if file exists: %v", err)
return err
}
if exists {
saveFileLogger.Debug("File already exists in database, skipping save to avoid overwriting original snapshot")
return nil
}
saveFileLogger.Debug("Creating new file snapshot in database")
err = db.db.Create(&FileSnapshot{
Date: time.Now(),
FilePath: filePath,
FileData: fileData,
}).Error
if err != nil {
saveFileLogger.Error("Failed to create file snapshot: %v", err)
} else {
saveFileLogger.Info("File successfully saved to database")
}
return err
}
func (db *DBWrapper) GetFile(filePath string) ([]byte, error) {
getFileLogger := dbLogger.WithPrefix("GetFile").WithField("filePath", filePath)
getFileLogger.Debug("Getting file from database")
var fileSnapshot FileSnapshot
err := db.db.Model(&FileSnapshot{}).Where("file_path = ?", filePath).First(&fileSnapshot).Error
if err != nil {
if errors.Is(err, gorm.ErrRecordNotFound) {
getFileLogger.Debug("File not found in database: %v", err)
} else {
getFileLogger.Warning("Failed to get file from database: %v", err)
}
return nil, err
}
getFileLogger.Debug("File found in database")
getFileLogger.Trace("Retrieved file data length: %d", len(fileSnapshot.FileData))
return fileSnapshot.FileData, nil
}
func (db *DBWrapper) GetAllFiles() ([]FileSnapshot, error) {
getAllFilesLogger := dbLogger.WithPrefix("GetAllFiles")
getAllFilesLogger.Debug("Getting all files from database")
var fileSnapshots []FileSnapshot
err := db.db.Model(&FileSnapshot{}).Find(&fileSnapshots).Error
if err != nil {
getAllFilesLogger.Error("Failed to get all files from database: %v", err)
return nil, err
}
getAllFilesLogger.Debug("Found %d files in database", len(fileSnapshots))
getAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
return fileSnapshots, nil
}
func (db *DBWrapper) RemoveAllFiles() error {
removeAllFilesLogger := dbLogger.WithPrefix("RemoveAllFiles")
removeAllFilesLogger.Debug("Removing all files from database")
err := db.db.Exec("DELETE FROM file_snapshots").Error
if err != nil {
removeAllFilesLogger.Error("Failed to remove all files from database: %v", err)
} else {
removeAllFilesLogger.Debug("All files removed from database")
}
return err
}

106
utils/file.go Normal file
View File

@@ -0,0 +1,106 @@
package utils
import (
"os"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// fileLogger is a scoped logger for the utils/file package.
var fileLogger = logger.Default.WithPrefix("utils/file")
// LimitString truncates a string to maxLen and adds "..." if truncated
func LimitString(s string, maxLen int) string {
limitStringLogger := fileLogger.WithPrefix("LimitString").WithField("originalLength", len(s)).WithField("maxLength", maxLen)
limitStringLogger.Debug("Limiting string length")
s = strings.ReplaceAll(s, "\n", "\\n")
if len(s) <= maxLen {
limitStringLogger.Trace("String length (%d) is within max length (%d), no truncation", len(s), maxLen)
return s
}
limited := s[:maxLen-3] + "..."
limitStringLogger.Trace("String truncated from %d to %d characters: %q", len(s), len(limited), limited)
return limited
}
func ResetWhereNecessary(associations map[string]FileCommandAssociation, db DB) error {
resetWhereNecessaryLogger := fileLogger.WithPrefix("ResetWhereNecessary")
resetWhereNecessaryLogger.Debug("Starting reset where necessary operation")
resetWhereNecessaryLogger.Trace("File-command associations input: %v", associations)
dirtyFiles := make(map[string]struct{})
for _, association := range associations {
resetWhereNecessaryLogger.Debug("Processing association for file: %q", association.File)
for _, command := range association.Commands {
resetWhereNecessaryLogger.Debug("Checking command %q for reset requirement", command.Name)
resetWhereNecessaryLogger.Trace("Command details: %v", command)
if command.Reset {
resetWhereNecessaryLogger.Debug("Command %q requires reset for file %q, marking as dirty", command.Name, association.File)
dirtyFiles[association.File] = struct{}{}
}
}
for _, command := range association.IsolateCommands {
resetWhereNecessaryLogger.Debug("Checking isolate command %q for reset requirement", command.Name)
resetWhereNecessaryLogger.Trace("Isolate command details: %v", command)
if command.Reset {
resetWhereNecessaryLogger.Debug("Isolate command %q requires reset for file %q, marking as dirty", command.Name, association.File)
dirtyFiles[association.File] = struct{}{}
}
}
}
resetWhereNecessaryLogger.Debug("Identified %d files that need to be reset", len(dirtyFiles))
resetWhereNecessaryLogger.Trace("Dirty files identified: %v", dirtyFiles)
for file := range dirtyFiles {
resetWhereNecessaryLogger.Debug("Resetting file %q", file)
fileData, err := db.GetFile(file)
if err != nil {
resetWhereNecessaryLogger.Warning("Failed to get original content for file %q from database: %v", file, err)
// Seed the snapshot from current disk content if missing, then use it as fallback
currentData, readErr := os.ReadFile(file)
if readErr != nil {
resetWhereNecessaryLogger.Warning("Additionally failed to read current file content for %q: %v", file, readErr)
continue
}
// Best-effort attempt to save baseline; ignore errors to avoid blocking reset
if saveErr := db.SaveFile(file, currentData); saveErr != nil {
resetWhereNecessaryLogger.Warning("Failed to seed baseline snapshot for %q: %v", file, saveErr)
}
fileData = currentData
}
resetWhereNecessaryLogger.Trace("Retrieved original file data length for %q: %d", file, len(fileData))
resetWhereNecessaryLogger.Debug("Writing original content back to file %q", file)
err = os.WriteFile(file, fileData, 0644)
if err != nil {
resetWhereNecessaryLogger.Warning("Failed to write original content back to file %q: %v", file, err)
continue
}
resetWhereNecessaryLogger.Debug("Successfully reset file %q", file)
}
resetWhereNecessaryLogger.Debug("Finished reset where necessary operation")
return nil
}
func ResetAllFiles(db DB) error {
resetAllFilesLogger := fileLogger.WithPrefix("ResetAllFiles")
resetAllFilesLogger.Debug("Starting reset all files operation")
fileSnapshots, err := db.GetAllFiles()
if err != nil {
resetAllFilesLogger.Error("Failed to get all file snapshots from database: %v", err)
return err
}
resetAllFilesLogger.Debug("Found %d files in database to reset", len(fileSnapshots))
resetAllFilesLogger.Trace("File snapshots retrieved: %v", fileSnapshots)
for _, fileSnapshot := range fileSnapshots {
resetAllFilesLogger.Debug("Resetting file %q", fileSnapshot.FilePath)
err = os.WriteFile(fileSnapshot.FilePath, fileSnapshot.FileData, 0644)
if err != nil {
resetAllFilesLogger.Warning("Failed to write file %q to disk: %v", fileSnapshot.FilePath, err)
continue
}
resetAllFilesLogger.Debug("File %q written to disk successfully", fileSnapshot.FilePath)
}
resetAllFilesLogger.Debug("Finished reset all files operation")
return nil
}

209
utils/file_test.go Normal file
View File

@@ -0,0 +1,209 @@
package utils
import (
"os"
"path/filepath"
"testing"
"github.com/stretchr/testify/assert"
)
func TestLimitString(t *testing.T) {
tests := []struct {
name string
input string
maxLen int
expected string
}{
{
name: "Short string",
input: "hello",
maxLen: 10,
expected: "hello",
},
{
name: "Exact length",
input: "hello",
maxLen: 5,
expected: "hello",
},
{
name: "Too long",
input: "hello world",
maxLen: 8,
expected: "hello...",
},
{
name: "With newlines",
input: "hello\nworld",
maxLen: 20,
expected: "hello\\nworld",
},
{
name: "With newlines truncated",
input: "hello\nworld\nfoo\nbar",
maxLen: 15,
expected: "hello\\nworld...",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result := LimitString(tt.input, tt.maxLen)
assert.Equal(t, tt.expected, result)
})
}
}
func TestResetWhereNecessary(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "reset-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create test files
file1 := filepath.Join(tmpDir, "file1.txt")
file2 := filepath.Join(tmpDir, "file2.txt")
file3 := filepath.Join(tmpDir, "file3.txt")
err = os.WriteFile(file1, []byte("original1"), 0644)
assert.NoError(t, err)
err = os.WriteFile(file2, []byte("original2"), 0644)
assert.NoError(t, err)
err = os.WriteFile(file3, []byte("original3"), 0644)
assert.NoError(t, err)
// Modify files
err = os.WriteFile(file1, []byte("modified1"), 0644)
assert.NoError(t, err)
err = os.WriteFile(file2, []byte("modified2"), 0644)
assert.NoError(t, err)
// Create mock DB
db, err := GetDB()
assert.NoError(t, err)
err = db.SaveFile(file1, []byte("original1"))
assert.NoError(t, err)
err = db.SaveFile(file2, []byte("original2"))
assert.NoError(t, err)
// file3 not in DB
// Create associations with reset commands
associations := map[string]FileCommandAssociation{
file1: {
File: file1,
Commands: []ModifyCommand{
{Name: "cmd1", Reset: true},
},
},
file2: {
File: file2,
IsolateCommands: []ModifyCommand{
{Name: "cmd2", Reset: true},
},
},
file3: {
File: file3,
Commands: []ModifyCommand{
{Name: "cmd3", Reset: false}, // No reset
},
},
}
// Run reset
err = ResetWhereNecessary(associations, db)
assert.NoError(t, err)
// Verify file1 was reset
data, _ := os.ReadFile(file1)
assert.Equal(t, "original1", string(data))
// Verify file2 was reset
data, _ = os.ReadFile(file2)
assert.Equal(t, "original2", string(data))
// Verify file3 was NOT reset
data, _ = os.ReadFile(file3)
assert.Equal(t, "original3", string(data))
}
func TestResetWhereNecessaryMissingFromDB(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "reset-missing-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create a test file that's been modified
file1 := filepath.Join(tmpDir, "file1.txt")
err = os.WriteFile(file1, []byte("modified_content"), 0644)
assert.NoError(t, err)
// Create DB but DON'T save file to it
db, err := GetDB()
assert.NoError(t, err)
// Create associations with reset command
associations := map[string]FileCommandAssociation{
file1: {
File: file1,
Commands: []ModifyCommand{
{Name: "cmd1", Reset: true},
},
},
}
// Run reset - should use current disk content as fallback
err = ResetWhereNecessary(associations, db)
assert.NoError(t, err)
// Verify file was "reset" to current content (saved to DB for next time)
data, _ := os.ReadFile(file1)
assert.Equal(t, "modified_content", string(data))
// Verify it was saved to DB
savedData, err := db.GetFile(file1)
assert.NoError(t, err)
assert.Equal(t, "modified_content", string(savedData))
}
func TestResetAllFiles(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "reset-all-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create test files
file1 := filepath.Join(tmpDir, "file1.txt")
file2 := filepath.Join(tmpDir, "file2.txt")
err = os.WriteFile(file1, []byte("original1"), 0644)
assert.NoError(t, err)
err = os.WriteFile(file2, []byte("original2"), 0644)
assert.NoError(t, err)
// Create mock DB and save originals
db, err := GetDB()
assert.NoError(t, err)
err = db.SaveFile(file1, []byte("original1"))
assert.NoError(t, err)
err = db.SaveFile(file2, []byte("original2"))
assert.NoError(t, err)
// Modify files
err = os.WriteFile(file1, []byte("modified1"), 0644)
assert.NoError(t, err)
err = os.WriteFile(file2, []byte("modified2"), 0644)
assert.NoError(t, err)
// Verify they're modified
data, _ := os.ReadFile(file1)
assert.Equal(t, "modified1", string(data))
// Reset all
err = ResetAllFiles(db)
assert.NoError(t, err)
// Verify both were reset
data, _ = os.ReadFile(file1)
assert.Equal(t, "original1", string(data))
data, _ = os.ReadFile(file2)
assert.Equal(t, "original2", string(data))
}

591
utils/modifycommand.go Normal file
View File

@@ -0,0 +1,591 @@
package utils
import (
"fmt"
"os"
"path/filepath"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
"github.com/BurntSushi/toml"
"github.com/bmatcuk/doublestar/v4"
"gopkg.in/yaml.v3"
)
// modifyCommandLogger is a scoped logger for the utils/modifycommand package.
var modifyCommandLogger = logger.Default.WithPrefix("utils/modifycommand")
type ModifyCommand struct {
Name string `yaml:"name,omitempty" toml:"name,omitempty"`
Regex string `yaml:"regex,omitempty" toml:"regex,omitempty"`
Regexes []string `yaml:"regexes,omitempty" toml:"regexes,omitempty"`
Lua string `yaml:"lua,omitempty" toml:"lua,omitempty"`
Files []string `yaml:"files,omitempty" toml:"files,omitempty"`
Reset bool `yaml:"reset,omitempty" toml:"reset,omitempty"`
LogLevel string `yaml:"loglevel,omitempty" toml:"loglevel,omitempty"`
Isolate bool `yaml:"isolate,omitempty" toml:"isolate,omitempty"`
NoDedup bool `yaml:"nodedup,omitempty" toml:"nodedup,omitempty"`
Disabled bool `yaml:"disable,omitempty" toml:"disable,omitempty"`
JSON bool `yaml:"json,omitempty" toml:"json,omitempty"`
SourceDir string `yaml:"-" toml:"-"` // Directory of the config file that loaded this command
}
type CookFile []ModifyCommand
func (c *ModifyCommand) Validate() error {
validateLogger := modifyCommandLogger.WithPrefix("Validate").WithField("commandName", c.Name)
validateLogger.Debug("Validating command")
// For JSON mode, regex patterns are not required
if !c.JSON {
if c.Regex == "" && len(c.Regexes) == 0 {
validateLogger.Error("Validation failed: Regex pattern is required for non-JSON mode")
return fmt.Errorf("pattern is required for non-JSON mode")
}
}
if c.Lua == "" {
validateLogger.Error("Validation failed: Lua expression is required")
return fmt.Errorf("lua expression is required")
}
if len(c.Files) == 0 {
validateLogger.Error("Validation failed: At least one file is required")
return fmt.Errorf("at least one file is required")
}
if c.LogLevel == "" {
validateLogger.Debug("LogLevel not specified, defaulting to INFO")
c.LogLevel = "INFO"
}
validateLogger.Debug("Command validated successfully")
return nil
}
// Ehh.. Not much better... Guess this wasn't the big deal
var matchesMemoTable map[string]bool = make(map[string]bool)
var globMemoTable map[string][]string = make(map[string][]string)
func Matches(path string, glob string) (bool, error) {
matchesLogger := modifyCommandLogger.WithPrefix("Matches").WithField("path", path).WithField("glob", glob)
matchesLogger.Debug("Checking if path matches glob")
key := fmt.Sprintf("%s:%s", path, glob)
if matches, ok := matchesMemoTable[key]; ok {
matchesLogger.Debug("Found match in memo table: %t", matches)
return matches, nil
}
matches, err := doublestar.Match(glob, path)
if err != nil {
matchesLogger.Error("Failed to match glob: %v", err)
return false, fmt.Errorf("failed to match glob %s with file %s: %w", glob, path, err)
}
matchesMemoTable[key] = matches
matchesLogger.Debug("Match result: %t, storing in memo table", matches)
return matches, nil
}
func SplitPattern(pattern string) (string, string) {
splitPatternLogger := modifyCommandLogger.WithPrefix("SplitPattern").WithField("pattern", pattern)
splitPatternLogger.Debug("Splitting pattern")
splitPatternLogger.Trace("Original pattern: %q", pattern)
// Split the pattern first to separate static and wildcard parts
static, remainingPattern := doublestar.SplitPattern(pattern)
splitPatternLogger.Trace("After split: static=%q, pattern=%q", static, remainingPattern)
// Resolve the static part to handle ~ expansion and make it absolute
// ResolvePath already normalizes to forward slashes
static = ResolvePath(static)
splitPatternLogger.Trace("Resolved static part: %q", static)
splitPatternLogger.Trace("Final static path: %q, Remaining pattern: %q", static, remainingPattern)
return static, remainingPattern
}
type FileCommandAssociation struct {
File string
IsolateCommands []ModifyCommand
Commands []ModifyCommand
}
func AssociateFilesWithCommands(files []string, commands []ModifyCommand) (map[string]FileCommandAssociation, error) {
associateFilesLogger := modifyCommandLogger.WithPrefix("AssociateFilesWithCommands")
associateFilesLogger.Debug("Associating files with commands")
associateFilesLogger.Trace("Input files: %v", files)
associateFilesLogger.Trace("Input commands: %v", commands)
associationCount := 0
fileCommands := make(map[string]FileCommandAssociation)
for _, file := range files {
// Use centralized path resolution internally but keep original file as key
resolvedFile := ResolvePath(file)
associateFilesLogger.Debug("Processing file: %q (resolved: %q)", file, resolvedFile)
fileCommands[file] = FileCommandAssociation{
File: resolvedFile,
IsolateCommands: []ModifyCommand{},
Commands: []ModifyCommand{},
}
for _, command := range commands {
associateFilesLogger.Debug("Checking command %q for file %q", command.Name, file)
for _, glob := range command.Files {
// SplitPattern now handles tilde expansion and path resolution
static, pattern := SplitPattern(glob)
associateFilesLogger.Trace("Glob parts for %q → static=%q pattern=%q", glob, static, pattern)
// Use resolved file for matching (already normalized to forward slashes by ResolvePath)
absFile := resolvedFile
associateFilesLogger.Trace("Absolute file path resolved for matching: %q", absFile)
// Only match if the file is under the static root
if !(strings.HasPrefix(absFile, static+"/") || absFile == static) {
associateFilesLogger.Trace("Skipping glob %q for file %q because file is outside static root %q", glob, file, static)
continue
}
patternFile := strings.TrimPrefix(absFile, static+`/`)
associateFilesLogger.Trace("Pattern-relative path used for match: %q", patternFile)
matches, err := Matches(patternFile, pattern)
if err != nil {
associateFilesLogger.Warning("Failed to match glob %q with file %q: %v", glob, file, err)
continue
}
if matches {
associateFilesLogger.Debug("File %q matches glob %q. Associating with command %q", file, glob, command.Name)
association := fileCommands[file]
if command.Isolate {
associateFilesLogger.Debug("Command %q is an isolate command, adding to isolate list", command.Name)
association.IsolateCommands = append(association.IsolateCommands, command)
} else {
associateFilesLogger.Debug("Command %q is a regular command, adding to regular list", command.Name)
association.Commands = append(association.Commands, command)
}
fileCommands[file] = association
associationCount++
} else {
associateFilesLogger.Trace("File %q did not match glob %q (pattern=%q, rel=%q)", file, glob, pattern, patternFile)
}
}
}
currentFileCommands := fileCommands[file]
associateFilesLogger.Debug("Finished processing file %q. Found %d regular commands and %d isolate commands", file, len(currentFileCommands.Commands), len(currentFileCommands.IsolateCommands))
associateFilesLogger.Trace("Commands for file %q: %v", file, currentFileCommands.Commands)
associateFilesLogger.Trace("Isolate commands for file %q: %v", file, currentFileCommands.IsolateCommands)
}
associateFilesLogger.Info("Completed association. Found %d total associations for %d files and %d commands", associationCount, len(files), len(commands))
return fileCommands, nil
}
func AggregateGlobs(commands []ModifyCommand) map[string]struct{} {
aggregateGlobsLogger := modifyCommandLogger.WithPrefix("AggregateGlobs")
aggregateGlobsLogger.Debug("Aggregating glob patterns from commands")
aggregateGlobsLogger.Trace("Input commands for aggregation: %v", commands)
globs := make(map[string]struct{})
for _, command := range commands {
aggregateGlobsLogger.Debug("Processing command %q for glob patterns", command.Name)
for _, glob := range command.Files {
// Split the glob into static and pattern parts, then resolve ONLY the static part
static, pattern := SplitPattern(glob)
// Reconstruct the glob with resolved static part
resolvedGlob := static
if pattern != "" {
resolvedGlob += "/" + pattern
}
aggregateGlobsLogger.Trace("Adding glob: %q (resolved to %q) [static=%s, pattern=%s]", glob, resolvedGlob, static, pattern)
globs[resolvedGlob] = struct{}{}
}
}
aggregateGlobsLogger.Debug("Finished aggregating globs. Found %d unique glob patterns", len(globs))
aggregateGlobsLogger.Trace("Aggregated unique globs: %v", globs)
return globs
}
func ExpandGlobs(patterns map[string]struct{}) ([]string, error) {
expandGlobsLogger := modifyCommandLogger.WithPrefix("ExpandGLobs")
expandGlobsLogger.Debug("Expanding glob patterns to actual files")
expandGlobsLogger.Trace("Input patterns for expansion: %v", patterns)
var files []string
filesMap := make(map[string]bool)
cwd, err := os.Getwd()
if err != nil {
expandGlobsLogger.Error("Failed to get current working directory: %v", err)
return nil, fmt.Errorf("failed to get current working directory: %w", err)
}
expandGlobsLogger.Debug("Current working directory: %q", cwd)
for pattern := range patterns {
expandGlobsLogger.Debug("Processing glob pattern: %q", pattern)
static, pattern := SplitPattern(pattern)
key := static + "|" + pattern
matches, ok := globMemoTable[key]
if !ok {
var err error
matches, err = doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
expandGlobsLogger.Warning("Error expanding glob %q in %q: %v", pattern, static, err)
continue
}
globMemoTable[key] = matches
}
expandGlobsLogger.Debug("Found %d matches for pattern %q", len(matches), pattern)
expandGlobsLogger.Trace("Raw matches for pattern %q: %v", pattern, matches)
for _, m := range matches {
// Resolve the full path
fullPath := ResolvePath(filepath.Join(static, m))
info, err := os.Stat(fullPath)
if err != nil {
expandGlobsLogger.Warning("Error getting file info for %q: %v", fullPath, err)
continue
}
if !info.IsDir() && !filesMap[fullPath] {
expandGlobsLogger.Trace("Adding unique file to list: %q", fullPath)
filesMap[fullPath], files = true, append(files, fullPath)
}
}
}
if len(files) > 0 {
expandGlobsLogger.Debug("Finished expanding globs. Found %d unique files to process", len(files))
expandGlobsLogger.Trace("Unique files to process: %v", files)
} else {
expandGlobsLogger.Warning("No files found after expanding glob patterns.")
}
return files, nil
}
func LoadCommands(args []string) ([]ModifyCommand, map[string]interface{}, error) {
loadCommandsLogger := modifyCommandLogger.WithPrefix("LoadCommands")
loadCommandsLogger.Debug("Loading commands from arguments (cook files or direct patterns)")
loadCommandsLogger.Trace("Input arguments: %v", args)
commands := []ModifyCommand{}
variables := make(map[string]interface{})
for _, arg := range args {
loadCommandsLogger.Debug("Processing argument for commands: %q", arg)
var newCommands []ModifyCommand
var newVariables map[string]interface{}
var err error
// Check file extension to determine format
if strings.HasSuffix(arg, ".toml") {
loadCommandsLogger.Debug("Loading TOML commands from %q", arg)
newCommands, newVariables, err = LoadCommandsFromTomlFiles(arg)
if err != nil {
loadCommandsLogger.Error("Failed to load TOML commands from argument %q: %v", arg, err)
return nil, nil, fmt.Errorf("failed to load commands from TOML files: %w", err)
}
} else {
// Default to YAML for .yml, .yaml, or any other extension
loadCommandsLogger.Debug("Loading YAML commands from %q", arg)
newCommands, newVariables, err = LoadCommandsFromCookFiles(arg)
if err != nil {
loadCommandsLogger.Error("Failed to load YAML commands from argument %q: %v", arg, err)
return nil, nil, fmt.Errorf("failed to load commands from cook files: %w", err)
}
}
for k, v := range newVariables {
variables[k] = v
}
loadCommandsLogger.Debug("Successfully loaded %d commands from %q", len(newCommands), arg)
for _, cmd := range newCommands {
if cmd.Disabled {
loadCommandsLogger.Debug("Skipping disabled command: %q", cmd.Name)
continue
}
commands = append(commands, cmd)
loadCommandsLogger.Trace("Added command %q. Current total commands: %d", cmd.Name, len(commands))
}
}
loadCommandsLogger.Info("Finished loading commands. Total %d commands and %d variables loaded", len(commands), len(variables))
return commands, variables, nil
}
func LoadCommandsFromCookFiles(pattern string) ([]ModifyCommand, map[string]interface{}, error) {
loadCookFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFiles").WithField("pattern", pattern)
loadCookFilesLogger.Debug("Loading commands from cook files based on pattern")
loadCookFilesLogger.Trace("Input pattern: %q", pattern)
static, pattern := SplitPattern(pattern)
commands := []ModifyCommand{}
variables := make(map[string]interface{})
cookFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
loadCookFilesLogger.Error("Failed to glob cook files for pattern %q: %v", pattern, err)
return nil, nil, fmt.Errorf("failed to glob cook files: %w", err)
}
loadCookFilesLogger.Debug("Found %d cook files for pattern %q", len(cookFiles), pattern)
loadCookFilesLogger.Trace("Cook files found: %v", cookFiles)
for _, cookFile := range cookFiles {
// Use centralized path resolution
cookFile = ResolvePath(filepath.Join(static, cookFile))
loadCookFilesLogger.Debug("Loading commands from individual cook file: %q", cookFile)
cookFileData, err := os.ReadFile(cookFile)
if err != nil {
loadCookFilesLogger.Error("Failed to read cook file %q: %v", cookFile, err)
return nil, nil, fmt.Errorf("failed to read cook file: %w", err)
}
loadCookFilesLogger.Trace("Read %d bytes from cook file %q", len(cookFileData), cookFile)
newCommands, newVariables, err := LoadCommandsFromCookFile(cookFileData)
if err != nil {
loadCookFilesLogger.Error("Failed to load commands from cook file data for %q: %v", cookFile, err)
return nil, nil, fmt.Errorf("failed to load commands from cook file: %w", err)
}
// Set source directory for each command
sourceDir := filepath.Dir(cookFile)
for i := range newCommands {
newCommands[i].SourceDir = sourceDir
}
commands = append(commands, newCommands...)
for k, v := range newVariables {
variables[k] = v
}
loadCookFilesLogger.Debug("Added %d commands and %d variables from cook file %q. Total commands now: %d", len(newCommands), len(newVariables), cookFile, len(commands))
}
loadCookFilesLogger.Debug("Finished loading commands from cook files. Total %d commands and %d variables", len(commands), len(variables))
return commands, variables, nil
}
func LoadCommandsFromCookFile(cookFileData []byte) ([]ModifyCommand, map[string]interface{}, error) {
loadCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromCookFile")
loadCommandLogger.Debug("Unmarshaling commands from cook file data")
loadCommandLogger.Trace("Cook file data length: %d", len(cookFileData))
var cookFile struct {
Variables map[string]interface{} `yaml:"variables,omitempty"`
Commands []ModifyCommand `yaml:"commands"`
}
err := yaml.Unmarshal(cookFileData, &cookFile)
if err != nil {
loadCommandLogger.Error("Failed to unmarshal cook file data: %v", err)
return nil, nil, fmt.Errorf("failed to unmarshal cook file: %w", err)
}
loadCommandLogger.Debug("Successfully unmarshaled %d commands and %d variables", len(cookFile.Commands), len(cookFile.Variables))
loadCommandLogger.Trace("Unmarshaled commands: %v", cookFile.Commands)
loadCommandLogger.Trace("Unmarshaled variables: %v", cookFile.Variables)
return cookFile.Commands, cookFile.Variables, nil
}
// CountGlobsBeforeDedup counts the total number of glob patterns across all commands before deduplication
func CountGlobsBeforeDedup(commands []ModifyCommand) int {
countGlobsLogger := modifyCommandLogger.WithPrefix("CountGlobsBeforeDedup")
countGlobsLogger.Debug("Counting glob patterns before deduplication")
count := 0
for _, cmd := range commands {
countGlobsLogger.Trace("Processing command %q, adding %d globs", cmd.Name, len(cmd.Files))
count += len(cmd.Files)
}
countGlobsLogger.Debug("Total glob patterns before deduplication: %d", count)
return count
}
func FilterCommands(commands []ModifyCommand, filter string) []ModifyCommand {
filterCommandsLogger := modifyCommandLogger.WithPrefix("FilterCommands").WithField("filter", filter)
filterCommandsLogger.Debug("Filtering commands")
filterCommandsLogger.Trace("Input commands: %v", commands)
filteredCommands := []ModifyCommand{}
filters := strings.Split(filter, ",")
filterCommandsLogger.Trace("Split filters: %v", filters)
for _, cmd := range commands {
filterCommandsLogger.Debug("Checking command %q against filters", cmd.Name)
for _, f := range filters {
if strings.Contains(cmd.Name, f) {
filterCommandsLogger.Debug("Command %q matches filter %q, adding to filtered list", cmd.Name, f)
filteredCommands = append(filteredCommands, cmd)
break // Command matches, no need to check other filters
}
}
}
filterCommandsLogger.Debug("Finished filtering commands. Found %d filtered commands", len(filteredCommands))
filterCommandsLogger.Trace("Filtered commands: %v", filteredCommands)
return filteredCommands
}
func LoadCommandsFromTomlFiles(pattern string) ([]ModifyCommand, map[string]interface{}, error) {
loadTomlFilesLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromTomlFiles").WithField("pattern", pattern)
loadTomlFilesLogger.Debug("Loading commands from TOML files based on pattern")
loadTomlFilesLogger.Trace("Input pattern: %q", pattern)
static, pattern := SplitPattern(pattern)
commands := []ModifyCommand{}
variables := make(map[string]interface{})
tomlFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
loadTomlFilesLogger.Error("Failed to glob TOML files for pattern %q: %v", pattern, err)
return nil, nil, fmt.Errorf("failed to glob TOML files: %w", err)
}
loadTomlFilesLogger.Debug("Found %d TOML files for pattern %q", len(tomlFiles), pattern)
loadTomlFilesLogger.Trace("TOML files found: %v", tomlFiles)
for _, tomlFile := range tomlFiles {
// Use centralized path resolution
tomlFile = ResolvePath(filepath.Join(static, tomlFile))
loadTomlFilesLogger.Debug("Loading commands from individual TOML file: %q", tomlFile)
tomlFileData, err := os.ReadFile(tomlFile)
if err != nil {
loadTomlFilesLogger.Error("Failed to read TOML file %q: %v", tomlFile, err)
return nil, nil, fmt.Errorf("failed to read TOML file: %w", err)
}
loadTomlFilesLogger.Trace("Read %d bytes from TOML file %q", len(tomlFileData), tomlFile)
newCommands, newVariables, err := LoadCommandsFromTomlFile(tomlFileData)
if err != nil {
loadTomlFilesLogger.Error("Failed to load commands from TOML file data for %q: %v", tomlFile, err)
return nil, nil, fmt.Errorf("failed to load commands from TOML file: %w", err)
}
// Set source directory for each command
sourceDir := filepath.Dir(tomlFile)
for i := range newCommands {
newCommands[i].SourceDir = sourceDir
}
commands = append(commands, newCommands...)
for k, v := range newVariables {
variables[k] = v
}
loadTomlFilesLogger.Debug("Added %d commands and %d variables from TOML file %q. Total commands now: %d", len(newCommands), len(newVariables), tomlFile, len(commands))
}
loadTomlFilesLogger.Debug("Finished loading commands from TOML files. Total %d commands and %d variables", len(commands), len(variables))
return commands, variables, nil
}
func LoadCommandsFromTomlFile(tomlFileData []byte) ([]ModifyCommand, map[string]interface{}, error) {
loadTomlCommandLogger := modifyCommandLogger.WithPrefix("LoadCommandsFromTomlFile")
loadTomlCommandLogger.Debug("Unmarshaling commands from TOML file data")
loadTomlCommandLogger.Trace("TOML file data length: %d", len(tomlFileData))
// TOML structure for commands array and top-level variables
var tomlData struct {
Variables map[string]interface{} `toml:"variables,omitempty"`
Commands []ModifyCommand `toml:"commands"`
// Also support direct array without wrapper
DirectCommands []ModifyCommand `toml:"-"`
}
// First try to parse as wrapped structure
err := toml.Unmarshal(tomlFileData, &tomlData)
if err != nil {
loadTomlCommandLogger.Error("Failed to unmarshal TOML file data: %v", err)
return nil, nil, fmt.Errorf("failed to unmarshal TOML file: %w", err)
}
var commands []ModifyCommand
variables := make(map[string]interface{})
// Extract top-level variables
if len(tomlData.Variables) > 0 {
loadTomlCommandLogger.Debug("Found %d top-level variables", len(tomlData.Variables))
for k, v := range tomlData.Variables {
variables[k] = v
}
}
// Use commands from wrapped structure
commands = tomlData.Commands
loadTomlCommandLogger.Debug("Successfully unmarshaled %d commands and %d variables", len(commands), len(variables))
loadTomlCommandLogger.Trace("Unmarshaled commands: %v", commands)
loadTomlCommandLogger.Trace("Unmarshaled variables: %v", variables)
return commands, variables, nil
}
// ConvertYAMLToTOML converts YAML files to TOML format
func ConvertYAMLToTOML(yamlPattern string) error {
convertLogger := modifyCommandLogger.WithPrefix("ConvertYAMLToTOML").WithField("pattern", yamlPattern)
convertLogger.Debug("Starting YAML to TOML conversion")
// Find all YAML files matching the pattern
static, pattern := SplitPattern(yamlPattern)
yamlFiles, err := doublestar.Glob(os.DirFS(static), pattern)
if err != nil {
convertLogger.Error("Failed to glob YAML files: %v", err)
return fmt.Errorf("failed to glob YAML files: %w", err)
}
convertLogger.Debug("Found %d YAML files to convert", len(yamlFiles))
if len(yamlFiles) == 0 {
convertLogger.Info("No YAML files found for pattern: %s", yamlPattern)
return nil
}
conversionCount := 0
skippedCount := 0
for _, yamlFile := range yamlFiles {
// Use centralized path resolution
yamlFilePath := ResolvePath(filepath.Join(static, yamlFile))
// Generate corresponding TOML file path
tomlFilePath := strings.TrimSuffix(yamlFilePath, filepath.Ext(yamlFilePath)) + ".toml"
convertLogger.Debug("Processing YAML file: %s -> %s", yamlFilePath, tomlFilePath)
// Check if TOML file already exists
if _, err := os.Stat(tomlFilePath); err == nil {
convertLogger.Info("Skipping conversion - TOML file already exists: %s", tomlFilePath)
skippedCount++
continue
}
// Read YAML file
yamlData, err := os.ReadFile(yamlFilePath)
if err != nil {
convertLogger.Error("Failed to read YAML file %s: %v", yamlFilePath, err)
continue
}
// Load YAML commands from this specific file
fileCommands, fileVariables, err := LoadCommandsFromCookFile(yamlData)
if err != nil {
convertLogger.Error("Failed to parse YAML file %s: %v", yamlFilePath, err)
continue
}
// Convert to TOML structure
tomlData, err := convertCommandsToTOML(fileCommands, fileVariables)
if err != nil {
convertLogger.Error("Failed to convert commands to TOML for %s: %v", yamlFilePath, err)
continue
}
// Write TOML file
err = os.WriteFile(tomlFilePath, tomlData, 0644)
if err != nil {
convertLogger.Error("Failed to write TOML file %s: %v", tomlFilePath, err)
continue
}
convertLogger.Info("Successfully converted %s to %s", yamlFilePath, tomlFilePath)
conversionCount++
}
convertLogger.Info("Conversion completed: %d files converted, %d files skipped", conversionCount, skippedCount)
return nil
}
// convertCommandsToTOML converts a slice of ModifyCommand to TOML format
func convertCommandsToTOML(commands []ModifyCommand, variables map[string]interface{}) ([]byte, error) {
convertLogger := modifyCommandLogger.WithPrefix("convertCommandsToTOML")
convertLogger.Debug("Converting %d commands to TOML format", len(commands))
// Create TOML structure
tomlData := struct {
Variables map[string]interface{} `toml:"variables,omitempty"`
Commands []ModifyCommand `toml:"commands"`
}{
Variables: variables,
Commands: commands,
}
// Marshal to TOML
tomlBytes, err := toml.Marshal(tomlData)
if err != nil {
convertLogger.Error("Failed to marshal commands to TOML: %v", err)
return nil, fmt.Errorf("failed to marshal commands to TOML: %w", err)
}
convertLogger.Debug("Successfully converted %d commands and %d variables to TOML (%d bytes)", len(commands), len(variables), len(tomlBytes))
return tomlBytes, nil
}

View File

@@ -0,0 +1,313 @@
package utils
import (
"os"
"path/filepath"
"testing"
"github.com/stretchr/testify/assert"
)
func TestAggregateGlobsWithDuplicates(t *testing.T) {
commands := []ModifyCommand{
{Files: []string{"*.txt", "*.md"}},
{Files: []string{"*.txt", "*.go"}}, // *.txt is duplicate
{Files: []string{"test/**/*.xml"}},
}
globs := AggregateGlobs(commands)
// Should deduplicate
assert.Equal(t, 4, len(globs))
// AggregateGlobs resolves paths, which uses forward slashes internally
assert.Contains(t, globs, ResolvePath("*.txt"))
assert.Contains(t, globs, ResolvePath("*.md"))
assert.Contains(t, globs, ResolvePath("*.go"))
assert.Contains(t, globs, ResolvePath("test/**/*.xml"))
}
func TestExpandGlobsWithActualFiles(t *testing.T) {
// Create temp dir with test files
tmpDir, err := os.MkdirTemp("", "glob-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create test files
testFile1 := filepath.Join(tmpDir, "test1.txt")
testFile2 := filepath.Join(tmpDir, "test2.txt")
testFile3 := filepath.Join(tmpDir, "test.md")
os.WriteFile(testFile1, []byte("test"), 0644)
os.WriteFile(testFile2, []byte("test"), 0644)
os.WriteFile(testFile3, []byte("test"), 0644)
// Change to temp directory so glob pattern can find files
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Test expanding globs using ResolvePath to normalize the pattern
globs := map[string]struct{}{
ResolvePath("*.txt"): {},
}
files, err := ExpandGlobs(globs)
assert.NoError(t, err)
assert.Equal(t, 2, len(files))
}
func TestSplitPatternWithTilde(t *testing.T) {
pattern := "~/test/*.txt"
static, pat := SplitPattern(pattern)
// Should expand ~
assert.NotEqual(t, "~", static)
assert.Contains(t, pat, "*.txt")
}
func TestLoadCommandsWithDisabled(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "disabled-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
yamlContent := `
variables:
test: "value"
commands:
- name: "enabled_cmd"
regex: "test"
lua: "v1 * 2"
files: ["*.txt"]
- name: "disabled_cmd"
regex: "test2"
lua: "v1 * 3"
files: ["*.txt"]
disable: true
`
yamlFile := filepath.Join(tmpDir, "test.yml")
err = os.WriteFile(yamlFile, []byte(yamlContent), 0644)
assert.NoError(t, err)
// Change to temp directory so LoadCommands can find the file with a simple pattern
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
commands, variables, err := LoadCommands([]string{"test.yml"})
assert.NoError(t, err)
// Should only load enabled command
assert.Equal(t, 1, len(commands))
assert.Equal(t, "enabled_cmd", commands[0].Name)
// Should still load variables
assert.Equal(t, 1, len(variables))
}
func TestFilterCommandsByName(t *testing.T) {
commands := []ModifyCommand{
{Name: "test_multiply"},
{Name: "test_divide"},
{Name: "other_command"},
{Name: "test_add"},
}
// Filter by "test"
filtered := FilterCommands(commands, "test")
assert.Equal(t, 3, len(filtered))
// Filter by multiple
filtered = FilterCommands(commands, "multiply,divide")
assert.Equal(t, 2, len(filtered))
}
func TestCountGlobsBeforeDedup(t *testing.T) {
commands := []ModifyCommand{
{Files: []string{"*.txt", "*.md", "*.go"}},
{Files: []string{"*.xml"}},
{Files: []string{"test/**/*.txt", "data/**/*.json"}},
}
count := CountGlobsBeforeDedup(commands)
assert.Equal(t, 6, count)
}
func TestMatchesWithMemoization(t *testing.T) {
path := "test/file.txt"
glob := "**/*.txt"
// First call
matches1, err1 := Matches(path, glob)
assert.NoError(t, err1)
assert.True(t, matches1)
// Second call should use memo
matches2, err2 := Matches(path, glob)
assert.NoError(t, err2)
assert.Equal(t, matches1, matches2)
}
func TestValidateCommand(t *testing.T) {
tests := []struct {
name string
cmd ModifyCommand
wantErr bool
}{
{
name: "Valid command",
cmd: ModifyCommand{
Regex: "test",
Lua: "v1 * 2",
Files: []string{"*.txt"},
},
wantErr: false,
},
{
name: "Valid JSON mode without regex",
cmd: ModifyCommand{
JSON: true,
Lua: "data.value = data.value * 2; modified = true",
Files: []string{"*.json"},
},
wantErr: false,
},
{
name: "Missing regex in non-JSON mode",
cmd: ModifyCommand{
Lua: "v1 * 2",
Files: []string{"*.txt"},
},
wantErr: true,
},
{
name: "Missing Lua",
cmd: ModifyCommand{
Regex: "test",
Files: []string{"*.txt"},
},
wantErr: true,
},
{
name: "Missing files",
cmd: ModifyCommand{
Regex: "test",
Lua: "v1 * 2",
},
wantErr: true,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
err := tt.cmd.Validate()
if tt.wantErr {
assert.Error(t, err)
} else {
assert.NoError(t, err)
}
})
}
}
func TestLoadCommandsFromTomlWithVariables(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "toml-vars-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
tomlContent := `[variables]
multiplier = 3
prefix = "PREFIX_"
[[commands]]
name = "test_cmd"
regex = "value = !num"
lua = "v1 * multiplier"
files = ["*.txt"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
assert.NoError(t, err)
// Change to temp directory so glob pattern can find the file
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
commands, variables, err := LoadCommandsFromTomlFiles("test.toml")
assert.NoError(t, err)
assert.Equal(t, 1, len(commands))
assert.Equal(t, 2, len(variables))
assert.Equal(t, int64(3), variables["multiplier"])
assert.Equal(t, "PREFIX_", variables["prefix"])
}
func TestConvertYAMLToTOMLSkipExisting(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "convert-skip-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create YAML file
yamlContent := `
commands:
- name: "test"
regex: "value"
lua: "v1 * 2"
files: ["*.txt"]
`
yamlFile := filepath.Join(tmpDir, "test.yml")
err = os.WriteFile(yamlFile, []byte(yamlContent), 0644)
assert.NoError(t, err)
// Create TOML file (should skip conversion)
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte("# existing"), 0644)
assert.NoError(t, err)
// Change to temp dir
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Should skip existing TOML
err = ConvertYAMLToTOML("test.yml")
assert.NoError(t, err)
// TOML content should be unchanged
content, _ := os.ReadFile(tomlFile)
assert.Equal(t, "# existing", string(content))
}
func TestLoadCommandsWithTomlExtension(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "toml-ext-test-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
tomlContent := `
[variables]
test_var = "value"
[[commands]]
name = "TestCmd"
regex = "test"
lua = "return true"
files = ["*.txt"]
`
tomlFile := filepath.Join(tmpDir, "test.toml")
err = os.WriteFile(tomlFile, []byte(tomlContent), 0644)
assert.NoError(t, err)
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// This should trigger the .toml suffix check in LoadCommands
commands, variables, err := LoadCommands([]string{"test.toml"})
assert.NoError(t, err)
assert.Len(t, commands, 1)
assert.Equal(t, "TestCmd", commands[0].Name)
assert.Len(t, variables, 1)
assert.Equal(t, "value", variables["test_var"])
}

1064
utils/modifycommand_test.go Normal file

File diff suppressed because it is too large Load Diff

View File

@@ -0,0 +1,93 @@
package utils
import (
"os"
"path/filepath"
"testing"
"github.com/stretchr/testify/assert"
)
// TestConvertYAMLToTOMLReadError tests error handling when YAML file can't be read
func TestConvertYAMLToTOMLReadError(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "convert-read-error-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create YAML file with no read permissions (on Unix) or delete it after creation
yamlFile := filepath.Join(tmpDir, "test.yml")
err = os.WriteFile(yamlFile, []byte("commands:\n - name: test\n"), 0000)
assert.NoError(t, err)
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// This should fail to read but not crash
err = ConvertYAMLToTOML("test.yml")
// Function continues on error, doesn't return error
assert.NoError(t, err)
// Fix permissions for cleanup
os.Chmod(yamlFile, 0644)
}
// TestConvertYAMLToTOMLParseError tests error handling when YAML is invalid
func TestConvertYAMLToTOMLParseError(t *testing.T) {
tmpDir, err := os.MkdirTemp("", "convert-parse-error-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create invalid YAML
yamlFile := filepath.Join(tmpDir, "invalid.yml")
err = os.WriteFile(yamlFile, []byte("commands:\n - [this is not valid yaml}}"), 0644)
assert.NoError(t, err)
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// This should fail to parse but not crash
err = ConvertYAMLToTOML("invalid.yml")
assert.NoError(t, err)
// TOML file should not exist
_, statErr := os.Stat(filepath.Join(tmpDir, "invalid.toml"))
assert.True(t, os.IsNotExist(statErr))
}
// TestConvertYAMLToTOMLWriteError tests error handling when TOML file can't be written
func TestConvertYAMLToTOMLWriteError(t *testing.T) {
if os.Getenv("CI") != "" {
t.Skip("Skipping write permission test in CI")
}
tmpDir, err := os.MkdirTemp("", "convert-write-error-*")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
// Create valid YAML
yamlFile := filepath.Join(tmpDir, "test.yml")
err = os.WriteFile(yamlFile, []byte("commands:\n - name: test\n regex: test\n lua: v1\n files: [test.txt]\n"), 0644)
assert.NoError(t, err)
// Create output directory with no write permissions
outputDir := filepath.Join(tmpDir, "readonly")
err = os.Mkdir(outputDir, 0555)
assert.NoError(t, err)
defer os.Chmod(outputDir, 0755) // Fix for cleanup
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
os.Chdir(tmpDir)
// Move YAML into readonly dir
newYamlFile := filepath.Join(outputDir, "test.yml")
os.Rename(yamlFile, newYamlFile)
os.Chdir(outputDir)
// This should fail to write but not crash
err = ConvertYAMLToTOML("test.yml")
assert.NoError(t, err)
}

79
utils/path.go Normal file
View File

@@ -0,0 +1,79 @@
package utils
import (
"os"
"path/filepath"
"strings"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// pathLogger is a scoped logger for the utils/path package.
var pathLogger = logger.Default.WithPrefix("utils/path")
// ResolvePath resolves a path to an absolute path, handling ~ expansion and cleaning
func ResolvePath(path string) string {
resolvePathLogger := pathLogger.WithPrefix("ResolvePath").WithField("inputPath", path)
resolvePathLogger.Trace("Resolving path: %q", path)
// Handle empty path
if path == "" {
resolvePathLogger.Trace("Empty path, returning empty string")
return ""
}
// Check if path is absolute
if filepath.IsAbs(path) {
resolvePathLogger.Trace("Path is already absolute: %q", path)
cleaned := filepath.ToSlash(filepath.Clean(path))
resolvePathLogger.Trace("Cleaned absolute path: %q", cleaned)
return cleaned
}
// Handle ~ expansion
if strings.HasPrefix(path, "~") {
homeDir, _ := os.UserHomeDir()
if strings.HasPrefix(path, "~/") || strings.HasPrefix(path, "~\\") {
path = filepath.Join(homeDir, path[2:])
} else if path == "~" {
path = homeDir
} else {
// ~something (like ~~), treat first ~ as home expansion, rest as literal
path = homeDir + path[1:]
}
resolvePathLogger.Trace("Expanded ~ to home directory: %q", path)
}
// Make absolute if not already
if !filepath.IsAbs(path) {
absPath, err := filepath.Abs(path)
if err != nil {
resolvePathLogger.Error("Failed to get absolute path: %v", err)
return filepath.ToSlash(filepath.Clean(path))
}
resolvePathLogger.Trace("Made path absolute: %q -> %q", path, absPath)
path = absPath
}
// Clean the path and normalize to forward slashes for consistency
cleaned := filepath.ToSlash(filepath.Clean(path))
resolvePathLogger.Trace("Final cleaned path: %q", cleaned)
return cleaned
}
// GetRelativePath returns the relative path from base to target
func GetRelativePath(base, target string) (string, error) {
getRelativePathLogger := pathLogger.WithPrefix("GetRelativePath")
getRelativePathLogger.Debug("Getting relative path from %q to %q", base, target)
relPath, err := filepath.Rel(base, target)
if err != nil {
getRelativePathLogger.Error("Failed to get relative path: %v", err)
return "", err
}
// Use forward slashes for consistency
relPath = filepath.ToSlash(relPath)
getRelativePathLogger.Debug("Relative path: %q", relPath)
return relPath, nil
}

386
utils/path_test.go Normal file
View File

@@ -0,0 +1,386 @@
package utils
import (
"os"
"path/filepath"
"runtime"
"strings"
"testing"
"github.com/stretchr/testify/assert"
)
func TestResolvePath(t *testing.T) {
// Save original working directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
// Create a temporary directory for testing
tmpDir, err := os.MkdirTemp("", "path_test")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
tests := []struct {
name string
input string
expected string
setup func() // Optional setup function
}{
{
name: "Empty path",
input: "",
expected: "",
},
{
name: "Already absolute path",
input: func() string {
if runtime.GOOS == "windows" {
return "C:/absolute/path/file.txt"
}
return "/absolute/path/file.txt"
}(),
expected: func() string {
if runtime.GOOS == "windows" {
return "C:/absolute/path/file.txt"
}
return "/absolute/path/file.txt"
}(),
},
{
name: "Relative path",
input: "relative/file.txt",
expected: func() string {
abs, _ := filepath.Abs("relative/file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
name: "Tilde expansion - home only",
input: "~",
expected: func() string {
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
return strings.ReplaceAll(filepath.Clean(home), "\\", "/")
}(),
},
{
name: "Tilde expansion - with subpath",
input: "~/Documents/file.txt",
expected: func() string {
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
expected := filepath.Join(home, "Documents", "file.txt")
return strings.ReplaceAll(filepath.Clean(expected), "\\", "/")
}(),
},
{
name: "Path normalization - double slashes",
input: "path//to//file.txt",
expected: func() string {
abs, _ := filepath.Abs("path/to/file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
name: "Path normalization - . and ..",
input: "path/./to/../file.txt",
expected: func() string {
abs, _ := filepath.Abs("path/file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
name: "Windows backslash normalization",
input: "path\\to\\file.txt",
expected: func() string {
abs, _ := filepath.Abs("path/to/file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
name: "Mixed separators with tilde",
input: "~/Documents\\file.txt",
expected: func() string {
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
expected := filepath.Join(home, "Documents", "file.txt")
return strings.ReplaceAll(filepath.Clean(expected), "\\", "/")
}(),
},
{
name: "Relative path from current directory",
input: "./file.txt",
expected: func() string {
abs, _ := filepath.Abs("file.txt")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
if tt.setup != nil {
tt.setup()
}
result := ResolvePath(tt.input)
assert.Equal(t, tt.expected, result, "ResolvePath(%q) = %q, want %q", tt.input, result, tt.expected)
})
}
}
func TestResolvePathWithWorkingDirectoryChange(t *testing.T) {
// Save original working directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
// Create temporary directories
tmpDir, err := os.MkdirTemp("", "path_test")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
subDir := filepath.Join(tmpDir, "subdir")
err = os.MkdirAll(subDir, 0755)
assert.NoError(t, err)
// Change to subdirectory
err = os.Chdir(subDir)
assert.NoError(t, err)
// Test relative path resolution from new working directory
result := ResolvePath("../test.txt")
expected := filepath.Join(tmpDir, "test.txt")
expected = strings.ReplaceAll(filepath.Clean(expected), "\\", "/")
assert.Equal(t, expected, result)
}
func TestResolvePathComplexTilde(t *testing.T) {
// Test complex tilde patterns
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
if home == "" {
t.Skip("Cannot determine home directory for tilde expansion tests")
}
tests := []struct {
input string
expected string
}{
{
input: "~",
expected: strings.ReplaceAll(filepath.Clean(home), "\\", "/"),
},
{
input: "~/",
expected: strings.ReplaceAll(filepath.Clean(home), "\\", "/"),
},
{
input: "~~",
expected: func() string {
// ~~ should be treated as ~ followed by ~ (tilde expansion)
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
if home != "" {
// First ~ gets expanded, second ~ remains
return strings.ReplaceAll(filepath.Clean(home+"~"), "\\", "/")
}
abs, _ := filepath.Abs("~~")
return strings.ReplaceAll(abs, "\\", "/")
}(),
},
{
input: func() string {
if runtime.GOOS == "windows" {
return "C:/not/tilde/path"
}
return "/not/tilde/path"
}(),
expected: func() string {
if runtime.GOOS == "windows" {
return "C:/not/tilde/path"
}
return "/not/tilde/path"
}(),
},
}
for _, tt := range tests {
t.Run("Complex tilde: "+tt.input, func(t *testing.T) {
result := ResolvePath(tt.input)
assert.Equal(t, tt.expected, result)
})
}
}
func TestGetRelativePath(t *testing.T) {
// Create temporary directories for testing
tmpDir, err := os.MkdirTemp("", "relative_path_test")
assert.NoError(t, err)
defer os.RemoveAll(tmpDir)
baseDir := filepath.Join(tmpDir, "base")
targetDir := filepath.Join(tmpDir, "target")
subDir := filepath.Join(targetDir, "subdir")
err = os.MkdirAll(baseDir, 0755)
assert.NoError(t, err)
err = os.MkdirAll(subDir, 0755)
assert.NoError(t, err)
tests := []struct {
name string
base string
target string
expected string
wantErr bool
}{
{
name: "Target is subdirectory of base",
base: baseDir,
target: filepath.Join(baseDir, "subdir"),
expected: "subdir",
wantErr: false,
},
{
name: "Target is parent of base",
base: filepath.Join(baseDir, "subdir"),
target: baseDir,
expected: "..",
wantErr: false,
},
{
name: "Target is sibling directory",
base: baseDir,
target: targetDir,
expected: "../target",
wantErr: false,
},
{
name: "Same directory",
base: baseDir,
target: baseDir,
expected: ".",
wantErr: false,
},
{
name: "With tilde expansion",
base: baseDir,
target: filepath.Join(baseDir, "file.txt"),
expected: "file.txt",
wantErr: false,
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
result, err := GetRelativePath(tt.base, tt.target)
if tt.wantErr {
assert.Error(t, err)
} else {
assert.NoError(t, err)
assert.Equal(t, tt.expected, result)
}
})
}
}
func TestResolvePathRegression(t *testing.T) {
// This test specifically addresses the original bug:
// "~ is NOT BEING FUCKING RESOLVED"
home := os.Getenv("HOME")
if home == "" && runtime.GOOS == "windows" {
home = os.Getenv("USERPROFILE")
}
if home == "" {
t.Skip("Cannot determine home directory for regression test")
}
// Test the exact pattern from the bug report
testPath := "~/Seafile/activitywatch/sync.yml"
result := ResolvePath(testPath)
expected := filepath.Join(home, "Seafile", "activitywatch", "sync.yml")
expected = strings.ReplaceAll(filepath.Clean(expected), "\\", "/")
assert.Equal(t, expected, result, "Tilde expansion bug not fixed!")
assert.NotContains(t, result, "~", "Tilde still present in resolved path!")
// Convert both to forward slashes for comparison
homeForwardSlash := strings.ReplaceAll(home, "\\", "/")
assert.Contains(t, result, homeForwardSlash, "Home directory not found in resolved path!")
}
func TestResolvePathEdgeCases(t *testing.T) {
// Save original working directory
origDir, _ := os.Getwd()
defer os.Chdir(origDir)
tests := []struct {
name string
input string
setup func()
shouldPanic bool
}{
{
name: "Just dot",
input: ".",
},
{
name: "Just double dot",
input: "..",
},
{
name: "Triple dot",
input: "...",
},
{
name: "Multiple leading dots",
input: "./.././../file.txt",
},
{
name: "Path with spaces",
input: "path with spaces/file.txt",
},
{
name: "Very long relative path",
input: strings.Repeat("../", 10) + "file.txt",
},
}
for _, tt := range tests {
t.Run(tt.name, func(t *testing.T) {
if tt.setup != nil {
tt.setup()
}
if tt.shouldPanic {
assert.Panics(t, func() {
ResolvePath(tt.input)
})
} else {
// Should not panic
assert.NotPanics(t, func() {
ResolvePath(tt.input)
})
// Result should be a valid absolute path
result := ResolvePath(tt.input)
if tt.input != "" {
assert.True(t, filepath.IsAbs(result) || result == "", "Result should be absolute or empty")
}
}
})
}
}

79
utils/replacecommand.go Normal file
View File

@@ -0,0 +1,79 @@
package utils
import (
"fmt"
"sort"
logger "git.site.quack-lab.dev/dave/cylogger"
)
// replaceCommandLogger is a scoped logger for the utils/replacecommand package.
var replaceCommandLogger = logger.Default.WithPrefix("utils/replacecommand")
type ReplaceCommand struct {
From int
To int
With string
}
func ExecuteModifications(modifications []ReplaceCommand, fileData string) (string, int) {
executeModificationsLogger := replaceCommandLogger.WithPrefix("ExecuteModifications")
executeModificationsLogger.Debug("Executing a batch of text modifications")
executeModificationsLogger.Trace("Number of modifications: %d, Original file data length: %d", len(modifications), len(fileData))
var err error
sort.Slice(modifications, func(i, j int) bool {
return modifications[i].From > modifications[j].From
})
executeModificationsLogger.Debug("Modifications sorted in reverse order for safe replacement")
executeModificationsLogger.Trace("Sorted modifications: %v", modifications)
executed := 0
for idx, modification := range modifications {
executeModificationsLogger.Debug("Applying modification %d/%d", idx+1, len(modifications))
executeModificationsLogger.Trace("Current modification details: From=%d, To=%d, With=%q", modification.From, modification.To, modification.With)
fileData, err = modification.Execute(fileData)
if err != nil {
executeModificationsLogger.Error("Failed to execute replacement for modification %+v: %v", modification, err)
continue
}
executed++
executeModificationsLogger.Trace("File data length after modification: %d", len(fileData))
}
executeModificationsLogger.Info("Successfully applied %d text replacements", executed)
return fileData, executed
}
func (m *ReplaceCommand) Execute(fileDataStr string) (string, error) {
executeLogger := replaceCommandLogger.WithPrefix("Execute").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With))
executeLogger.Debug("Attempting to execute single replacement")
err := m.Validate(len(fileDataStr))
if err != nil {
executeLogger.Error("Failed to validate modification: %v", err)
return fileDataStr, fmt.Errorf("failed to validate modification: %v", err)
}
executeLogger.Trace("Applying replacement: fileDataStr[:%d] + %q + fileDataStr[%d:]", m.From, m.With, m.To)
result := fileDataStr[:m.From] + m.With + fileDataStr[m.To:]
executeLogger.Trace("Replacement executed. Result length: %d", len(result))
return result, nil
}
func (m *ReplaceCommand) Validate(maxsize int) error {
validateLogger := replaceCommandLogger.WithPrefix("Validate").WithField("modification", fmt.Sprintf("From:%d,To:%d,With:%q", m.From, m.To, m.With)).WithField("maxSize", maxsize)
validateLogger.Debug("Validating replacement command against max size")
if m.To < m.From {
validateLogger.Error("Validation failed: 'To' (%d) is less than 'From' (%d)", m.To, m.From)
return fmt.Errorf("command to is less than from: %v", m)
}
if m.From > maxsize || m.To > maxsize {
validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is greater than max size (%d)", m.From, m.To, maxsize)
return fmt.Errorf("command from or to is greater than replacement length: %v", m)
}
if m.From < 0 || m.To < 0 {
validateLogger.Error("Validation failed: 'From' (%d) or 'To' (%d) is less than 0", m.From, m.To)
return fmt.Errorf("command from or to is less than 0: %v", m)
}
validateLogger.Debug("Modification command validated successfully")
return nil
}

View File

@@ -0,0 +1,504 @@
package utils
import (
"testing"
"github.com/stretchr/testify/assert"
)
func TestReplaceCommandExecute(t *testing.T) {
tests := []struct {
name string
input string
command ReplaceCommand
expected string
shouldError bool
}{
{
name: "Simple replacement",
input: "This is a test string",
command: ReplaceCommand{From: 5, To: 7, With: "was"},
expected: "This was a test string",
shouldError: false,
},
{
name: "Replace at beginning",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 5, With: "Hi"},
expected: "Hi world",
shouldError: false,
},
{
name: "Replace at end",
input: "Hello world",
command: ReplaceCommand{From: 6, To: 11, With: "everyone"},
expected: "Hello everyone",
shouldError: false,
},
{
name: "Replace entire string",
input: "Hello world",
command: ReplaceCommand{From: 0, To: 11, With: "Goodbye!"},
expected: "Goodbye!",
shouldError: false,
},
{
name: "Error: From > To",
input: "Test string",
command: ReplaceCommand{From: 7, To: 5, With: "fail"},
expected: "Test string",
shouldError: true,
},
{
name: "Error: From > string length",
input: "Test",
command: ReplaceCommand{From: 10, To: 12, With: "fail"},
expected: "Test",
shouldError: true,
},
{
name: "Error: To > string length",
input: "Test",
command: ReplaceCommand{From: 2, To: 10, With: "fail"},
expected: "Test",
shouldError: true,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
result, err := tc.command.Execute(tc.input)
if tc.shouldError {
if err == nil {
t.Errorf("Expected an error for command %+v but got none", tc.command)
}
} else {
if err != nil {
t.Errorf("Unexpected error: %v", err)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
}
})
}
}
func TestExecuteModifications(t *testing.T) {
tests := []struct {
name string
input string
modifications []ReplaceCommand
expected string
expectedCount int
}{
{
name: "Single modification",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
},
expected: "Hi world",
expectedCount: 1,
},
{
name: "Multiple modifications",
input: "This is a test string",
modifications: []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 8, To: 14, With: "sample"},
},
expected: "That is sample string",
expectedCount: 2,
},
{
name: "Overlapping modifications",
input: "ABCDEF",
modifications: []ReplaceCommand{
{From: 0, To: 3, With: "123"}, // ABC -> 123
{From: 2, To: 5, With: "xyz"}, // CDE -> xyz
},
// The actual behavior with the current implementation
expected: "123yzF",
expectedCount: 2,
},
{
name: "Sequential modifications",
input: "Hello world",
modifications: []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 5, To: 6, With: ""}, // Remove the space
{From: 6, To: 11, With: "everyone"},
},
expected: "Hieveryone",
expectedCount: 3,
},
}
for _, tc := range tests {
t.Run(tc.name, func(t *testing.T) {
// Make a copy of the modifications to avoid modifying the test case
mods := make([]ReplaceCommand, len(tc.modifications))
copy(mods, tc.modifications)
result, count := ExecuteModifications(mods, tc.input)
if count != tc.expectedCount {
t.Errorf("Expected %d modifications, got %d", tc.expectedCount, count)
}
if result != tc.expected {
t.Errorf("Expected %q, got %q", tc.expected, result)
}
})
}
}
func TestReverseOrderExecution(t *testing.T) {
// This test verifies the current behavior of modification application
input := "Original text with multiple sections"
// Modifications in specific positions
modifications := []ReplaceCommand{
{From: 0, To: 8, With: "Modified"}, // Original -> Modified
{From: 9, To: 13, With: "document"}, // text -> document
{From: 14, To: 22, With: "without"}, // with -> without
{From: 23, To: 31, With: "any"}, // multiple -> any
}
// The actual current behavior of our implementation
expected := "Modified document withouttanytions"
result, count := ExecuteModifications(modifications, input)
if count != 4 {
t.Errorf("Expected 4 modifications, got %d", count)
}
if result != expected {
t.Errorf("Expected %q, got %q", expected, result)
}
}
// Replace text in the middle of a string with new content
func TestReplaceCommandExecute_ReplacesTextInMiddle(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello replaced, how are you?", result)
}
// Replace with empty string (deletion)
func TestReplaceCommandExecute_DeletesText(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello , how are you?", result)
}
// Replace with longer string than original segment
func TestReplaceCommandExecute_WithLongerString(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 6,
To: 11,
With: "longerreplacement",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Hello longerreplacement, how are you?", result)
}
// From and To values are the same (zero-length replacement)
func TestReplaceCommandExecute_ZeroLengthReplacement(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 5,
With: "inserted",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.NoError(t, err)
assert.Equal(t, "Helloinserted world", result)
}
// From value is greater than To value
func TestReplaceCommandExecute_FromGreaterThanTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 10,
To: 5,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// From or To values exceed string length
func TestReplaceCommandExecute_FromOrToExceedsLength(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: 5,
To: 50, // Exceeds the length of the fileContent
With: "replaced",
}
fileContent := "Hello world"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world", result)
}
// From or To values are negative
func TestReplaceCommandExecute_NegativeFromOrTo(t *testing.T) {
// Arrange
cmd := &ReplaceCommand{
From: -1,
To: 10,
With: "replaced",
}
fileContent := "Hello world, how are you?"
// Act
result, err := cmd.Execute(fileContent)
// Assert
assert.Error(t, err)
assert.Equal(t, "Hello world, how are you?", result)
}
// Modifications are applied in reverse order (from highest to lowest 'From' value)
func TestExecuteModificationsAppliesInReverseOrder(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 0, To: 4, With: "That"},
{From: 10, To: 14, With: "sample"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a sample string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// One or more modifications fail but others succeed
func TestExecuteModificationsWithPartialFailures(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
// Create a custom ReplaceCommand implementation that will fail
failingCommand := ReplaceCommand{
From: 15,
To: 10, // Invalid range (To < From) to cause failure
With: "will fail",
}
// Valid commands
validCommand1 := ReplaceCommand{
From: 0,
To: 4,
With: "That",
}
validCommand2 := ReplaceCommand{
From: 26,
To: 38,
With: "modifications",
}
modifications := []ReplaceCommand{failingCommand, validCommand1, validCommand2}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "That is a test string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
// Only 2 out of 3 modifications should succeed
if executed != 2 {
t.Errorf("Expected 2 modifications to be executed successfully, but got %d", executed)
}
}
// All valid modifications are executed and the modified string is returned
func TestExecuteModificationsAllValid(t *testing.T) {
// Setup test data
fileData := "Hello world, this is a test"
modifications := []ReplaceCommand{
{From: 0, To: 5, With: "Hi"},
{From: 18, To: 20, With: "was"},
{From: 21, To: 27, With: "an example"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "Hi world, this was an example"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// The count of successfully executed modifications is returned
func TestExecuteModificationsReturnsCorrectCount(t *testing.T) {
// Setup test data
fileData := "Initial text for testing"
modifications := []ReplaceCommand{
{From: 0, To: 7, With: "Final"},
{From: 12, To: 16, With: "example"},
{From: 17, To: 24, With: "process"},
}
// Execute the function
_, executed := ExecuteModifications(modifications, fileData)
// Verify the count of executed modifications
expectedExecuted := 3
if executed != expectedExecuted {
t.Errorf("Expected %d modifications to be executed, but got %d", expectedExecuted, executed)
}
}
// Empty modifications list returns the original string with zero executed count
func TestExecuteModificationsWithEmptyList(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
if result != fileData {
t.Errorf("Expected result to be %q, but got %q", fileData, result)
}
if executed != 0 {
t.Errorf("Expected 0 modifications to be executed, but got %d", executed)
}
}
// Modifications with identical 'From' values
func TestExecuteModificationsWithIdenticalFromValues(t *testing.T) {
// Setup test data
fileData := "This is a test string for replacements"
modifications := []ReplaceCommand{
{From: 10, To: 14, With: "sample"},
{From: 10, To: 14, With: "example"},
{From: 26, To: 38, With: "modifications"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
// Yes, it's mangled, yes, it's intentional
// Every subsequent command works with the modified contents of the previous command
// So by the time we get to "example" the indices have already eaten into "sample"... In fact they have eaten into "samp", "le" is left
// So we prepend "example" and end up with "examplele"
// Whether sample or example goes first here is irrelevant to us
// But it just so happens that sample goes first, so we end up with "examplele"
expectedResult := "This is a examplele string for modifications"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}
// Modifications that would affect each other if not sorted properly
func TestExecuteModificationsHandlesOverlappingRanges(t *testing.T) {
// Setup test data
fileData := "The quick brown fox jumps over the lazy dog"
modifications := []ReplaceCommand{
{From: 4, To: 9, With: "slow"},
{From: 10, To: 15, With: "red"},
{From: 16, To: 19, With: "cat"},
}
// Execute the function
result, executed := ExecuteModifications(modifications, fileData)
// Verify results
expectedResult := "The slow red cat jumps over the lazy dog"
if result != expectedResult {
t.Errorf("Expected result to be %q, but got %q", expectedResult, result)
}
if executed != 3 {
t.Errorf("Expected 3 modifications to be executed, but got %d", executed)
}
}